Query         gi|254780263|ref|YP_003064676.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 392
No_of_seqs    158 out of 6852
Neff          8.0 
Searched_HMMs 39220
Date          Tue May 24 11:39:26 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780263.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK00049 elongation factor Tu; 100.0       0       0  749.7  30.7  391    1-392     1-397 (397)
  2 PRK12735 elongation factor Tu; 100.0       0       0  748.0  30.2  391    1-392     1-396 (396)
  3 TIGR00483 EF-1_alpha translati 100.0       0       0  755.8  14.1  374    7-391     2-441 (445)
  4 PRK12736 elongation factor Tu; 100.0       0       0  736.9  28.3  388    1-392     1-394 (394)
  5 CHL00071 tufA elongation facto 100.0       0       0  725.9  29.7  391    1-392     1-409 (409)
  6 PRK12317 elongation factor 1-a 100.0       0       0  702.7  29.9  377    7-392     2-423 (426)
  7 PTZ00336 elongation factor 1-a 100.0       0       0  695.2  30.3  377    7-392     2-431 (449)
  8 PTZ00141 elongation factor 1 a 100.0       0       0  695.3  29.8  377    7-392     2-429 (443)
  9 PRK05124 cysN sulfate adenylyl 100.0       0       0  685.2  27.7  373    8-392    23-439 (475)
 10 COG5256 TEF1 Translation elong 100.0       0       0  681.4  26.7  376    8-392     3-428 (428)
 11 KOG0460 consensus              100.0       0       0  684.4  19.0  389    3-392    45-438 (449)
 12 COG0050 TufB GTPases - transla 100.0       0       0  673.5  23.8  389    1-392     1-394 (394)
 13 PRK05506 bifunctional sulfate  100.0       0       0  625.0  28.3  369    8-389     3-415 (613)
 14 PRK04000 translation initiatio 100.0       0       0  608.2  25.2  354    5-388     1-410 (410)
 15 PRK10512 selenocysteinyl-tRNA- 100.0       0       0  601.8  24.7  335   14-390     2-340 (615)
 16 TIGR02034 CysN sulfate adenyly 100.0       0       0  603.6  17.4  360   13-387     1-411 (411)
 17 TIGR00485 EF-Tu translation el 100.0       0       0  574.5  15.3  389    1-392     1-394 (394)
 18 KOG0458 consensus              100.0       0       0  555.9  20.8  376    8-392   173-603 (603)
 19 PTZ00327 eukaryotic translatio 100.0       0       0  551.2  22.1  358    5-391    30-456 (460)
 20 TIGR00475 selB selenocysteine- 100.0       0       0  544.8  19.1  351   13-390     1-357 (627)
 21 COG2895 CysN GTPases - Sulfate 100.0       0       0  536.7  21.9  369    8-391     2-416 (431)
 22 TIGR01394 TypA_BipA GTP-bindin 100.0       0       0  539.5  10.1  331   14-358     3-357 (609)
 23 KOG0459 consensus              100.0       0       0  524.9  17.9  373    9-392    76-501 (501)
 24 COG3276 SelB Selenocysteine-sp 100.0       0       0  464.4  19.3  335   14-389     2-338 (447)
 25 COG5258 GTPBP1 GTPase [General 100.0       0       0  459.9  15.1  363    9-391   114-527 (527)
 26 PRK10218 GTP-binding protein;  100.0       0       0  456.1  14.0  282   14-302     7-299 (607)
 27 COG1217 TypA Predicted membran 100.0       0       0  437.3  11.2  316   13-342     6-332 (603)
 28 COG5257 GCD11 Translation init 100.0       0       0  416.3  19.6  350   10-389     8-413 (415)
 29 TIGR01393 lepA GTP-binding pro 100.0       0       0  412.0  12.0  265   14-297     5-282 (598)
 30 cd01884 EF_Tu EF-Tu subfamily. 100.0       0       0  398.4  10.8  190   11-200     1-195 (195)
 31 cd01883 EF1_alpha Eukaryotic e 100.0       0       0  388.7  13.2  186   14-200     1-218 (219)
 32 cd04166 CysN_ATPS CysN_ATPS su 100.0       0       0  388.9  12.6  185   14-200     1-207 (208)
 33 PRK05433 GTP-binding protein L 100.0       0       0  389.2  12.1  273    1-296     1-282 (601)
 34 KOG0463 consensus              100.0       0       0  379.0  14.3  359   13-391   134-547 (641)
 35 PRK13351 elongation factor G;  100.0       0       0  352.2  16.8  265   14-296    10-391 (687)
 36 KOG0462 consensus              100.0       0       0  357.8  12.0  261   14-295    62-332 (650)
 37 PRK00007 elongation factor G;  100.0       0       0  350.0  16.9  276   14-297    12-397 (693)
 38 PRK00741 prfC peptide chain re 100.0       0       0  348.6  16.3  265   14-296    12-381 (526)
 39 PRK12740 elongation factor G;  100.0       0       0  349.3  15.6  261   18-296     1-376 (670)
 40 cd01891 TypA_BipA TypA (tyrosi 100.0       0       0  350.6  11.8  184   14-200     4-194 (194)
 41 PRK12739 elongation factor G;  100.0       0       0  343.1  16.3  276   14-297    12-395 (693)
 42 KOG1143 consensus              100.0       0       0  341.8  15.2  360   13-391   168-583 (591)
 43 cd01888 eIF2_gamma eIF2-gamma  100.0       0       0  347.1   6.9  169   13-202     1-203 (203)
 44 COG0480 FusA Translation elong 100.0       0       0  334.9  16.9  276   11-295     9-392 (697)
 45 cd01889 SelB_euk SelB subfamil 100.0       0       0  342.0  10.5  172   13-201     1-189 (192)
 46 PRK07560 elongation factor EF- 100.0       0       0  335.6  13.6  276   13-296    21-376 (730)
 47 KOG0461 consensus              100.0       0       0  335.3  12.3  342   10-371     5-380 (522)
 48 COG0481 LepA Membrane GTPase L 100.0       0       0  330.2  13.1  262   14-294    11-282 (603)
 49 KOG0466 consensus              100.0       0       0  334.7   2.7  354    6-389    32-458 (466)
 50 KOG0052 consensus              100.0       0       0  326.6   8.4  325    7-392     2-373 (391)
 51 TIGR00484 EF-G translation elo 100.0       0       0  323.0   4.5  268   13-297    11-404 (705)
 52 cd00881 GTP_translation_factor 100.0       0       0  313.9  11.4  175   14-200     1-189 (189)
 53 PRK12312 infB translation init 100.0 2.8E-45       0  299.4  11.4  238    7-275   113-354 (610)
 54 cd01890 LepA LepA subfamily.   100.0 2.8E-45       0  300.0   9.8  170   14-200     2-179 (179)
 55 CHL00189 infB translation init 100.0 1.3E-44       0  295.8  12.5  250    8-292   269-527 (770)
 56 COG4108 PrfC Peptide chain rel 100.0 2.1E-44       0  294.4  13.3  273   14-295    14-382 (528)
 57 pfam00009 GTP_EFTU Elongation  100.0 2.7E-44       0  293.8  11.2  178   10-199     1-185 (185)
 58 KOG0465 consensus              100.0 1.3E-44       0  295.9   6.4  264   12-295    39-421 (721)
 59 PRK05306 infB translation init 100.0 3.9E-43       0  286.5  13.3  251    7-292   337-593 (839)
 60 cd04167 Snu114p Snu114p subfam 100.0   4E-43       0  286.5  10.6  184   14-200     2-213 (213)
 61 cd01885 EF2 EF2 (for archaea a 100.0 2.9E-42       0  281.1  12.0  184   14-200     2-222 (222)
 62 PRK04004 translation initiatio 100.0 7.4E-42       0  278.6  11.1  223   11-258     5-281 (592)
 63 cd04171 SelB SelB subfamily.   100.0 4.6E-42       0  279.9   9.5  161   14-195     2-163 (164)
 64 TIGR00503 prfC peptide chain r 100.0 4.8E-42       0  279.8   9.2  301   14-326    13-416 (530)
 65 cd04165 GTPBP1_like GTPBP1-lik 100.0 4.4E-42       0  280.0   7.5  144   14-159     1-172 (224)
 66 cd04168 TetM_like Tet(M)-like  100.0 2.5E-40 5.6E-45  269.1  10.6  137   14-155     1-145 (237)
 67 COG0532 InfB Translation initi 100.0 4.3E-39 1.1E-43  261.4  11.9  211   10-246     4-220 (509)
 68 cd04170 EF-G_bact Elongation f 100.0 5.3E-39 1.3E-43  260.9  12.1  150   14-166     1-156 (268)
 69 KOG1145 consensus              100.0 1.7E-38 4.5E-43  257.7  11.0  236    9-275   151-391 (683)
 70 cd04169 RF3 RF3 subfamily.  Pe 100.0 1.3E-37 3.3E-42  252.3  12.0  139   14-155     4-152 (267)
 71 cd01886 EF-G Elongation factor 100.0 1.7E-37 4.2E-42  251.6  12.2  134   14-148     1-142 (270)
 72 TIGR00490 aEF-2 translation el 100.0 1.7E-37 4.4E-42  251.5   9.9  276   14-295    21-374 (724)
 73 KOG0469 consensus              100.0 4.9E-36 1.3E-40  242.5   9.4  282    9-293    16-472 (842)
 74 KOG0464 consensus              100.0 1.7E-35 4.3E-40  239.2   3.3  266   14-294    39-418 (753)
 75 KOG0467 consensus              100.0 1.1E-31 2.8E-36  215.5  13.7  125   11-136     7-136 (887)
 76 cd01887 IF2_eIF5B IF2/eIF5B (i 100.0 3.5E-32 8.8E-37  218.6   9.1  157   14-195     2-163 (168)
 77 KOG1144 consensus              100.0 8.2E-29 2.1E-33  197.7   8.5  231   15-268   478-773 (1064)
 78 KOG0468 consensus              100.0 1.1E-27 2.7E-32  190.8  12.4  124   13-137   129-262 (971)
 79 TIGR00491 aIF-2 translation in  99.9 2.6E-28 6.5E-33  194.6   6.8  224   10-258   549-828 (1145)
 80 TIGR00487 IF-2 translation ini  99.9 2.1E-23 5.3E-28  164.2  10.2  235    8-273    87-327 (594)
 81 cd01895 EngA2 EngA2 subfamily.  99.9   3E-22 7.8E-27  157.0   9.5  159   12-195     2-172 (174)
 82 cd03693 EF1_alpha_II EF1_alpha  99.9 3.1E-23 7.8E-28  163.2   3.3   90  204-296     1-90  (91)
 83 cd03697 EFTU_II EFTU_II: Elong  99.8 3.4E-22 8.6E-27  156.7   3.5   87  208-295     1-87  (87)
 84 TIGR03594 GTPase_EngA ribosome  99.8 1.5E-20 3.8E-25  146.5   9.9  166   15-213     2-178 (429)
 85 pfam03143 GTP_EFTU_D3 Elongati  99.8 7.1E-20 1.8E-24  142.3  12.6   96  296-391     1-97  (97)
 86 PRK00093 engA GTP-binding prot  99.8   4E-20   1E-24  143.8  10.6  168   14-214     3-179 (438)
 87 PRK09518 bifunctional cytidyla  99.8 3.8E-20 9.7E-25  144.0   9.3  168   14-214   281-459 (714)
 88 PRK03003 engA GTP-binding prot  99.8 6.7E-20 1.7E-24  142.5   8.7  168   14-214    40-218 (474)
 89 cd01876 YihA_EngB The YihA (En  99.8 9.5E-20 2.4E-24  141.5   9.0  155   15-196     2-169 (170)
 90 cd04089 eRF3_II eRF3_II: domai  99.8 8.6E-21 2.2E-25  148.0   3.6   82  207-293     1-82  (82)
 91 cd03696 selB_II selB_II: this   99.8 7.9E-21   2E-25  148.2   3.2   83  208-293     1-83  (83)
 92 cd03698 eRF3_II_like eRF3_II_l  99.8 1.2E-20   3E-25  147.1   3.5   83  207-293     1-83  (83)
 93 PRK00089 era GTP-binding prote  99.8 1.2E-19   3E-24  140.9   8.6  172   14-214    10-195 (296)
 94 cd04163 Era Era subfamily.  Er  99.8 3.9E-19   1E-23  137.7   9.1  156   13-196     4-167 (168)
 95 cd03694 GTPBP_II Domain II of   99.8 3.7E-20 9.5E-25  144.0   3.3   86  208-293     1-87  (87)
 96 cd00880 Era_like Era (E. coli   99.8 1.5E-19 3.8E-24  140.3   6.0  153   17-195     1-161 (163)
 97 COG1160 Predicted GTPases [Gen  99.8 6.2E-19 1.6E-23  136.5   8.2  168   14-214     5-185 (444)
 98 cd03706 mtEFTU_III Domain III   99.8 4.9E-18 1.3E-22  130.9  10.0   93  298-390     1-93  (93)
 99 cd01894 EngA1 EngA1 subfamily.  99.8 3.6E-18 9.3E-23  131.7   9.3  148   16-196     1-156 (157)
100 PRK00093 engA GTP-binding prot  99.8   8E-18   2E-22  129.6  10.4  153    9-176   169-333 (438)
101 pfam10662 PduV-EutP Ethanolami  99.7 1.5E-18 3.8E-23  134.1   5.5  135   14-193     3-141 (143)
102 TIGR03598 GTPase_YsxC ribosome  99.7 5.5E-18 1.4E-22  130.6   7.9  147   11-174    17-176 (179)
103 PRK00454 engB GTPase EngB; Rev  99.7 7.7E-18   2E-22  129.7   8.2  159   12-197    24-195 (196)
104 TIGR03594 GTPase_EngA ribosome  99.7 2.2E-17 5.6E-22  126.8   9.6  154    8-176   168-332 (429)
105 PRK03003 engA GTP-binding prot  99.7 3.7E-17 9.3E-22  125.5   9.9  150   11-176   210-370 (474)
106 cd04093 HBS1_C HBS1_C: this fa  99.7 8.1E-17 2.1E-21  123.3  11.6   87  299-390     2-107 (107)
107 cd04164 trmE TrmE (MnmE, ThdF,  99.7 4.6E-17 1.2E-21  124.8  10.0  145   13-195     2-154 (157)
108 cd03707 EFTU_III Domain III of  99.7 3.3E-17 8.4E-22  125.7   9.2   90  298-387     1-90  (90)
109 COG1159 Era GTPase [General fu  99.7 5.8E-17 1.5E-21  124.3   8.6  174   13-214     7-194 (298)
110 pfam02421 FeoB_N Ferrous iron   99.7 1.5E-16 3.9E-21  121.6   9.0  153   14-199     1-161 (188)
111 PRK09518 bifunctional cytidyla  99.7   2E-16 5.2E-21  120.9   9.1  150   12-177   452-612 (714)
112 cd03704 eRF3c_III This family   99.7 4.2E-16 1.1E-20  118.9  10.3   87  299-390     2-108 (108)
113 cd03705 EF1_alpha_III Domain I  99.7 7.8E-16   2E-20  117.2  10.8   84  299-387     2-104 (104)
114 cd01513 Translation_factor_III  99.7 6.3E-16 1.6E-20  117.8  10.2   85  298-387     1-102 (102)
115 PRK04213 GTP-binding protein;   99.6   8E-16   2E-20  117.2   9.0  159   14-202     3-188 (195)
116 cd03695 CysN_NodQ_II CysN_NodQ  99.6   1E-16 2.5E-21  122.8   3.8   81  208-293     1-81  (81)
117 cd01878 HflX HflX subfamily.    99.6 1.6E-15 4.2E-20  115.3   9.5  154    8-195    36-202 (204)
118 cd01879 FeoB Ferrous iron tran  99.6 6.1E-16 1.6E-20  117.9   7.2  146   17-196     1-155 (158)
119 COG1160 Predicted GTPases [Gen  99.6   1E-15 2.6E-20  116.5   7.0  150   11-175   177-338 (444)
120 cd01898 Obg Obg subfamily.  Th  99.6 2.7E-15 6.9E-20  113.9   7.9  152   14-195     2-168 (170)
121 cd03708 GTPBP_III Domain III o  99.6 3.4E-14 8.6E-19  107.1  11.8   86  298-390     1-87  (87)
122 cd01897 NOG NOG1 is a nucleola  99.6 1.4E-14 3.7E-19  109.4   9.4  150   14-195     2-165 (168)
123 cd04094 selB_III This family r  99.6 9.6E-14 2.5E-18  104.3  12.3   95  288-387     1-97  (97)
