HHsearch alignment for GI: 254780263 and conserved domain: cd04153

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus. Arl5 is developmentally regulated during embryogenesis in mice. Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion. Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library. It is found in brain, heart, lung, cartilage, and kidney. No function has been assigned for Arl8 to date.
Probab=99.28  E-value=1.9e-11  Score=90.06  Aligned_cols=144  Identities=18%  Similarity=0.123  Sum_probs=91.4

Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHH
Q ss_conf             38827999990468988789999998764442001312686869862920637899982199089998478730246779
Q gi|254780263|r    9 NKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNM   88 (392)
Q Consensus         9 ~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~m   88 (392)
T Consensus        12 ~~k~~KililG~~~sGKTsil~~l~~~~---------~~~------~~pT~G~~~~~i~~~~~~~~iwD~~G~e~~~~~~   76 (174)
T cd04153          12 PRKEYKVIIVGLDNAGKTTILYQFLLGE---------VVH------TSPTIGSNVEEIVYKNIRFLMWDIGGQESLRSSW   76 (174)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHCCC---------CCC------CCCCCCCCEEEEEECCEEEEEEECCCCCCCCCHH
T ss_conf             8977999999899998899999997399---------277------1672360469999788899999899986566226


Q ss_pred             HHHHHCCCCEEEEECCCCC-CCCCHHHHHH-HHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCC-EEEEEEEEEEE
Q ss_conf             8774002331452012344-3321067788-8863---187602331002333561222110123210-01110145322
Q gi|254780263|r   89 ITGATQADGAILVCAAEDG-PKPQTREHIL-LARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIR-DLLKEHKYSDD  162 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G-~~~QT~eh~~-l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~-~~l~~~~~~~~  162 (392)
T Consensus        77 ~~y~~~a~~ii~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~p-ili~~NK~Dl~~~~~-~~ei~~~l~l~~~~----~~~  150 (174)
T cd04153          77 NTYYTNTDAVILVIDSTDRERLPLTKEELYKMLAHEDLRKAV-LLVLANKQDLKGAMT-PAEISESLGLTSIR----DHT  150 (174)
T ss_pred             HHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCC-EEEEEECCCCCCCCC-HHHHHHHHHHHHHH----CCC
T ss_conf             777057753799997678889999999999997261016982-899995555655789-99999997477763----598


Q ss_pred             EECCCCEEEEE
Q ss_conf             10233114676
Q gi|254780263|r  163 TPIIRGSALCA  173 (392)
Q Consensus       163 ~pii~~sa~~g  173 (392)
T Consensus       151 ~~~~~~SAktG  161 (174)
T cd04153         151 WHIQGCCALTG  161 (174)
T ss_pred             CEEEEEECCCC
T ss_conf             09999668589