HHsearch alignment for GI: 254780263 and conserved domain: cd04176

>cd04176 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Rap subfamily of the Ras family. It consists of Rap2a, Rap2b, and Rap2c. Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton. In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments. In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway. The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis. Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation. A number of additional effector proteins for Rap2 have been identified, incl
Probab=98.76  E-value=2.9e-08  Score=70.31  Aligned_cols=138  Identities=23%  Similarity=0.229  Sum_probs=80.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE-EEEEEEEE--CCCEEEEEEECCCCHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206-37899982--1990899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI-ATAHVSYE--TDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi-~~~~~~~~--~~~~~i~iiD~PGH~~f~~~mi   89 (392)
T Consensus         2 ~KivllGd~~VGKTsli~r~~~~~------------f~~~y--~pTi~~~~~k~i~~~~~~~~l~iwDtaG~e~~~~~~~   67 (163)
T cd04176           2 YKVVVLGSGGVGKSALTVQFVSGT------------FIEKY--DPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRD   67 (163)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCC------------CCCCC--CCCCCCEEEEEEEECCEEEEEEEEECCCCHHHHHHHH
T ss_conf             399998999978999999997098------------99755--8852331679999888999999998988542567889


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHH-----HHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             7740023314520123443321067788-----8863---1876023310023335612221101232100111014532
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHIL-----LARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~~-----l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
T Consensus        68 ~~~~~a~~~ilvydit~~---~Sf~~l~~~~~~i~~~~~~~~~p-iilVgNK~DL~~~r~---V~~~e~~~~a~~~----  136 (163)
T cd04176          68 LYIKNGQGFIVVYSLVNQ---QTFQDIKPMRDQIVRVKGYEKVP-IILVGNKVDLESERE---VSSAEGRALAEEW----  136 (163)
T ss_pred             HHHCCCCEEEEEECCCCH---HHHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCCCCCCC---CCHHHHHHHHHHC----
T ss_conf             985578656897127988---99999999999999973899963-999743134001276---9999999999985----


Q ss_pred             EEECCCCEEEEEEE
Q ss_conf             21023311467641
Q gi|254780263|r  162 DTPIIRGSALCALQ  175 (392)
Q Consensus       162 ~~pii~~sa~~g~~  175 (392)
T Consensus       137 ~~~~~E~SAk~~~n  150 (163)
T cd04176         137 GCPFMETSAKSKTM  150 (163)
T ss_pred             CCEEEEECCCCCCC
T ss_conf             99899985687817