124 PRK09554 feoB ferrous iron tra  99.5 3.8E-14 9.8E-19  106.8   7.3  136   12-173     3-153 (772)
125 pfam00025 Arf ADP-ribosylation  99.5 1.1E-13 2.9E-18  103.8   9.3  145    9-174    11-161 (174)
126 cd01881 Obg_like The Obg-like   99.5 1.1E-13 2.7E-18  104.0   8.2  149   17-195     1-174 (176)
127 cd04155 Arl3 Arl3 subfamily.    99.5 3.1E-13 7.9E-18  101.1   8.0  143   10-173    12-160 (173)
128 COG2229 Predicted GTPase [Gene  99.4 8.2E-13 2.1E-17   98.5  10.0  150   13-172    11-162 (187)
129 cd04154 Arl2 Arl2 subfamily.    99.4 5.5E-13 1.4E-17   99.6   8.1  145    8-173    10-160 (173)
130 TIGR00450 thdF tRNA modificati  99.4 2.6E-12 6.6E-17   95.4  11.1  120    6-137   219-346 (473)
131 cd01896 DRG The developmentall  99.4   5E-12 1.3E-16   93.6  10.6   82   14-107     2-90  (233)
132 COG0486 ThdF Predicted GTPase   99.4 6.4E-12 1.6E-16   93.0   9.8  154   10-198   215-376 (454)
133 cd04160 Arfrp1 Arfrp1 subfamil  99.3 3.3E-12 8.3E-17   94.8   7.8  150   14-174     1-155 (167)
134 COG0370 FeoB Fe2+ transport sy  99.3 3.3E-12 8.5E-17   94.7   7.3  136   13-174     4-150 (653)
135 TIGR03156 GTP_HflX GTP-binding  99.3 1.1E-11 2.7E-16   91.6   9.0  148   13-195   190-349 (351)
136 PRK05291 trmE tRNA modificatio  99.3   2E-11 5.2E-16   89.9   9.7  145   10-197   214-366 (445)
137 pfam01926 MMR_HSR1 GTPase of u  99.3 9.3E-12 2.4E-16   92.0   7.8   98   24-133     1-106 (106)
138 cd00878 Arf_Arl Arf (ADP-ribos  99.3   8E-12   2E-16   92.4   7.1  139   15-174     2-146 (158)
139 cd04153 Arl5_Arl8 Arl5/Arl8 su  99.3 1.9E-11 4.8E-16   90.1   8.6  144    9-173    12-161 (174)
140 COG0218 Predicted GTPase [Gene  99.3 2.9E-11 7.4E-16   88.9   9.6  118   13-144    25-155 (200)
141 TIGR00437 feoB ferrous iron tr  99.3 3.7E-12 9.4E-17   94.5   4.0  129   19-174     1-142 (733)
142 cd03691 BipA_TypA_II BipA_TypA  99.2 3.4E-12 8.8E-17   94.6   3.3   82  208-293     1-86  (86)
143 TIGR00231 small_GTP small GTP-  99.2 2.6E-11 6.7E-16   89.2   6.8  153   13-172     4-173 (186)
144 cd01882 BMS1 Bms1.  Bms1 is an  99.2 6.9E-11 1.8E-15   86.6   8.5  144   10-172    37-180 (225)
145 cd04157 Arl6 Arl6 subfamily.    99.2 6.6E-11 1.7E-15   86.7   7.7  141   14-173     1-149 (162)
146 pfam00071 Ras Ras family. Incl  99.2 4.4E-11 1.1E-15   87.8   6.7  139   14-175     1-148 (162)
147 cd04159 Arl10_like Arl10-like   99.2 7.2E-11 1.8E-15   86.5   7.4  140   15-174     2-147 (159)
148 cd04149 Arf6 Arf6 subfamily.    99.2 6.3E-11 1.6E-15   86.8   7.1  144   10-174     7-156 (168)
149 cd00879 Sar1 Sar1 subfamily.    99.2 2.2E-10 5.6E-15   83.5   9.4  146   10-173    17-176 (190)
150 smart00177 ARF ARF-like small   99.1 2.7E-10 6.8E-15   82.9   8.9  143   10-174    11-160 (175)
151 PRK11058 putative GTPase HflX;  99.1 1.3E-10 3.4E-15   84.8   7.2  165   13-213   198-375 (426)
152 cd04150 Arf1_5_like Arf1-Arf5-  99.1 3.2E-10   8E-15   82.5   8.1  139   13-173     1-146 (159)
153 cd04151 Arl1 Arl1 subfamily.    99.1 2.7E-10   7E-15   82.9   7.6  139   15-174     2-146 (158)
154 PTZ00133 ADP-ribosylation fact  99.1 4.4E-10 1.1E-14   81.6   8.5  143   10-173    15-163 (182)
155 cd00882 Ras_like_GTPase Ras-li  99.1 1.4E-10 3.5E-15   84.7   5.9  139   17-174     1-146 (157)
156 COG2262 HflX GTPases [General   99.1 3.9E-10   1E-14   81.9   7.7  154   11-198   191-356 (411)
157 TIGR02528 EutP ethanolamine ut  99.1 2.4E-10   6E-15   83.3   6.0  136   14-194     2-143 (144)
158 PRK12299 obgE GTPase ObgE; Rev  99.1   4E-10   1E-14   81.8   7.1  150   14-197   160-326 (334)
159 cd04095 CysN_NoDQ_III TCysN_No  99.0 2.5E-09 6.3E-14   76.9  10.3   83  299-387     2-103 (103)
160 COG1084 Predicted GTPase [Gene  99.0 1.9E-09 4.9E-14   77.6   9.6  115   14-141   170-297 (346)
161 cd00154 Rab Rab family.  Rab G  99.0   7E-10 1.8E-14   80.3   7.3  139   13-174     1-148 (159)
162 cd04156 ARLTS1 ARLTS1 subfamil  99.0 8.2E-10 2.1E-14   79.9   7.1  139   15-174     2-148 (160)
163 pfam09439 SRPRB Signal recogni  99.0 1.9E-09 4.8E-14   77.7   8.4  113    9-139     2-127 (181)
164 cd01863 Rab18 Rab18 subfamily.  99.0 1.4E-09 3.6E-14   78.5   7.0  142   13-175     1-149 (161)
165 PRK12298 obgE GTPase ObgE; Rev  99.0   2E-09   5E-14   77.6   7.6  138   14-174   161-319 (380)
166 cd04161 Arl2l1_Arl13_like Arl2  99.0 1.8E-09 4.7E-14   77.7   7.4  140   15-174     2-149 (167)
167 TIGR02729 Obg_CgtA GTP-binding  99.0 4.6E-09 1.2E-13   75.3   9.5  110   14-137   160-295 (296)
168 pfam03144 GTP_EFTU_D2 Elongati  99.0   4E-10   1E-14   81.8   3.7   70  222-292     1-70  (70)
169 smart00178 SAR Sar1p-like memb  99.0 3.4E-09 8.7E-14   76.1   8.3  146   10-173    15-170 (184)
170 PRK12296 obgE GTPase ObgE; Rev  99.0 2.5E-09 6.4E-14   76.9   7.4  136   13-173   160-325 (495)
171 cd04152 Arl4_Arl7 Arl4/Arl7 su  99.0   2E-09 5.1E-14   77.5   6.8  144   12-174     3-156 (183)
172 cd01860 Rab5_related Rab5-rela  99.0 2.8E-09 7.1E-14   76.6   7.6  153   13-197     2-162 (163)
173 COG5192 BMS1 GTP-binding prote  99.0 9.3E-09 2.4E-13   73.4  10.2  113   10-140    67-179 (1077)
174 KOG1191 consensus               99.0 4.7E-09 1.2E-13   75.2   8.6  121    8-139   264-404 (531)
175 cd04158 ARD1 ARD1 subfamily.    99.0 2.4E-09   6E-14   77.1   7.1  139   15-174     2-147 (169)
176 KOG1423 consensus               98.9 3.5E-09   9E-14   76.0   7.8  117    9-140    69-201 (379)
177 cd04105 SR_beta Signal recogni  98.9 4.7E-09 1.2E-13   75.2   8.4  126   14-153     2-141 (203)
178 cd01342 Translation_Factor_II_  98.9 4.7E-10 1.2E-14   81.4   3.1   83  208-293     1-83  (83)
179 cd04123 Rab21 Rab21 subfamily.  98.9 1.1E-09 2.9E-14   79.1   5.0  142   14-175     2-149 (162)
180 smart00175 RAB Rab subfamily o  98.9 2.6E-09 6.7E-14   76.8   6.7  142   13-174     1-148 (164)
181 PRK12297 obgE GTPase ObgE; Rev  98.9   7E-09 1.8E-13   74.1   8.1  135   14-173   160-314 (429)
182 cd01862 Rab7 Rab7 subfamily.    98.9 2.6E-09 6.6E-14   76.8   5.7  141   13-175     1-154 (172)
183 cd01893 Miro1 Miro1 subfamily.  98.9 5.4E-09 1.4E-13   74.8   7.3  157   13-195     1-161 (166)
184 cd04119 RJL RJL (RabJ-Like) su  98.9 4.1E-09   1E-13   75.6   6.5  144   13-175     1-154 (168)
185 cd04116 Rab9 Rab9 subfamily.    98.9 5.3E-09 1.4E-13   74.9   6.7  143   10-175     3-158 (170)
186 cd04127 Rab27A Rab27a subfamil  98.9   8E-09   2E-13   73.8   7.2  144   13-175     5-164 (180)
187 cd04115 Rab33B_Rab33A Rab33B/R  98.9 1.2E-08 3.1E-13   72.6   8.2  143   12-179     2-157 (170)
188 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  98.8 9.7E-09 2.5E-13   73.2   7.0  143   13-175     3-151 (166)
189 cd04145 M_R_Ras_like M-Ras/R-R  98.8 1.2E-08   3E-13   72.8   7.2  142   11-174     1-150 (164)
190 cd04128 Spg1 Spg1p.  Spg1p (se  98.8 1.1E-08 2.8E-13   72.9   7.1  149   13-175     1-153 (182)
191 cd04139 RalA_RalB RalA/RalB su  98.8 6.6E-09 1.7E-13   74.3   5.9  137   14-175     2-149 (164)
192 cd01867 Rab8_Rab10_Rab13_like   98.8   9E-09 2.3E-13   73.4   6.6  143   13-175     4-152 (167)
193 cd00157 Rho Rho (Ras homology)  98.8   1E-08 2.6E-13   73.1   6.7  145   13-175     1-160 (171)
194 cd00876 Ras Ras family.  The R  98.8 1.4E-08 3.5E-13   72.3   7.2  135   15-174     2-147 (160)
195 cd04125 RabA_like RabA-like su  98.8 8.7E-09 2.2E-13   73.6   6.1  145   13-176     1-150 (188)
196 cd04124 RabL2 RabL2 subfamily.  98.8 1.4E-08 3.6E-13   72.3   7.2  140   13-175     1-145 (161)
197 cd04108 Rab36_Rab34 Rab34/Rab3  98.8 1.3E-08 3.2E-13   72.5   6.9  145   14-175     2-152 (170)
198 cd04113 Rab4 Rab4 subfamily.    98.8 1.1E-08 2.7E-13   73.0   6.4  142   14-175     2-149 (161)
199 cd04121 Rab40 Rab40 subfamily.  98.8   1E-08 2.6E-13   73.1   6.2  139   12-175     6-154 (189)
200 cd04162 Arl9_Arfrp2_like Arl9/  98.8 2.1E-08 5.3E-13   71.2   7.5  110   15-139     2-114 (164)
201 cd01868 Rab11_like Rab11-like.  98.8 1.8E-08 4.7E-13   71.5   7.1  141   13-175     4-152 (165)
202 cd03689 RF3_II RF3_II: this su  98.8 2.1E-09 5.3E-14   77.4   2.0   73  217-293    11-84  (85)
203 cd04107 Rab32_Rab38 Rab38/Rab3  98.8 1.1E-08 2.9E-13   72.9   5.7  142   13-175     1-155 (201)
204 cd04104 p47_IIGP_like p47 (47-  98.8 5.9E-09 1.5E-13   74.6   4.3  165   13-202     2-188 (197)
205 cd04122 Rab14 Rab14 subfamily.  98.8 1.7E-08 4.3E-13   71.7   6.1  143   13-175     3-151 (166)
206 cd04176 Rap2 Rap2 subgroup.  T  98.8 2.9E-08 7.4E-13   70.3   7.1  138   13-175     2-150 (163)
207 cd04088 EFG_mtEFG_II EFG_mtEFG  98.8 4.4E-09 1.1E-13   75.4   2.8   78  209-293     2-83  (83)
208 smart00173 RAS Ras subfamily o  98.7 2.7E-08 6.9E-13   70.5   6.7  137   14-175     2-149 (164)
209 cd04106 Rab23_lke Rab23-like s  98.7 2.7E-08   7E-13   70.5   6.7  143   13-175     1-150 (162)
210 cd04112 Rab26 Rab26 subfamily.  98.7 2.1E-08 5.4E-13   71.1   6.1  153   14-196     2-161 (191)
211 cd01861 Rab6 Rab6 subfamily.    98.7   3E-08 7.8E-13   70.2   6.9  145   14-175     2-149 (161)
212 cd01866 Rab2 Rab2 subfamily.    98.7 2.1E-08 5.3E-13   71.2   5.9  141   13-175     5-153 (168)
213 cd04117 Rab15 Rab15 subfamily.  98.7 2.1E-08 5.4E-13   71.1   5.7  140   13-175     1-149 (161)
214 COG1100 GTPase SAR1 and relate  98.7   8E-08   2E-12   67.6   8.5  116   13-141     6-128 (219)
215 cd04110 Rab35 Rab35 subfamily.  98.7 4.6E-08 1.2E-12   69.1   7.2  143   13-174     7-153 (199)
216 cd00877 Ran Ran (Ras-related n  98.7 5.7E-08 1.5E-12   68.5   7.4  138   14-175     2-146 (166)
217 cd04138 H_N_K_Ras_like H-Ras/N  98.7 3.9E-08 9.9E-13   69.5   6.4  136   13-174     2-148 (162)
218 cd04101 RabL4 RabL4 (Rab-like4  98.7 7.8E-08   2E-12   67.6   7.9  142   13-174     1-150 (164)
219 COG3596 Predicted GTPase [Gene  98.7 7.9E-08   2E-12   67.6   7.8  170    8-199    35-223 (296)
220 cd04114 Rab30 Rab30 subfamily.  98.7 3.4E-08 8.6E-13   69.9   5.7  141   13-175     8-156 (169)
221 PTZ00132 GTP-binding nuclear p  98.7 5.8E-08 1.5E-12   68.5   6.8  138   11-176     5-153 (209)
222 cd04177 RSR1 RSR1 subgroup.  R  98.7 2.6E-08 6.6E-13   70.6   5.0  139   13-175     2-151 (168)
223 cd01874 Cdc42 Cdc42 subfamily.  98.7   1E-07 2.6E-12   67.0   7.8  143   12-175     1-162 (175)
224 cd01871 Rac1_like Rac1-like su  98.7 9.2E-08 2.3E-12   67.2   7.4  142   13-175     2-162 (174)
225 cd01864 Rab19 Rab19 subfamily.  98.7   6E-08 1.5E-12   68.3   6.3  141   13-175     4-153 (165)
226 cd04120 Rab12 Rab12 subfamily.  98.7 3.8E-08 9.7E-13   69.6   5.3  141   13-175     1-150 (202)
227 pfam00350 Dynamin_N Dynamin fa  98.7 1.2E-07 3.1E-12   66.4   7.8   62   69-134    99-168 (168)
228 cd01892 Miro2 Miro2 subfamily.  98.7 1.4E-07 3.5E-12   66.1   8.1  143   10-174     2-152 (169)
229 cd04147 Ras_dva Ras-dva subfam  98.7 6.5E-08 1.7E-12   68.1   6.4  152   15-196     2-161 (198)
230 cd04092 mtEFG2_II_like mtEFG2_  98.7 2.1E-08 5.4E-13   71.1   3.8   80  210-293     3-83  (83)
231 cd04132 Rho4_like Rho4-like su  98.6 9.8E-08 2.5E-12   67.0   7.1  144   14-175     2-154 (187)
232 cd04118 Rab24 Rab24 subfamily.  98.6 1.1E-07 2.8E-12   66.7   7.3  142   13-175     1-153 (193)
233 cd04140 ARHI_like ARHI subfami  98.6 8.6E-08 2.2E-12   67.4   6.5  151   13-195     2-162 (165)
234 KOG1489 consensus               98.6 1.4E-07 3.6E-12   66.0   7.6  136   13-173   197-352 (366)
235 cd03699 lepA_II lepA_II: This   98.6 2.7E-08 6.8E-13   70.5   3.8   84  208-292     1-85  (86)
236 cd01875 RhoG RhoG subfamily.    98.6 1.8E-07 4.6E-12   65.4   7.8  154   12-196     3-175 (191)
237 cd01865 Rab3 Rab3 subfamily.    98.6 6.4E-08 1.6E-12   68.2   5.5  144   13-175     2-150 (165)
238 cd04142 RRP22 RRP22 subfamily.  98.6 1.2E-07   3E-12   66.5   6.7  142   13-175     1-161 (198)
239 cd04137 RheB Rheb (Ras Homolog  98.6 7.7E-08   2E-12   67.7   5.7  140   14-175     3-150 (180)
240 PRK13768 GTPase; Provisional    98.6   2E-07 5.1E-12   65.1   7.8  114   14-141     4-179 (253)
241 cd04126 Rab20 Rab20 subfamily.  98.6 1.4E-07 3.5E-12   66.1   6.9  108   13-139     1-115 (220)
242 cd04141 Rit_Rin_Ric Rit/Rin/Ri  98.6 7.9E-08   2E-12   67.6   5.5  152   13-196     3-162 (172)
243 cd01870 RhoA_like RhoA-like su  98.6 1.8E-07 4.5E-12   65.5   7.1  140   14-174     3-161 (175)
244 smart00174 RHO Rho (Ras homolo  98.6 1.1E-07 2.9E-12   66.6   6.1  152   15-195     1-169 (174)
245 cd04175 Rap1 Rap1 subgroup.  T  98.6 1.6E-07   4E-12   65.7   6.6  141   13-175     2-150 (164)
246 cd04130 Wrch_1 Wrch-1 subfamil  98.6 1.7E-07 4.3E-12   65.6   6.5  145   13-175     1-161 (173)
247 cd04133 Rop_like Rop subfamily  98.6 2.4E-07 6.1E-12   64.6   7.1  155   13-195     2-170 (176)
248 cd04144 Ras2 Ras2 subfamily.    98.6 2.3E-07 5.9E-12   64.7   6.8  136   15-175     2-150 (190)
249 cd04136 Rap_like Rap-like subf  98.5 3.2E-07 8.3E-12   63.8   6.9  138   13-175     2-150 (163)
250 pfam03029 ATP_bind_1 Conserved  98.5 3.5E-07 8.8E-12   63.6   7.0  109   17-140     1-170 (234)
251 cd04091 mtEFG1_II_like mtEFG1_  98.5 6.5E-08 1.6E-12   68.1   3.2   76  212-293     5-81  (81)
252 pfam05049 IIGP Interferon-indu  98.5 1.2E-07 3.1E-12   66.4   4.3  169    7-202    30-222 (375)
253 cd03688 eIF2_gamma_II eIF2_gam  98.5 8.4E-08 2.1E-12   67.4   3.0   91  204-294     2-112 (113)
254 cd04135 Tc10 TC10 subfamily.    98.5 4.2E-07 1.1E-11   63.1   6.2  144   13-174     1-160 (174)
255 cd04134 Rho3 Rho3 subfamily.    98.5 7.3E-07 1.9E-11   61.6   7.4  147   14-175     2-161 (189)
256 cd04146 RERG_RasL11_like RERG/  98.5 3.8E-07 9.6E-12   63.4   5.9  149   15-194     2-160 (165)
257 cd04111 Rab39 Rab39 subfamily.  98.4 3.6E-07 9.1E-12   63.5   5.6  140   13-176     3-154 (211)
258 pfam08477 Miro Miro-like prote  98.4 2.8E-06 7.1E-11   58.0   9.4  111   15-135     2-118 (118)
259 pfam03308 ArgK ArgK protein. T  98.4 5.6E-07 1.4E-11   62.3   5.7  171    7-192    24-231 (267)
260 cd04109 Rab28 Rab28 subfamily.  98.4 1.3E-06 3.2E-11   60.1   7.5  136   14-174     2-152 (215)
261 pfam04670 Gtr1_RagA Gtr1/RagA   98.4 1.4E-06 3.7E-11   59.8   7.6  133   15-159     2-149 (230)
262 COG0536 Obg Predicted GTPase [  98.4 2.1E-06 5.3E-11   58.8   7.8  140   13-173   160-318 (369)
263 cd03690 Tet_II Tet_II: This su  98.4 2.7E-07 6.8E-12   64.3   3.1   81  205-293     1-85  (85)
264 cd04148 RGK RGK subfamily.  Th  98.4 1.3E-06 3.3E-11   60.1   6.6  152   14-197     2-162 (221)
265 KOG0073 consensus               98.3 3.7E-06 9.4E-11   57.3   8.7  144    5-173    10-163 (185)
266 cd04174 Rnd1_Rho6 Rnd1/Rho6 su  98.3 3.3E-06 8.5E-11   57.5   7.6  141   13-174    14-173 (232)
267 cd04131 Rnd Rnd subfamily.  Th  98.3 4.2E-06 1.1E-10   56.9   8.0  142   13-175     2-162 (178)
268 cd04129 Rho2 Rho2 subfamily.    98.3 1.3E-06 3.3E-11   60.1   5.4  152   14-196     3-171 (187)
269 COG1163 DRG Predicted GTPase [  98.3 1.5E-06 3.8E-11   59.7   5.7   85   13-109    64-155 (365)
270 cd03700 eEF2_snRNP_like_II EF2  98.2   1E-06 2.6E-11   60.8   3.9   69  220-292    14-92  (93)
271 cd04102 RabL3 RabL3 (Rab-like3  98.2 1.4E-05 3.6E-10   53.6   9.7  113   13-140     1-145 (202)
272 cd04143 Rhes_like Rhes_like su  98.2 2.7E-06 6.9E-11   58.1   6.0  155   14-199     2-172 (247)
273 smart00176 RAN Ran (Ras-relate  98.2 2.2E-06 5.5E-11   58.7   5.2  131   18-176     1-142 (200)
274 KOG0092 consensus               98.2 8.1E-06 2.1E-10   55.2   7.3  158   11-201     4-170 (200)
275 pfam04548 AIG1 AIG1 family. Ar  98.2 2.1E-05 5.3E-10   52.6   9.3  117   13-140     1-132 (200)
276 cd04172 Rnd3_RhoE_Rho8 Rnd3/Rh  98.2 1.1E-05 2.8E-10   54.3   7.7  145   13-175     6-166 (182)
277 TIGR01425 SRP54_euk signal rec  98.1 1.2E-05 3.2E-10   54.0   7.5  126    5-136   115-272 (453)
278 cd04173 Rnd2_Rho7 Rnd2/Rho7 su  98.1 1.5E-05 3.9E-10   53.4   7.8  143   13-176     2-163 (222)
279 pfam00448 SRP54 SRP54-type pro  98.1 4.4E-05 1.1E-09   50.6   9.9  123   11-137     1-153 (196)
280 PRK05306 infB translation init  98.1 2.2E-05 5.6E-10   52.4   8.3   82  209-292   748-829 (839)
281 KOG2486 consensus               98.1 5.4E-05 1.4E-09   50.0  10.2  149   13-175   137-303 (320)
282 cd01849 YlqF_related_GTPase Yl  98.1 5.1E-06 1.3E-10   56.4   4.9   46   96-141     1-46  (155)
283 pfam00735 Septin Septin. Membe  98.1 3.1E-05   8E-10   51.5   8.7  140   12-157     4-173 (280)
284 cd04103 Centaurin_gamma Centau  98.1 7.7E-06   2E-10   55.3   5.5  140   13-175     1-146 (158)
285 COG4917 EutP Ethanolamine util  98.1 5.6E-06 1.4E-10   56.1   4.8  137   14-195     3-143 (148)
286 cd03115 SRP The signal recogni  98.1 3.6E-05 9.1E-10   51.1   8.8  120   15-138     3-153 (173)
287 cd01859 MJ1464 MJ1464.  This f  98.0 6.6E-06 1.7E-10   55.7   4.8   92   87-198     5-96  (156)
288 PRK09435 arginine/ornithine tr  98.0 1.7E-05 4.4E-10   53.1   6.8  170   11-192    48-254 (325)
289 cd01850 CDC_Septin CDC/Septin.  98.0 4.8E-05 1.2E-09   50.4   9.0  140   12-157     4-175 (276)
290 cd01858 NGP_1 NGP-1.  Autoanti  98.0 1.2E-05   3E-10   54.1   5.7   51   90-140     4-55  (157)
291 COG1703 ArgK Putative periplas  98.0 1.6E-05   4E-10   53.3   6.1  167   10-197    50-253 (323)
292 KOG0780 consensus               98.0 3.2E-05 8.1E-10   51.5   7.7  123    5-136    95-252 (483)
293 cd01852 AIG1 AIG1 (avrRpt2-ind  98.0   2E-05 5.1E-10   52.7   6.5  164   13-198     1-184 (196)
294 COG0541 Ffh Signal recognition  98.0 7.1E-05 1.8E-09   49.3   9.2  122    9-137    97-252 (451)
295 COG0378 HypB Ni2+-binding GTPa  98.0 9.4E-06 2.4E-10   54.7   4.4  154    4-173     5-186 (202)
296 PRK12312 infB translation init  98.0 6.5E-06 1.6E-10   55.8   3.4   91  200-292   511-601 (610)
297 KOG0090 consensus               98.0 8.5E-06 2.2E-10   55.0   4.0  127   14-155    40-179 (238)
298 cd01856 YlqF YlqF.  Proteins o  97.9 1.8E-05 4.6E-10   53.0   4.8   83   79-173     3-86  (171)
299 CHL00189 infB translation init  97.9 7.1E-05 1.8E-09   49.3   7.8   81  209-292   679-759 (770)
300 COG5019 CDC3 Septin family pro  97.9 8.4E-05 2.1E-09   48.8   8.1  140   11-156    22-193 (373)
301 PRK00771 signal recognition pa  97.9 0.00011 2.7E-09   48.2   8.3  125    7-137    93-247 (433)
302 PRK06731 flhF flagellar biosyn  97.9 8.1E-05 2.1E-09   49.0   7.5  124    9-138    73-225 (270)
303 pfam05783 DLIC Dynein light in  97.8 1.9E-05 4.8E-10   52.9   4.0  141   13-170    46-265 (490)
304 KOG0076 consensus               97.8 4.5E-05 1.1E-09   50.5   5.4  169    7-196    12-189 (197)
305 smart00053 DYNc Dynamin, GTPas  97.8 0.00016 4.2E-09   47.0   8.0  124   14-140    28-208 (240)
306 cd04090 eEF2_II_snRNP Loc2 eEF  97.8 3.5E-05   9E-10   51.2   4.5   68  222-292    16-93  (94)
307 PRK10867 signal recognition pa  97.8 0.00028   7E-09   45.6   8.9  121   10-136    99-252 (453)
308 KOG1547 consensus               97.7 0.00028 7.1E-09   45.6   8.8  140   11-158    45-217 (336)
309 KOG0394 consensus               97.7  0.0002   5E-09   46.6   7.9  150    8-176     5-166 (210)
310 cd03692 mtIF2_IVc mtIF2_IVc: t  97.7 2.4E-05 6.2E-10   52.2   3.2   81  210-292     3-83  (84)
311 cd01856 YlqF YlqF.  Proteins o  97.7 5.6E-05 1.4E-09   49.9   4.9   57   10-80    113-169 (171)
312 KOG0077 consensus               97.7  0.0002 5.2E-09   46.5   7.6  113   11-139    19-136 (193)
313 cd03114 ArgK-like The function  97.7 0.00014 3.7E-09   47.4   6.7  112   15-135     2-148 (148)
314 PRK10416 cell division protein  97.7 0.00059 1.5E-08   43.6   9.7   30   10-40    294-323 (499)
315 KOG0448 consensus               97.7 0.00021 5.4E-09   46.3   7.4  140   10-152   107-290 (749)
316 KOG0078 consensus               97.6 0.00017 4.3E-09   46.9   6.4  143   11-177    11-163 (207)
317 cd04178 Nucleostemin_like Nucl  97.6 0.00013 3.4E-09   47.6   5.7   46   96-141     1-47  (172)
318 PRK12723 flagellar biosynthesi  97.6  0.0006 1.5E-08   43.6   8.9  121   15-138   177-326 (388)
319 cd01857 HSR1_MMR1 HSR1/MMR1.    97.6 0.00012 3.2E-09   47.8   4.9   56   86-141     3-59  (141)
320 TIGR00750 lao LAO/AO transport  97.6 0.00032   8E-09   45.3   6.9  162   13-197    39-267 (333)
321 PRK06995 flhF flagellar biosyn  97.6 0.00098 2.5E-08   42.2   9.4  122   14-138   178-325 (404)
322 PRK05703 flhF flagellar biosyn  97.5  0.0011 2.9E-08   41.9   9.3  121   14-138   212-359 (412)
323 KOG1532 consensus               97.5 0.00063 1.6E-08   43.4   7.9  126   13-139    20-196 (366)
324 PTZ00099 rab6; Provisional      97.5 0.00013 3.4E-09   47.6   4.3  119   57-197    11-141 (176)
325 COG0532 InfB Translation initi  97.5 6.9E-05 1.8E-09   49.4   2.8   82  210-293   416-497 (509)
326 KOG0098 consensus               97.5 0.00046 1.2E-08   44.3   6.9  143   12-173     6-153 (216)
327 pfam00503 G-alpha G-protein al  97.5  0.0019 4.8E-08   40.5   9.9   26    7-32     23-48  (350)
328 smart00275 G_alpha G protein a  97.5  0.0025 6.3E-08   39.7  10.4   27    6-32     15-41  (342)
329 TIGR00959 ffh signal recogniti  97.5 0.00014 3.7E-09   47.4   4.1  120   10-136   100-259 (439)
330 KOG0070 consensus               97.4 0.00012 3.1E-09   47.8   3.6  144   10-173    15-163 (181)
331 PRK09563 rbgA ribosomal biogen  97.4 0.00031 7.8E-09   45.4   5.5   60   79-141     8-68  (282)
332 KOG1486 consensus               97.4 0.00023 5.8E-09   46.1   4.7   85   12-109    62-154 (364)
333 cd01855 YqeH YqeH.  YqeH is an  97.4 0.00024   6E-09   46.1   4.5  101   82-196    21-123 (190)
334 TIGR03596 GTPase_YlqF ribosome  97.4 0.00016   4E-09   47.2   3.6   83   79-173     5-88  (276)
335 pfam02492 cobW CobW/HypB/UreG,  97.4 0.00068 1.7E-08   43.2   6.7  142   15-167     3-174 (174)
336 TIGR03596 GTPase_YlqF ribosome  97.4 0.00032 8.2E-09   45.2   5.0   58   10-81    116-173 (276)
337 PRK10463 hydrogenase nickel in  97.3 0.00011 2.8E-09   48.1   2.3  148   10-173   102-274 (290)
338 pfam09173 eIF2_C Initiation fa  97.3  0.0015 3.8E-08   41.1   8.0   61  318-387    24-88  (88)
339 PRK09563 rbgA ribosomal biogen  97.3 0.00024 6.1E-09   46.0   3.9   58   10-81    119-176 (282)
340 cd03110 Fer4_NifH_child This p  97.3  0.0024 6.1E-08   39.8   9.0   69   67-138    89-157 (179)
341 COG3640 CooC CO dehydrogenase   97.3   0.001 2.6E-08   42.1   7.0   65   70-137   133-198 (255)
342 TIGR00064 ftsY signal recognit  97.3  0.0016   4E-08   40.9   7.9  150    7-162    78-267 (284)
343 KOG1954 consensus               97.3 0.00087 2.2E-08   42.5   6.4  130   10-142    58-229 (532)
344 KOG0094 consensus               97.3  0.0033 8.4E-08   39.0   9.3  157   13-201    23-188 (221)
345 cd01859 MJ1464 MJ1464.  This f  97.3 0.00054 1.4E-08   43.8   5.2   56   11-80    100-155 (156)
346 TIGR00436 era GTP-binding prot  97.3 0.00096 2.4E-08   42.3   6.4  144   14-174     2-156 (278)
347 PRK12726 flagellar biosynthesi  97.2  0.0017 4.2E-08   40.8   7.4  120   15-137   209-355 (407)
348 cd01854 YjeQ_engC YjeQ/EngC.    97.2  0.0011 2.7E-08   42.0   6.0   72   92-173    76-149 (287)
349 cd01857 HSR1_MMR1 HSR1/MMR1.    97.2 0.00067 1.7E-08   43.3   4.9   57   10-80     81-137 (141)
350 KOG0084 consensus               97.2  0.0021 5.5E-08   40.1   7.4  143   12-174     9-158 (205)
351 KOG1707 consensus               97.1  0.0036 9.2E-08   38.7   8.1  118    9-139     6-130 (625)
352 TIGR00073 hypB hydrogenase acc  97.1 0.00052 1.3E-08   43.9   3.6  155   11-195    33-220 (225)
353 pfam03193 DUF258 Protein of un  97.1  0.0018 4.7E-08   40.5   6.3   65   14-85     37-101 (161)
354 PRK00098 ribosome-associated G  97.1 0.00031 7.9E-09   45.3   2.3   73   92-173    78-152 (298)
355 KOG3886 consensus               97.0 0.00083 2.1E-08   42.7   4.1  118   14-142     6-134 (295)
356 TIGR03348 VI_IcmF type VI secr  97.0  0.0044 1.1E-07   38.2   7.7  121   14-145   113-265 (1169)
357 COG1161 Predicted GTPases [Gen  97.0   0.002   5E-08   40.4   5.7   65   74-141    13-78  (322)
358 PRK01889 ribosome-associated G  97.0   0.002 5.2E-08   40.3   5.8   71   92-173   109-181 (353)
359 cd00066 G-alpha G protein alph  97.0   0.012 3.1E-07   35.4   9.6   85   53-137   143-241 (317)
360 cd01873 RhoBTB RhoBTB subfamil  97.0  0.0018 4.5E-08   40.6   5.3  115   11-137     1-133 (195)
361 cd02036 MinD Bacterial cell di  97.0  0.0049 1.2E-07   37.9   7.5  120   15-136     2-126 (179)
362 KOG0410 consensus               96.9  0.0041   1E-07   38.4   7.0  145   14-198   180-341 (410)
363 KOG1534 consensus               96.9  0.0012   3E-08   41.7   4.2  124   14-139     5-179 (273)
364 KOG2655 consensus               96.9  0.0029 7.3E-08   39.3   5.9  139   12-156    21-189 (366)
365 KOG0075 consensus               96.9  0.0017 4.3E-08   40.8   4.6  113   10-139    18-137 (186)
366 PRK12288 ribosome-associated G  96.8 0.00062 1.6E-08   43.5   2.0   73   92-173   120-195 (344)
367 COG0552 FtsY Signal recognitio  96.8   0.013 3.4E-07   35.2   8.5  120   10-136   138-296 (340)
368 pfam07015 VirC1 VirC1 protein.  96.8  0.0064 1.6E-07   37.2   6.8  114   20-136    10-152 (231)
369 COG1419 FlhF Flagellar GTP-bin  96.7   0.012 3.1E-07   35.4   8.1  124   12-139   203-353 (407)
370 cd01849 YlqF_related_GTPase Yl  96.7  0.0018 4.6E-08   40.6   3.8   57   10-80     98-154 (155)
371 PRK13849 putative crown gall t  96.7  0.0069 1.8E-07   37.0   6.7  119   15-136     4-152 (231)
372 COG1149 MinD superfamily P-loo  96.7  0.0028 7.2E-08   39.4   4.7   81   71-155   164-244 (284)
373 KOG0095 consensus               96.7   0.013 3.4E-07   35.2   8.1  125   10-149     5-137 (213)
374 COG0523 Putative GTPases (G3E   96.7  0.0033 8.5E-08   38.9   4.9  146   16-169     5-183 (323)
375 cd01858 NGP_1 NGP-1.  Autoanti  96.7  0.0027 6.8E-08   39.5   4.4   59    8-80     98-156 (157)
376 TIGR03597 GTPase_YqeH ribosome  96.7  0.0032 8.2E-08   39.0   4.8  111   60-176    29-141 (360)
377 COG1162 Predicted GTPases [Gen  96.7  0.0012 3.1E-08   41.7   2.5   62   94-159    79-142 (301)
378 PRK11889 flhF flagellar biosyn  96.6   0.022 5.6E-07   33.9   8.9   20   14-33    243-262 (436)
379 PRK04004 translation initiatio  96.6  0.0017 4.4E-08   40.7   3.1   76  214-293   474-550 (592)
380 PRK01889 ribosome-associated G  96.6  0.0016 4.2E-08   40.8   2.8   16  232-247   189-204 (353)
381 PRK12727 flagellar biosynthesi  96.5   0.016   4E-07   34.8   7.6   60  218-278   356-422 (557)
382 PRK12289 ribosome-associated G  96.5 0.00094 2.4E-08   42.3   1.3   72   92-173    86-159 (351)
383 PRK09601 translation-associate  96.4   0.012 3.2E-07   35.4   6.4   82   13-106     3-108 (364)
384 TIGR03597 GTPase_YqeH ribosome  96.4  0.0015 3.9E-08   41.0   1.8   19   15-33    157-175 (360)
385 KOG3905 consensus               96.3  0.0052 1.3E-07   37.7   4.2  141   13-170    53-272 (473)
386 cd02042 ParA ParA and ParB of   96.3  0.0072 1.8E-07   36.9   4.9   65   21-106     9-73  (104)
387 KOG2485 consensus               96.3   0.015 3.8E-07   34.9   6.4   71   67-140    18-89  (335)
388 KOG0082 consensus               96.2   0.089 2.3E-06   30.1  10.1   84   54-137   178-275 (354)
389 PRK12288 ribosome-associated G  96.2   0.011 2.9E-07   35.6   5.4   33   70-102    51-85  (344)
390 KOG4252 consensus               96.2  0.0022 5.5E-08   40.1   1.7  133    1-148    12-149 (246)
391 PRK10751 molybdopterin-guanine  96.2  0.0098 2.5E-07   36.0   5.0   58   14-93      4-61  (170)
392 pfam01656 CbiA CobQ/CobB/MinD/  96.2    0.01 2.5E-07   36.0   5.0   71   69-141   111-181 (212)
393 PHA02518 ParA-like protein; Pr  96.2   0.014 3.6E-07   35.0   5.7  120   15-136     3-145 (211)
394 PRK13796 GTP-binding protein Y  96.2   0.013 3.2E-07   35.4   5.4  110   60-175    37-148 (367)
395 PRK12724 flagellar biosynthesi  96.2   0.077   2E-06   30.5   9.5  118   15-138   226-373 (432)
396 KOG0395 consensus               96.2  0.0091 2.3E-07   36.2   4.7  138   13-172     4-149 (196)
397 cd01983 Fer4_NifH The Fer4_Nif  96.1   0.025 6.3E-07   33.6   6.8   74   15-112     2-76  (99)
398 PRK00143 trmU tRNA (5-methylam  96.1   0.045 1.2E-06   31.9   7.9  118  261-391   230-355 (355)
399 PRK13796 GTP-binding protein Y  96.1  0.0034 8.7E-08   38.9   2.1   30   71-103    77-106 (367)
400 KOG0074 consensus               96.0   0.026 6.6E-07   33.4   6.5  109   10-139    15-134 (185)
401 PRK11537 putative GTP-binding   96.0    0.02 5.2E-07   34.0   5.8  125   15-141     7-167 (317)
402 KOG0086 consensus               95.9   0.066 1.7E-06   30.9   8.1  111   13-139    10-129 (214)
403 cd03116 MobB Molybdenum is an   95.9   0.061 1.5E-06   31.1   7.7   50   14-84      3-52  (159)
404 cd03702 IF2_mtIF2_II This fami  95.6   0.011 2.9E-07   35.6   3.1   74  211-293     4-79  (95)
405 KOG0087 consensus               95.6   0.033 8.5E-07   32.7   5.5  139   13-175    15-163 (222)
406 KOG1490 consensus               95.5  0.0062 1.6E-07   37.3   1.5  117   13-141   169-298 (620)
407 KOG3887 consensus               95.5  0.0078   2E-07   36.6   1.9  119    8-141    25-152 (347)
408 TIGR00176 mobB molybdopterin-g  95.4   0.073 1.9E-06   30.6   6.9   24   15-38      2-25  (165)
409 cd03701 IF2_IF5B_II IF2_IF5B_I  95.3   0.019 4.8E-07   34.3   3.4   60  211-275     4-64  (95)
410 KOG1144 consensus               95.3  0.0098 2.5E-07   36.0   2.0   60  215-278   945-1006(1064)
411 KOG2484 consensus               95.2   0.032 8.1E-07   32.9   4.5   70   71-140   122-193 (435)
412 cd02038 FleN-like FleN is a me  95.2   0.059 1.5E-06   31.2   5.8  124   15-154     2-128 (139)
413 cd03112 CobW_like The function  95.2   0.056 1.4E-06   31.4   5.7   21   15-35      3-23  (158)
414 cd01853 Toc34_like Toc34-like   95.2   0.058 1.5E-06   31.2   5.8   61   10-81     29-89  (249)
415 KOG0071 consensus               95.2    0.23   6E-06   27.5   8.7  140   12-173    17-163 (180)
416 TIGR03371 cellulose_yhjQ cellu  95.1    0.21 5.3E-06   27.8   8.4   68   69-138   113-182 (246)
417 TIGR03574 selen_PSTK L-seryl-t  95.1     0.1 2.7E-06   29.7   6.8   98   15-131     2-102 (249)
418 KOG2423 consensus               95.0  0.0079   2E-07   36.6   0.8   46   93-138   212-258 (572)
419 KOG0080 consensus               95.0    0.14 3.7E-06   28.8   7.2  139   11-172    10-158 (209)
420 PRK05480 uridine kinase; Provi  94.9   0.034 8.6E-07   32.7   3.7   30    8-38      3-32  (209)
421 COG1341 Predicted GTPase or GT  94.7   0.033 8.5E-07   32.7   3.4   35   13-47     74-108 (398)
422 TIGR02788 VirB11 P-type DNA tr  94.7   0.057 1.4E-06   31.3   4.6   76   14-129   160-240 (328)
423 TIGR01007 eps_fam capsular exo  94.7   0.067 1.7E-06   30.9   5.0  120   15-138    22-197 (207)
424 cd04178 Nucleostemin_like Nucl  94.7   0.036 9.3E-07   32.5   3.6   57   10-80    115-171 (172)
425 PRK09602 translation-associate  94.7    0.13 3.2E-06   29.1   6.3   91   13-105     3-114 (396)
426 PRK13900 type IV secretion sys  94.7   0.034 8.7E-07   32.7   3.4   16  187-202   174-189 (332)
427 cd02037 MRP-like MRP (Multiple  94.6    0.26 6.8E-06   27.2   7.9  116   19-135     7-132 (169)
428 KOG0447 consensus               94.6     0.3 7.6E-06   26.8   8.0  127   11-138   306-493 (980)
429 TIGR02782 TrbB_P P-type conjug  94.6   0.033 8.3E-07   32.8   3.1   26   13-38    140-165 (315)
430 PRK13948 shikimate kinase; Pro  94.4   0.054 1.4E-06   31.4   3.9   50    7-60      5-54  (182)
431 COG1161 Predicted GTPases [Gen  94.4   0.052 1.3E-06   31.5   3.8   57   10-80    130-186 (322)
432 PRK10246 exonuclease subunit S  94.4    0.22 5.6E-06   27.7   6.9   65   15-79     33-98  (1047)
433 pfam09140 MipZ ATPase MipZ. Mi  94.3     0.1 2.6E-06   29.7   5.1   84   20-105     9-131 (261)
434 pfam09547 Spore_IV_A Stage IV   94.3   0.059 1.5E-06   31.2   3.8  128    7-136    12-192 (492)
435 KOG1533 consensus               94.2   0.093 2.4E-06   30.0   4.8  125   14-139     4-178 (290)
436 COG1763 MobB Molybdopterin-gua  94.1    0.36 9.2E-06   26.3   7.6   50   14-84      4-53  (161)
437 PRK13851 type IV secretion sys  94.1   0.057 1.4E-06   31.3   3.4   16  187-202   176-191 (343)
438 PRK08118 topology modulation p  94.1   0.057 1.5E-06   31.3   3.4   24   14-37      3-26  (167)
439 CHL00175 minD septum-site dete  94.0   0.086 2.2E-06   30.2   4.3   66   68-135   122-187 (279)
440 cd03279 ABC_sbcCD SbcCD and ot  93.9    0.22 5.7E-06   27.6   6.2   80   15-101    31-117 (213)
441 PRK07261 topology modulation p  93.9   0.065 1.7E-06   30.9   3.4   24   14-37      2-25  (171)
442 cd01130 VirB11-like_ATPase Typ  93.9    0.04   1E-06   32.2   2.3   28   10-37     23-50  (186)
443 COG4962 CpaF Flp pilus assembl  93.8   0.092 2.3E-06   30.0   4.1   16  187-202   187-202 (355)
444 KOG1424 consensus               93.6    0.08   2E-06   30.4   3.4   81   83-172   163-244 (562)
445 KOG1424 consensus               93.5    0.12   3E-06   29.4   4.2   44   69-116   175-226 (562)
446 cd01900 YchF YchF subfamily.    93.4    0.19   5E-06   28.0   5.2   80   15-106     1-104 (274)
447 TIGR01526 nadR_NMN_Atrans nico  93.3   0.089 2.3E-06   30.1   3.4   23   80-105    16-38  (346)
448 cd01899 Ygr210 Ygr210 subfamil  93.3     0.2   5E-06   28.0   5.0   88   15-105     1-110 (318)
449 PRK13695 putative NTPase; Prov  93.2    0.46 1.2E-05   25.6   6.8   28   12-39      3-30  (174)
450 PRK07667 uridine kinase; Provi  93.1    0.16 4.1E-06   28.5   4.4   32    8-39     10-41  (190)
451 TIGR02768 TraA_Ti Ti-type conj  93.0    0.08   2E-06   30.4   2.7   79   15-102   433-535 (888)
452 pfam00437 GSPII_E Type II/IV s  93.0    0.35 8.9E-06   26.4   6.0   13  188-200   154-166 (283)
453 KOG0072 consensus               93.0   0.032 8.3E-07   32.8   0.7  137   13-173    19-164 (182)
454 pfam03205 MobB Molybdopterin g  92.9    0.13 3.3E-06   29.1   3.7   26   14-39      2-27  (122)
455 TIGR01184 ntrCD nitrate ABC tr  92.9   0.084 2.1E-06   30.2   2.6   21   15-35     14-34  (230)
456 KOG0097 consensus               92.8    0.69 1.7E-05   24.6   7.9  140   13-175    12-160 (215)
457 TIGR01969 minD_arch cell divis  92.8    0.23 5.8E-06   27.6   4.8   81   69-155   108-188 (258)
458 KOG0093 consensus               92.7    0.43 1.1E-05   25.8   6.1  141   14-172    23-167 (193)
459 cd03253 ABCC_ATM1_transporter   92.6   0.097 2.5E-06   29.9   2.7   24   14-37     29-52  (236)
460 cd03369 ABCC_NFT1 Domain 2 of   92.5    0.13 3.4E-06   29.0   3.3   25   14-38     36-60  (207)
461 PRK07429 phosphoribulokinase;   92.5    0.24   6E-06   27.5   4.6   31    9-40      6-36  (331)
462 cd03289 ABCC_CFTR2 The CFTR su  92.5    0.11 2.8E-06   29.5   2.9   25   14-38     32-56  (275)
463 cd02023 UMPK Uridine monophosp  92.4    0.13 3.3E-06   29.1   3.1   23   15-37      2-24  (198)
464 TIGR00487 IF-2 translation ini  92.4   0.037 9.5E-07   32.4   0.3   83  209-293   501-583 (594)
465 cd03252 ABCC_Hemolysin The ABC  92.3   0.092 2.3E-06   30.0   2.2   25   14-38     30-54  (237)
466 COG0419 SbcC ATPase involved i  92.3    0.81 2.1E-05   24.1   7.3   62   15-78     28-90  (908)
467 pfam00485 PRK Phosphoribulokin  92.2    0.14 3.5E-06   28.9   3.0   26   15-40      2-27  (196)
468 PRK13631 cbiO cobalt transport  92.1    0.12 3.1E-06   29.3   2.7   24   14-37     54-77  (320)
469 PRK09270 frcK putative fructos  92.1    0.25 6.3E-06   27.3   4.2   30   10-39     32-61  (230)
470 cd03249 ABC_MTABC3_MDL1_MDL2 M  92.1    0.15 3.8E-06   28.7   3.1   24   14-37     31-54  (238)
471 COG0563 Adk Adenylate kinase a  92.0    0.16 4.1E-06   28.5   3.2   23   14-36      2-24  (178)
472 cd00464 SK Shikimate kinase (S  92.0    0.16   4E-06   28.5   3.2   43   14-60      1-43  (154)
473 PTZ00258 GTP-binding protein;   92.0    0.41   1E-05   26.0   5.3   88    6-105    16-127 (392)
474 TIGR00618 sbcc exonuclease Sbc  91.8    0.13 3.4E-06   29.0   2.6   25   14-38     32-57  (1063)
475 KOG1487 consensus               91.8    0.13 3.4E-06   29.0   2.6   56   14-81     61-116 (358)
476 COG0489 Mrp ATPases involved i  91.8    0.93 2.4E-05   23.8   8.1   67   69-137   165-232 (265)
477 PRK13644 cbiO cobalt transport  91.7    0.15 3.7E-06   28.8   2.7   24   14-37     30-53  (274)
478 PTZ00243 ABC transporter; Prov  91.6    0.14 3.7E-06   28.8   2.6   20   15-34    689-708 (1560)
479 pfam03266 DUF265 Protein of un  91.6    0.66 1.7E-05   24.7   6.0   27   14-40      1-27  (168)
480 cd03291 ABCC_CFTR1 The CFTR su  91.5    0.16   4E-06   28.5   2.8   25   14-38     65-89  (282)
481 cd03246 ABCC_Protease_Secretio  91.5    0.16 4.2E-06   28.4   2.8   25   14-38     30-54  (173)
482 cd03290 ABCC_SUR1_N The SUR do  91.4    0.15 3.9E-06   28.6   2.6   25   14-38     29-53  (218)
483 TIGR00957 MRP_assoc_pro multi   91.4    0.17 4.4E-06   28.3   2.8   24   15-38    670-693 (1542)
484 PRK13646 cbiO cobalt transport  91.4    0.16 4.2E-06   28.4   2.7   24   14-37     35-58  (286)
485 COG3523 IcmF Type VI protein s  91.4    0.17 4.4E-06   28.3   2.8  119   14-146   127-279 (1188)
486 PRK05057 aroK shikimate kinase  91.3    0.25 6.3E-06   27.3   3.6   43   14-60      6-48  (172)
487 PRK13657 cyclic beta-1,2-gluca  91.3    0.18 4.6E-06   28.2   2.9   32  357-388   523-554 (585)
488 PRK13833 conjugal transfer pro  91.2    0.17 4.3E-06   28.4   2.6   11  188-198   159-169 (323)
489 KOG0088 consensus               91.2    0.91 2.3E-05   23.8   6.4  108   13-137    14-131 (218)
490 cd02030 NDUO42 NADH:Ubiquinone  91.2    0.21 5.4E-06   27.8   3.1   23   15-37      2-24  (219)
491 cd03251 ABCC_MsbA MsbA is an e  91.2    0.18 4.7E-06   28.1   2.8   25   14-38     30-54  (234)
492 TIGR02324 CP_lyasePhnL phospho  91.2    0.16 4.2E-06   28.4   2.5   24   15-38     37-60  (224)
493 cd03230 ABC_DR_subfamily_A Thi  91.2    0.52 1.3E-05   25.4   5.1   25   14-38     28-52  (173)
494 KOG3883 consensus               91.2     1.1 2.7E-05   23.4   8.2  107   14-139    11-133 (198)
495 TIGR00955 3a01204 Pigment prec  91.2    0.16 4.1E-06   28.5   2.5   18   15-32     61-78  (671)
496 COG0012 Predicted GTPase, prob  91.1     0.3 7.6E-06   26.8   3.8   91   12-106     2-109 (372)
497 PRK13632 cbiO cobalt transport  91.1    0.17 4.3E-06   28.4   2.5   20   15-34     39-58  (273)
498 KOG0054 consensus               91.1    0.18 4.6E-06   28.2   2.7   20   15-34    550-569 (1381)
499 PRK13651 cobalt transporter AT  91.1    0.18 4.6E-06   28.2   2.7   20   15-34     36-55  (304)
500 PRK06696 uridine kinase; Valid  91.0     0.3 7.5E-06   26.9   3.7   28   13-40     27-54  (227)

No 1  
>PRK00049 elongation factor Tu; Reviewed
Probab=100.00  E-value=0  Score=749.74  Aligned_cols=391  Identities=60%  Similarity=0.965  Sum_probs=360.9

Q ss_pred             CCHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHH-----HCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEE
Q ss_conf             9612421038827999990468988789999998764442-----00131268686986292063789998219908999
Q gi|254780263|r    1 MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEK-----KEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSH   75 (392)
Q Consensus         1 m~~~~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~-----~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~i   75 (392)
                      |+++.++++|||+||+++||||||||||+|+|++.+.+..     .....+|+++|||+||+||++++.+|++++++|+|
T Consensus         1 ~~~~~~~~~kp~~ni~~~GHVD~GKSTL~g~Lt~~l~~~~g~~~~~~~~~~D~~~eEr~rGiTid~~~~~~~t~~~~~~~   80 (397)
T PRK00049          1 MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITKVLAKKYGGAEAKAYDQIDNAPEEKARGITINTAHVEYETEKRHYAH   80 (397)
T ss_pred             CCCCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHCCCCHHHHHCCCEEEEEEEEEECCCCEEEE
T ss_conf             97334278998329999912588899999999866665438531001333025766762581699879999728814999


Q ss_pred             EECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEE
Q ss_conf             84787302467798774002331452012344332106778888631876023310023335612221101232100111
Q gi|254780263|r   76 IDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLK  155 (392)
Q Consensus        76 iD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~  155 (392)
                      ||+|||++|++||++|++++|+|+|||||++|+++||+||+.++++|||+++||||||||+++++++++.++.+++++|+
T Consensus        81 iD~PGH~~fiknmI~Ga~~~D~alLVV~A~~G~~~QT~EHl~l~~~LGv~~~iV~vnK~D~v~~~~~~~~v~~~i~~~l~  160 (397)
T PRK00049         81 VDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFLNKCDMVDDEELLELVEMEVRELLS  160 (397)
T ss_pred             ECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             51786388899987301215679999974888665289999999980998279999866888859999999999999998


Q ss_pred             EEEEE-EEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCC
Q ss_conf             01453-22102331146764114445652123320344310252222100001100000001355445430148742453
Q gi|254780263|r  156 EHKYS-DDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRI  234 (392)
Q Consensus       156 ~~~~~-~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l  234 (392)
                      +.+|. .++|++|+|++.+++..+....+..+.+|++++++++|.|+++.++||||||+++|+++|+|+|++|+|+||++
T Consensus       161 ~~~f~~~~ipiv~~S~~~~~~~~~~~~~~~~i~~Ll~~ld~~~~~p~r~~~~p~r~~Id~vf~i~G~GtVVtGtv~sG~i  240 (397)
T PRK00049        161 KYDFPGDDTPIIRGSALKALEEIGDPEWEAKILELMEAVDSYIPEPERAIDKPFLMPIEDVFSISGRGTVVTGRVERGII  240 (397)
T ss_pred             HCCCCCCCCCEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCEEEECCCCEEEEEEEEEEEE
T ss_conf             46998444768985500311477865317899999999986477888888886077723388767972799989800056


Q ss_pred             CCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCCCCCEEEEEEEEEEECCC
Q ss_conf             48967999506874321254121001211443210013666411245432202117732677763000168999710567
Q gi|254780263|r  235 KAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASE  314 (392)
Q Consensus       235 ~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~~~~~~f~A~i~il~~~~  314 (392)
                      ++||++.++|... ..+++|++||+|++++++|.|||+|+++|+|++.++|+||+|||+|+++.+++.|+|++.+|+..+
T Consensus       241 ~~Gd~v~i~~~~~-~~~~~VksIq~~~~~v~~a~aG~~v~i~L~gi~~~~I~rG~vL~~p~~~~p~~~f~A~v~vL~~~~  319 (397)
T PRK00049        241 KVGEEVEIVGIRD-TQKTTVTGVEMFRKLLDEGQAGDNVGLLLRGIKREDVERGQVLAKPGSITPHTKFEAEVYVLSKEE  319 (397)
T ss_pred             CCCCEEEEEECCC-CCEEEEEEEEECCEEEEEECCCCEEEEEECCCCHHHCCCCCEEECCCCCCCCEEEEEEEEEECCCC
T ss_conf             0799899960698-847999999962707026358877999977998898576019956998887729999999971545


Q ss_pred             CCCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEEEECCEEEEEEEEEEEEC
Q ss_conf             875555115978999954147779999618955707897699999977817754698499998996999899955319
Q gi|254780263|r  315 GGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       315 ~~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilRd~~~tig~G~I~~v~e  392 (392)
                      +.+..++..||++++|+++.++++++.+.++++.+++||.+.|+|+|.+|+|+++++||+|||+|+|+|+|.|++++|
T Consensus       320 ~~~h~pi~~gy~~~lh~~t~~v~~~i~l~~~~e~l~~Gd~a~v~i~l~~Pi~~e~g~RFvlRd~g~Tig~G~V~~vle  397 (397)
T PRK00049        320 GGRHTPFFNGYRPQFYFRTTDVTGVIELPEGVEMVMPGDNVKMTVELIAPIAMEEGLRFAIREGGRTVGAGVVTKIIE  397 (397)
T ss_pred             CCCCCCCCCCCEEEEEEEECEEEEEEEECCCCCEECCCCEEEEEEEECCCEEECCCCEEEEEECCEEEEEEEEEEEEC
T ss_conf             776565337826999985056999999368971635899899999989837864399899998997899999999879


No 2  
>PRK12735 elongation factor Tu; Reviewed
Probab=100.00  E-value=0  Score=748.03  Aligned_cols=391  Identities=60%  Similarity=0.973  Sum_probs=363.1

Q ss_pred             CCHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHH----HCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEE
Q ss_conf             9612421038827999990468988789999998764442----001312686869862920637899982199089998
Q gi|254780263|r    1 MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEK----KEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHI   76 (392)
Q Consensus         1 m~~~~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~----~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~ii   76 (392)
                      |+||+++++|||+||+++||||||||||+|+|++.+.+..    +....+|+++|||+||+||++++++|++++++|+||
T Consensus         1 ~~~~~~~~~kp~ini~~~GHVD~GKSTL~g~Lt~~~~~~~~~~~~~~~~~D~~~eEr~rGiTid~~~~~fet~~~~~~~i   80 (396)
T PRK12735          1 MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKKGGGEAKAYDQIDNAPEEKARGITINTSHVEYETANRHYAHV   80 (396)
T ss_pred             CCCCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHCCCHHHHCCCEEEEEEEEEEECCCEEEEEE
T ss_conf             97233278998349999942688589899998614545246431221221166567437737985699997398059998


Q ss_pred             ECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEE
Q ss_conf             47873024677987740023314520123443321067788886318760233100233356122211012321001110
Q gi|254780263|r   77 DCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKE  156 (392)
Q Consensus        77 D~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~  156 (392)
                      |+|||++|++||++|++++|+|+|||||++|+++||+||+.++++|||+++||||||||+++++++++.++.+++++|++
T Consensus        81 D~PGHe~fiknMI~Ga~~aD~alLVV~A~~G~~~QTrEHl~l~~~lgv~~~iV~vnK~D~v~~~~~~e~v~~~i~~~l~~  160 (396)
T PRK12735         81 DCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFLNKCDMVDDEELLELVEMEVRELLSK  160 (396)
T ss_pred             ECCCHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             36866887766641004256799999868787531699999999839985899998758888199999999999999985


Q ss_pred             EEEE-EEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCC
Q ss_conf             1453-221023311467641144456521233203443102522221000011000000013554454301487424534
Q gi|254780263|r  157 HKYS-DDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIK  235 (392)
Q Consensus       157 ~~~~-~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~  235 (392)
                      .+|. +++|++++|++.++++++....++.+.+|++++++++|.|+++.++||||||+++|+++|+|+|++|+|+||+++
T Consensus       161 ~~f~~~~~piv~~S~~~~~~~~~~~~~~~~i~~Ll~~l~~~~~~p~r~~~~pfrl~Id~vf~v~G~GtVVtGtV~sG~i~  240 (396)
T PRK12735        161 YDFPGDDTPIIRGSALKALEGDAEWIGEAKILELMEALDSYIPTPERAIDKPFLMPIEDVFSISGRGTVVTGRVERGIVK  240 (396)
T ss_pred             CCCCCCCCCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEEEC
T ss_conf             59996647799967337225887434447799999998852678777778865999764777679715999898121562


Q ss_pred             CCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCCCCCEEEEEEEEEEECCCC
Q ss_conf             89679995068743212541210012114432100136664112454322021177326777630001689997105678
Q gi|254780263|r  236 AGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEG  315 (392)
Q Consensus       236 ~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~~~~~~f~A~i~il~~~~~  315 (392)
                      +||++.++|... ...++|+|||+|++++++|.|||+|+++|+|++.++++||||||+|+++.+++.|+|++.+|+..++
T Consensus       241 ~Gd~v~i~~~~~-~~~~~V~sIq~~~~~v~~a~aG~~v~l~L~gi~~~~i~rG~VL~~p~~~~~~~~f~a~v~vL~~~~~  319 (396)
T PRK12735        241 VGDEVEIVGIKD-TQKTTVTGVEMFRKLLDEGQAGDNVGVLLRGTKREDVERGQVLAKPGSIKPHTKFEAEVYVLSKEEG  319 (396)
T ss_pred             CCCEEEEEECCC-CCEEEEEEEEECCCCCCEECCCCEEEEEECCCCHHHCCCEEEEECCCCCCCCEEEEEEEEEECCCCC
T ss_conf             799899972699-8469999999867080271488789999479988985626799669987887299999999705557


Q ss_pred             CCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEEEECCEEEEEEEEEEEEC
Q ss_conf             75555115978999954147779999618955707897699999977817754698499998996999899955319
Q gi|254780263|r  316 GRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       316 ~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilRd~~~tig~G~I~~v~e  392 (392)
                      .+..++..||++++|+++.++++++.+.++++.+++|+.+.|+|+|.+|+|+++++||+|||+|+|+|+|.|++|+|
T Consensus       320 ~~h~pi~~g~~~~lh~~t~~v~~~i~~~~~~~~l~~G~~a~v~i~l~~Pi~~e~g~RFvlRd~g~Tig~G~V~~vle  396 (396)
T PRK12735        320 GRHTPFFNGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNVKMTVELIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE  396 (396)
T ss_pred             CCCCCCCCCCEEEEEEEECEEEEEEEECCCCCEECCCCEEEEEEEECCCEEECCCCEEEEEECCEEEEEEEEEEEEC
T ss_conf             76565215827999996066999999658982757999899999989837865399899998996899999999889


No 3  
>TIGR00483 EF-1_alpha translation elongation factor EF-1, subunit alpha; InterPro: IPR004539   Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution.   EF1A (also known as EF-1alpha or EF-Tu) is a G-protein. It forms a ternary complex of EF1A-GTP-aminoacyltRNA. The binding of aminoacyl-tRNA stimulates GTP hydrolysis by EF1A, causing a conformational change in EF1A that causes EF1A-GDP to detach from the ribosome, leaving the aminoacyl-tRNA attached at the A-site. Only the cognate aminoacyl-tRNA can induce the required conformational change in EF1A through its tight anticodon-codon binding , . EF1A-GDP is returned to its active state, EF1A-GTP, through the action of another elongation factor, EF1B (also known as EF-Ts or EF-1beta/gamma/delta).   This entry represents EF1A proteins found primarily in eukaryotic (eEF1A) and archaeal (aEF1A) organisms, these proteins being more closely related to one another than to EF1A (or EF-Tu) found in bacteria (IPR004541 from INTERPRO).   More information about these proteins can be found at Protein of the Month: Elongation Factors . ; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=755.79  Aligned_cols=374  Identities=35%  Similarity=0.614  Sum_probs=341.7

Q ss_pred             HCCCCEEEEEEEECCCCCHHHHHHHHH-----------HHHHHHHHCCCC--------CCCCHHHHHCCCEEEEEEEEEE
Q ss_conf             103882799999046898878999999-----------876444200131--------2686869862920637899982
Q gi|254780263|r    7 VRNKESLGLSTIGHVDHGKTTLTAAIT-----------KYYSEEKKEYGD--------IDSAPEEKLRGITIATAHVSYE   67 (392)
Q Consensus         7 ~~~k~~~ni~~iGhvd~GKSTL~~~L~-----------~~~~~~~~~~~~--------~D~~~~E~~rGiTi~~~~~~~~   67 (392)
                      -|+|+|+|+++|||||||||||+|+|+           .++.+++.+.++        ||++++|||||+|||+++.-|+
T Consensus         2 aKeK~~~Nv~~IGHVD~GKST~~G~Lly~~G~I~~~~~eK~~kEa~e~GK~~F~fa~V~D~Lk~ERERGvTID~A~~KFe   81 (445)
T TIGR00483         2 AKEKEHINVAFIGHVDHGKSTLVGRLLYKAGAIDEQLLEKLKKEAQEKGKASFEFAWVMDRLKEERERGVTIDVAHKKFE   81 (445)
T ss_pred             CCCCCEEEEEEEEEEECCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCHHHHHHHHCC
T ss_conf             76543244899825408850266777754289658999999875755187303676543110000015622433445417


Q ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCC-------CCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH
Q ss_conf             1990899984787302467798774002331452012344-------332106778888631876023310023335612
Q gi|254780263|r   68 TDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDG-------PKPQTREHILLARQIGISSIVVYMNKVDAVDDD  140 (392)
Q Consensus        68 ~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G-------~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~  140 (392)
                      |++|.+|+||||||+||+||||+|+||||+|+||||..++       ++||||||++|++.|||+|+||||||||.|+|+
T Consensus        82 T~KY~~TivDcPGHRDFiKNMITGaSQADaAvLv~~v~~~~~~ag~~~~pQTrEH~~La~TLGi~QliVAiNKMD~V~yd  161 (445)
T TIGR00483        82 TDKYEVTIVDCPGHRDFIKNMITGASQADAAVLVVAVDDGEFEAGISVQPQTREHVFLARTLGINQLIVAINKMDSVNYD  161 (445)
T ss_pred             CCCEEEEEEECCCCCHHHHHCCCCCCCCCEEEEEEECCCCCCCCCEEECCCCHHHHHHHHHHCCEEEEEEECCCCCEECC
T ss_conf             88516999846987013431126675124279999525441024012178605778887750320453331024610027


Q ss_pred             -HHHHHCCCCCCE-EEEEEEEEEEEECCCCEEEEEEECCC-----CCCCCCC------------CCCHHHHHHCCCCCCC
Q ss_conf             -221101232100-11101453221023311467641144-----4565212------------3320344310252222
Q gi|254780263|r  141 -ELLDISEYEIRD-LLKEHKYSDDTPIIRGSALCALQGTN-----KELGEDS------------IHALMKAVDTHIPTPQ  201 (392)
Q Consensus       141 -~~~~~i~~~i~~-~l~~~~~~~~~pii~~sa~~g~~~~n-----~~~~~~~------------~~~Ll~~i~~~~~~p~  201 (392)
                       +.|+.++.++.+ +|+..||+.+-  |++.|+++|+|||     ..++||+            ++||+|+||. +..|+
T Consensus       162 ~~~f~~~~~~~s~~l~K~vGY~p~~--v~FiP~s~~~GDN~~~~s~~~PWYkgwe~e~~agvv~G~TL~EA~D~-~~~P~  238 (445)
T TIGR00483       162 EEEFEALKKEVSEQLLKKVGYKPDE--VPFIPISAFEGDNVIKKSENTPWYKGWEKETKAGVVKGKTLLEALDA-LEPPE  238 (445)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCC--CCEEEECCCCCCCHHHHHCCCCCCCCCCCCCCCEEECCCHHHHHHHH-HCCCC
T ss_conf             7899999999999899874887561--23254035467613433038885255220002302218458988731-04786


Q ss_pred             CCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCC
Q ss_conf             10000110000000135544543014874245348967999506874321254121001211443210013666411245
Q gi|254780263|r  202 RSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVN  281 (392)
Q Consensus       202 ~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~  281 (392)
                      +..|+|||+||||+|++.|+|||..|||++|.|+.|+.+.+-|.+   +..+|+||||||+.+++|.|||+||||++|++
T Consensus       239 kp~d~PLRiPiQDVY~I~GvGTVPVGRVEtGvl~~G~~V~F~PAG---VsgEVKSiEMHHE~i~~a~PGDNiGFNVrgVs  315 (445)
T TIGR00483       239 KPVDKPLRIPIQDVYSITGVGTVPVGRVETGVLKPGDKVVFEPAG---VSGEVKSIEMHHEQIEQAEPGDNIGFNVRGVS  315 (445)
T ss_pred             CCCCCCCCCCCCCEEEECCEEECCCCCEECCEEECCCEEEECCCC---CCCCEEEEEECCCCCCCCCCCCCCCEEECCCC
T ss_conf             434677305530035753366223460202426448878963788---43121367611343667777874122001556


Q ss_pred             CCEEECHHEEECCCC--CCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEE-------------ECCCH
Q ss_conf             432202117732677--763000168999710567875555115978999954147779999-------------61895
Q gi|254780263|r  282 RADVPRGRVVCAPGS--IQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRII-------------LSPGS  346 (392)
Q Consensus       282 ~~di~rGdvl~~~~~--~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~-------------~~~~~  346 (392)
                      ..||+||||..++++  |..+..|+|+|++|.     ||+.+..||+|.+||++++++|++.             .+++|
T Consensus       316 ~kdIrRGdV~G~~~NdPP~v~~~F~A~~vVL~-----HP~~ItvGYtPV~~~HTA~~AC~F~EL~~K~d~rtG~~~Ee~P  390 (445)
T TIGR00483       316 KKDIRRGDVAGHPDNDPPKVAKEFTAQIVVLQ-----HPGAITVGYTPVLHAHTAQIACRFVELLKKLDPRTGQVLEENP  390 (445)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEC-----CCCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             02200143037888758721014412799972-----8976773565630143113333168888550733585014787


Q ss_pred             HHHCCCCEEEEEEEECCCEEECC------CCEEEEEECCEEEEEEEEEEEE
Q ss_conf             57078976999999778177546------9849999899699989995531
Q gi|254780263|r  347 QAVMPGDRVDLEVELIYPIAMEP------NQTFSMREGGKTVGAGLILEII  391 (392)
Q Consensus       347 ~~i~~g~~~~v~l~l~~pi~~e~------~~rfilRd~~~tig~G~I~~v~  391 (392)
                      ++|++||.|.|.+.+.+|+|+|.      .+||++||+++|||+|+++++.
T Consensus       391 ~FLKtGdAA~VK~~PtkP~viE~~~~~P~lGRFAiRDMg~Tva~G~~~d~~  441 (445)
T TIGR00483       391 QFLKTGDAAIVKLKPTKPMVIEKVKEIPPLGRFAIRDMGQTVAAGMIIDVK  441 (445)
T ss_pred             CCCCCCCEEEEEEECCCCEEEECCCCCCCCCHHHHHHHCCEEEEEEEEEEC
T ss_conf             512467636899618997487200158986513413301204112678621


No 4  
>PRK12736 elongation factor Tu; Reviewed
Probab=100.00  E-value=0  Score=736.87  Aligned_cols=388  Identities=61%  Similarity=0.979  Sum_probs=359.4

Q ss_pred             CCHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHH----HCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEE
Q ss_conf             9612421038827999990468988789999998764442----001312686869862920637899982199089998
Q gi|254780263|r    1 MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEK----KEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHI   76 (392)
Q Consensus         1 m~~~~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~----~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~ii   76 (392)
                      |+|+.|+++|||+||+++||||||||||+|+|++.+++.+    +....+|+++|||+||+||++++++|++++++|+||
T Consensus         1 ~~~~~~~~~k~~~ni~~~GHVD~GKSTL~g~L~~~~~~~~~~~~~~~~~~D~~~eEr~rGiTid~~~~~~~t~~~~~~~i   80 (394)
T PRK12736          1 MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITKVLAERGLAQAKDYASIDAAPEEKARGITINTAHVEYETEKRHYAHV   80 (394)
T ss_pred             CCCCCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHCCCCEEEEEEEEEECCCEEEEEE
T ss_conf             96001278998749999951288489899897504545065102222331166556247821784189997288369998


Q ss_pred             ECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEE
Q ss_conf             47873024677987740023314520123443321067788886318760233100233356122211012321001110
Q gi|254780263|r   77 DCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKE  156 (392)
Q Consensus        77 D~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~  156 (392)
                      |+|||++|++||++|++++|+|+|||||++|+++||+||+.++++|||+++||||||||+++++++++.++.+++++|+.
T Consensus        81 D~PGH~~fi~nmi~Ga~~~D~alLVV~A~~G~~~QT~EHl~l~~~lgv~~~IV~vnK~D~v~~~~~~~~v~~~i~~~l~~  160 (394)
T PRK12736         81 DCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLARQVGVPYIVVFLNKVDLVDDEELLELVEMEVRELLSE  160 (394)
T ss_pred             ECCCCHHHHCCEEEEECCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             88972543110444353466589999858774677999999999829991599998878998399999999999999987


Q ss_pred             EEEEE-EEECCCCEEEEEEECCCCCCCCCCC-CCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCC
Q ss_conf             14532-2102331146764114445652123-320344310252222100001100000001355445430148742453
Q gi|254780263|r  157 HKYSD-DTPIIRGSALCALQGTNKELGEDSI-HALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRI  234 (392)
Q Consensus       157 ~~~~~-~~pii~~sa~~g~~~~n~~~~~~~~-~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l  234 (392)
                      .+|.. ++|++++|+++++   |....|+.. .+|++++++++|.|+++.++||||||+++|+++|+|+|++|+|+||++
T Consensus       161 ~g~~~~~ip~i~~s~~~~~---~~~~~~~~~i~~Ll~~ld~~~~~p~r~~~~p~r~~Id~vf~v~G~GtVvtG~V~sG~i  237 (394)
T PRK12736        161 YDFPGDDIPVIRGSALKAL---EGDPKWEDAIMELMDAVDEYIPTPERDTDKPFLMPVEDVFSITGRGTVVTGRVERGTV  237 (394)
T ss_pred             CCCCCCCCCEEEEECCCCC---CCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEEEEEECCCEEEEEEEEEECEE
T ss_conf             6999120609984543613---6887357789999999985277888877776288711178608975899999801468


Q ss_pred             CCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCCCCCEEEEEEEEEEECCC
Q ss_conf             48967999506874321254121001211443210013666411245432202117732677763000168999710567
Q gi|254780263|r  235 KAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASE  314 (392)
Q Consensus       235 ~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~~~~~~f~A~i~il~~~~  314 (392)
                      ++||++.++|.. ....++|++|++|++++++|.|||+|+++|+|++.++++||||||+|+++.++++|+|++.||...+
T Consensus       238 ~~Gd~v~i~~~~-~~~~~~VrsI~~~~~~v~~a~aG~~v~l~L~gid~~~i~rG~vL~~~~~~~p~~~f~A~i~il~~~~  316 (394)
T PRK12736        238 KVGDEVEIVGIK-ETQKTTVTGVEMFRKLLDEGQAGDNVGVLLRGVDRDEVERGQVLAKPGSIKPHTKFKAEVYILTKEE  316 (394)
T ss_pred             ECCCEEEEEECC-CCCEEEEEEEEECCCCCCCCCCCCEEEEEECCCCHHHCCCEEEEECCCCCCCCCEEEEEEEEEECCC
T ss_conf             659989997079-9807999987367837248047678999976899899671669966998898709999999982456


Q ss_pred             CCCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEEEECCEEEEEEEEEEEEC
Q ss_conf             875555115978999954147779999618955707897699999977817754698499998996999899955319
Q gi|254780263|r  315 GGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       315 ~~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilRd~~~tig~G~I~~v~e  392 (392)
                      +.+.+++..||++++|+++.++++++.+.++++.+++|+.+.|+|+|.+|+|+++++||+|||+|+|+|+|.|++++|
T Consensus       317 ~~~~~pi~~g~~~~~~~~t~~v~~~i~l~~~~~~l~~Gd~a~v~l~l~~Pi~~e~g~RFvlRd~g~Tig~G~V~~vl~  394 (394)
T PRK12736        317 GGRHTPFFTNYRPQFYFRTTDVTGSIELPEGTEMVMPGDNVTITVELIHPIAMEQGLKFAIREGGRTVGAGVVTEILE  394 (394)
T ss_pred             CCCCCCCCCCCEEEEEEEECEEEEEEEECCCCCCCCCCCEEEEEEEECCEEEECCCCEEEEEECCEEEEEEEEEEEEC
T ss_conf             666554017827999997356999999458973408999899999989728765699899998995799999999889


No 5  
>CHL00071 tufA elongation factor Tu
Probab=100.00  E-value=0  Score=725.86  Aligned_cols=391  Identities=56%  Similarity=0.923  Sum_probs=355.6

Q ss_pred             CCHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHH----HCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEE
Q ss_conf             9612421038827999990468988789999998764442----001312686869862920637899982199089998
Q gi|254780263|r    1 MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEK----KEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHI   76 (392)
Q Consensus         1 m~~~~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~----~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~ii   76 (392)
                      |+.+.|+|+|||+||+++||||||||||+|+|+...+...    +...++|++++||+||+||++++.+|++++++|+||
T Consensus         1 ~~~~~~~~~k~~vni~~~GHVD~GKSTL~g~L~~~~~~~~~~~~~~~~~~D~~~eEr~rGiTid~~~~~~et~~~~~~~i   80 (409)
T CHL00071          1 MAREKFERKKPHVNIGTIGHVDHGKTTLTAAITMTLAANGGAKGKKYDEIDSAPEEKARGITINTAHVEYETENRHYAHV   80 (409)
T ss_pred             CCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHCCCCHHHHHCCCEEEECEEEEECCCEEEEEE
T ss_conf             96000368998699999954588399999998645300451334315532379768736944880248996287599998


Q ss_pred             ECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEE
Q ss_conf             47873024677987740023314520123443321067788886318760233100233356122211012321001110
Q gi|254780263|r   77 DCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKE  156 (392)
Q Consensus        77 D~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~  156 (392)
                      |+|||++|++||++|++++|+|+|||||++|+++||+||+.|+++||||++||||||||+++++++++.++.+++++|++
T Consensus        81 D~PGH~~fv~nmi~Gas~aD~alLVV~A~~G~~~QTkEHl~l~~~lgV~~~IVavnKmD~v~~~~~~e~i~~~i~~~l~~  160 (409)
T CHL00071         81 DCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTKEHILLAKQVGVPNIVVFLNKEDQVDDEELLELVELEVRELLDK  160 (409)
T ss_pred             ECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             67967899999875230158128999868788500499999999739993655555679854899999999999999997


Q ss_pred             EEEEE-EEECCCCEEEEEEECCC-------CCCCCCCC-CCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEE
Q ss_conf             14532-21023311467641144-------45652123-32034431025222210000110000000135544543014
Q gi|254780263|r  157 HKYSD-DTPIIRGSALCALQGTN-------KELGEDSI-HALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTG  227 (392)
Q Consensus       157 ~~~~~-~~pii~~sa~~g~~~~n-------~~~~~~~~-~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~G  227 (392)
                      .+|.. ++|++|+|++.+++...       ...+||.. .+|++.|++++|.|+++.++||||||+++|+++|+|+|++|
T Consensus       161 ~g~~~~~i~~vp~sa~~~~~~~~~~~~~~~~~~~w~~~~~~Ll~~l~~~~p~~~r~~~~p~r~~Id~vf~v~G~GtVv~G  240 (409)
T CHL00071        161 YDFPGDEIPIVAGSALLALEALIENPKIKRGENKWVDKIYNLMDAVDSYIPTPERDTDKPFLMAIEDVFSITGRGTVATG  240 (409)
T ss_pred             CCCCCCCCEEEECCHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCEEECCCCEEEEEE
T ss_conf             39984556089652133234312587545565612447999999887237788887677606442214753897889999


Q ss_pred             EEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCCCCCEEEEEEE
Q ss_conf             87424534896799950687432125412100121144321001366641124543220211773267776300016899
Q gi|254780263|r  228 CIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASV  307 (392)
Q Consensus       228 rV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~~~~~~f~A~i  307 (392)
                      +|+||++++||++.++|.. +...++|++|+.+++++++|.|||+|+++|+|++..+|+||||||+|+++.++++|+|++
T Consensus       241 ~v~sG~v~~Gd~v~i~~~~-~~~~~~VksI~~~~~~~~~a~aG~~v~l~L~gi~~~~I~rG~VL~~p~~~~~~~~F~A~I  319 (409)
T CHL00071        241 RIERGTVKVGDTVEIVGLR-ETRTTTVTGLEMFQKTLDEGLAGDNVGILLRGIQKEDIERGMVLAKPGTITPHTKFEAQV  319 (409)
T ss_pred             EEEECCCCCCCEEEEEECC-CCCEEEEEEEEECCCCCCEECCCCEEEEEECCCCHHHCCCEEEEECCCCCCCCEEEEEEE
T ss_conf             9914563499989999769-986079999998895988887998899997599878877468996899998731999999


Q ss_pred             EEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEEC-----CCHHHHCCCCEEEEEEEECCCEEECCCCEEEEEECCEEE
Q ss_conf             971056787555511597899995414777999961-----895570789769999997781775469849999899699
Q gi|254780263|r  308 YILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILS-----PGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTV  382 (392)
Q Consensus       308 ~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~-----~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilRd~~~ti  382 (392)
                      .||+..++.+..+++.||++++|+++.++++++...     ..++.+++||.+.|+|+|.+|+|+++++||+|||+|+|+
T Consensus       320 ~iL~~~~~~~~~pi~~g~~~~lh~~t~~~~~~I~~l~~~~~~~~~~l~~Gd~a~v~~~l~~Pi~ie~g~RfilRd~g~Ti  399 (409)
T CHL00071        320 YILTKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFTADDGSKAEMVMPGDRIKMTVELIYPIAIEKGMRFAIREGGRTV  399 (409)
T ss_pred             EEEECCCCCCCCCCCCCCEEEEEEEEEEEEEEEEEEECCCCCCCCEECCCCEEEEEEEECCCEEECCCCEEEEEECCEEE
T ss_conf             99867667765531589758999985499999999603577786173689989999998940887659989999899889


Q ss_pred             EEEEEEEEEC
Q ss_conf             9899955319
Q gi|254780263|r  383 GAGLILEIIE  392 (392)
Q Consensus       383 g~G~I~~v~e  392 (392)
                      |+|+|++|+|
T Consensus       400 g~G~V~~v~~  409 (409)
T CHL00071        400 GAGVVSKIIK  409 (409)
T ss_pred             EEEEEEEEEC
T ss_conf             9999999869


No 6  
>PRK12317 elongation factor 1-alpha; Reviewed
Probab=100.00  E-value=0  Score=702.71  Aligned_cols=377  Identities=37%  Similarity=0.593  Sum_probs=336.4

Q ss_pred             HCCCCEEEEEEEECCCCCHHHHHHHHHH-----------HHHHHHHCCCC--------CCCCHHHHHCCCEEEEEEEEEE
Q ss_conf             1038827999990468988789999998-----------76444200131--------2686869862920637899982
Q gi|254780263|r    7 VRNKESLGLSTIGHVDHGKTTLTAAITK-----------YYSEEKKEYGD--------IDSAPEEKLRGITIATAHVSYE   67 (392)
Q Consensus         7 ~~~k~~~ni~~iGhvd~GKSTL~~~L~~-----------~~~~~~~~~~~--------~D~~~~E~~rGiTi~~~~~~~~   67 (392)
                      .++|||+||+++||||||||||+|+|+.           .+.+++.+.++        ||++++||+||+|||+++.+|+
T Consensus         2 ~~~K~~l~i~~~GhVD~GKSTL~G~Ll~~~g~~~~~~~~~~~~~~~~~g~~s~~~a~~~D~~~eEr~rGiTid~~~~~f~   81 (426)
T PRK12317          2 AKEKPHLNLAVIGHVDHGKSTLVGRLLYETGAVDEHIIEEYEEEAKKKGKESFKFAWVMDRLKEERERGVTIDLAHKKFE   81 (426)
T ss_pred             CCCCCEEEEEEEEECCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHCCCEEEEEEEEEE
T ss_conf             99897849999952287688887689877299448999999989986487752143212578668755827883169995


Q ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCC--CCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH-HHHH
Q ss_conf             199089998478730246779877400233145201234--4332106778888631876023310023335612-2211
Q gi|254780263|r   68 TDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAED--GPKPQTREHILLARQIGISSIVVYMNKVDAVDDD-ELLD  144 (392)
Q Consensus        68 ~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~--G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~-~~~~  144 (392)
                      +++++|+|+|+|||++|++||++|++++|+|+|||||++  |+++||+||+.|+++|||+++||||||||+++|+ ++|+
T Consensus        82 ~~~~~~~iiD~PGH~~fi~nmi~Gas~~D~ailvV~A~~~~G~~~QT~eHl~l~~~lgi~~iiV~vnKmD~v~~~~~~~~  161 (426)
T PRK12317         82 TDKYYFTIIDCPGHRDFVKNMITGASQADAAVLVVSARDAGGVMPQTREHVFLARTLGINQLIVAINKMDAVNYDEKRYN  161 (426)
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHHHH
T ss_conf             49816999878963667877874534677279999636566764778999999998099839999953335677889999


Q ss_pred             HCCCCCCEEEEEEEEE-EEEECCCCEEEEEEECCC--CCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCC
Q ss_conf             0123210011101453-221023311467641144--4565212332034431025222210000110000000135544
Q gi|254780263|r  145 ISEYEIRDLLKEHKYS-DDTPIIRGSALCALQGTN--KELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGR  221 (392)
Q Consensus       145 ~i~~~i~~~l~~~~~~-~~~pii~~sa~~g~~~~n--~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~  221 (392)
                      +++.++.++|++.+|+ .++|++|+|+++|.+..+  ..++||++++|+++|++ ++.|.+..++||||||+++|+++|.
T Consensus       162 ~i~~~~~~~l~~~g~~~~~i~~iPiSa~~Gdni~~~s~~~~Wy~G~tLl~~L~~-~~~~~~~~~~p~r~~I~~v~~~~g~  240 (426)
T PRK12317        162 EVKEEVSKLLKMVGYKPDDIPFIPVSAFEGDNVVKKSDNTPWYNGPTLLEALDA-LKPPEKPTDKPLRIPIQDVYSITGV  240 (426)
T ss_pred             HHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHC-CCCCCCCCCCCEEEEEEEEEEECCC
T ss_conf             999999999997098803470887532346564116766863220789999863-7777665578535578778840687


Q ss_pred             CCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCC-CCCC
Q ss_conf             543014874245348967999506874321254121001211443210013666411245432202117732677-7630
Q gi|254780263|r  222 GTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGS-IQEY  300 (392)
Q Consensus       222 G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~-~~~~  300 (392)
                      |+|++|+|+||++++||++.++|++   ..++|++|+.++.++++|.|||+|+++|++++..||+||||||++++ |..+
T Consensus       241 Gtvv~G~v~sG~i~~Gd~v~i~Ps~---~~~~VksI~~~~~~v~~a~aG~~v~l~L~~i~~~dI~rG~Vl~~~~~~~~~~  317 (426)
T PRK12317        241 GTVPVGRVETGVLKVGDKVVFMPAG---KVGEVKSIEMHHEELPQAEPGDNIGFNVRGVGKNDIKRGDVAGHTDNPPTVA  317 (426)
T ss_pred             EEEEEEEECCCCCCCCCEEEEECCC---CCEEEEEEEECCCEEEEEECCCEEEEEEECCCHHCCCCCCEEECCCCCCCEE
T ss_conf             0799868443854379999996799---8658976886694788995898699998367442277864894799998430


Q ss_pred             EEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEE-------------CCCHHHHCCCCEEEEEEEECCCEEE
Q ss_conf             001689997105678755551159789999541477799996-------------1895570789769999997781775
Q gi|254780263|r  301 SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIIL-------------SPGSQAVMPGDRVDLEVELIYPIAM  367 (392)
Q Consensus       301 ~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~-------------~~~~~~i~~g~~~~v~l~l~~pi~~  367 (392)
                      ++|+|++.||+     ++..+..||++.+|+++.++.|++..             +++++++++||.+.|+|++.+|+|+
T Consensus       318 ~~F~A~i~~l~-----~~~~i~~G~~~vlh~~t~~~~~~i~~I~~~id~~tg~~~~~~~~~l~~gd~a~v~l~~~~pi~~  392 (426)
T PRK12317        318 EEFTAQIVVLQ-----HPSAITVGYTPVFHAHTAQVACTFEELVKKLDPRTGQVVEENPQFIKTGDAAIVKIKPTKPLVI  392 (426)
T ss_pred             EEEEEEEEEEC-----CCCCCCCCCEEEEEECCCEEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCEEEEEEEECCEEEE
T ss_conf             08999999974-----8986789967999953668999999989998278775513585460899989999998984887


Q ss_pred             CCCC------EEEEEECCEEEEEEEEEEEEC
Q ss_conf             4698------499998996999899955319
Q gi|254780263|r  368 EPNQ------TFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       368 e~~~------rfilRd~~~tig~G~I~~v~e  392 (392)
                      |+|+      ||+|||+|+|||+|+|++|..
T Consensus       393 e~~~~~~~lGrFiLrd~~~TVa~G~I~~v~p  423 (426)
T PRK12317        393 EKVSEIPQLGRFAIRDMGQTVAAGMVIDVKP  423 (426)
T ss_pred             ECCCCCCCCCEEEEEECCCEEEEEEEEEEEC
T ss_conf             0455478776499998991499999987417


No 7  
>PTZ00336 elongation factor 1-alpha; Provisional
Probab=100.00  E-value=0  Score=695.17  Aligned_cols=377  Identities=31%  Similarity=0.457  Sum_probs=333.9

Q ss_pred             HCCCCEEEEEEEECCCCCHHHHHHHHHH-----------HHHHHHHCCCC--------CCCCHHHHHCCCEEEEEEEEEE
Q ss_conf             1038827999990468988789999998-----------76444200131--------2686869862920637899982
Q gi|254780263|r    7 VRNKESLGLSTIGHVDHGKTTLTAAITK-----------YYSEEKKEYGD--------IDSAPEEKLRGITIATAHVSYE   67 (392)
Q Consensus         7 ~~~k~~~ni~~iGhvd~GKSTL~~~L~~-----------~~~~~~~~~~~--------~D~~~~E~~rGiTi~~~~~~~~   67 (392)
                      -++|||+||+++||||||||||+|+|+.           .+.+++.+.++        ||++++||+||+|||+++++|+
T Consensus         2 ~~~K~~lni~~~GhVD~GKSTL~G~Ll~~~~~v~~~~l~~~~~~~~~~g~~s~~~a~~~D~~~~Er~rGiTid~~~~~f~   81 (449)
T PTZ00336          2 GKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFE   81 (449)
T ss_pred             CCCCCEEEEEEEECCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHCCCHHHHCCCEEEEEEEEEEE
T ss_conf             99886439999927789688889999987488478999999999987187514325451277223228758986799997


Q ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCC-------CHHHHHHHHHHCCCCCEEEEECCCC--CCC
Q ss_conf             1990899984787302467798774002331452012344332-------1067788886318760233100233--356
Q gi|254780263|r   68 TDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKP-------QTREHILLARQIGISSIVVYMNKVD--AVD  138 (392)
Q Consensus        68 ~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~-------QT~eh~~l~~~lgi~~iIv~iNKmD--~v~  138 (392)
                      +++++|+|+|+|||++|++||++|++++|+|||||||++|+++       ||+||+.|+++|||+++||||||||  .++
T Consensus        82 t~~~~~~iiD~PGH~~fi~nmi~Gas~aD~aiLVVdA~~G~~e~g~~~~gQTreHl~i~~~Lgv~~iiV~vNKmD~~~v~  161 (449)
T PTZ00336         82 SPKSVFTIIDAPGHRDFIKNMITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVT  161 (449)
T ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCCEECCCCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCC
T ss_conf             49848999868946888999997650067679999878774103556677539999999866997799998620156621


Q ss_pred             CH-HHHHHCCCCCCEEEEEEEEEE-EEECCCCEEEEEEECC--CCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCC
Q ss_conf             12-221101232100111014532-2102331146764114--4456521233203443102522221000011000000
Q gi|254780263|r  139 DD-ELLDISEYEIRDLLKEHKYSD-DTPIIRGSALCALQGT--NKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEG  214 (392)
Q Consensus       139 ~~-~~~~~i~~~i~~~l~~~~~~~-~~pii~~sa~~g~~~~--n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~  214 (392)
                      |+ ++|+++..++..+|++.+|+. ++++||+||++|.+..  ...++||.+++|+++|+. ++.|.++.++||||||++
T Consensus       162 ~~~~r~~~i~~e~~~~l~~~g~~~~~v~~IPiSa~~Gdni~~~s~~~~Wy~GptLl~~Ld~-~~~~~r~~~~p~r~pV~~  240 (449)
T PTZ00336        162 YAQSRYDEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIEKSDNMPWYKGPTLLDALDM-LEPPVRPVDKPLRLPLQD  240 (449)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCHHHHHHHC-CCCCCCCCCCCCCCCCCE
T ss_conf             1378999999999999987499900054354201047775326555754105248999754-489877566764234010


Q ss_pred             CCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECC
Q ss_conf             01355445430148742453489679995068743212541210012114432100136664112454322021177326
Q gi|254780263|r  215 SCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAP  294 (392)
Q Consensus       215 vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~  294 (392)
                      +|+++|.|+|++|+|+||++++||++.++|.+   ..++|++|+++++++++|.|||+|+++|++++..||+|||+++.+
T Consensus       241 vf~~~g~gtvv~G~V~sG~v~~Gd~V~i~Ps~---~~~~VksI~~~~~~v~~A~aG~~V~i~L~~i~~~dI~rGdVl~~~  317 (449)
T PTZ00336        241 VYKIGGIGTVPVGRVETGIMKPGDVVTFAPAN---VTTEVKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRRGNVCGNS  317 (449)
T ss_pred             EEECCCCCEEEEEEEECCCCCCCCEEEECCCC---CEEEEEEEEECCCEECEECCCCEEEEECCCCCHHCCCCCCEEECC
T ss_conf             77327883188899943630589999991799---879998999899385967799847892488735307886399628


Q ss_pred             --CCCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEE-------------CCCHHHHCCCCEEEEEE
Q ss_conf             --777630001689997105678755551159789999541477799996-------------18955707897699999
Q gi|254780263|r  295 --GSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIIL-------------SPGSQAVMPGDRVDLEV  359 (392)
Q Consensus       295 --~~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~-------------~~~~~~i~~g~~~~v~l  359 (392)
                        ++|..+.+|+|+++||+.     +..+..+|++.+++++.++.|++..             .++|++|++||.|.|+|
T Consensus       318 ~~~~p~~~~~F~A~v~~l~~-----~~~i~~Gy~~~l~~~t~~v~~~i~~I~~kid~~tg~~~~~~p~~l~~ndia~v~l  392 (449)
T PTZ00336        318 KNDPPKEAADFTAQVIVLNH-----PGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAIVKM  392 (449)
T ss_pred             CCCCCCCCCEEEEEEEEECC-----CCCCCCCCCEEEECCCCEEEEEEEEEEEEECCCCCCEECCCCCCCCCCCEEEEEE
T ss_conf             99998414579999999678-----8765899426999653689999999889985899858056833549999899999


Q ss_pred             EECCCEEECCC------CEEEEEECCEEEEEEEEEEEEC
Q ss_conf             97781775469------8499998996999899955319
Q gi|254780263|r  360 ELIYPIAMEPN------QTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       360 ~l~~pi~~e~~------~rfilRd~~~tig~G~I~~v~e  392 (392)
                      ++.+|+|+|+|      +||+|||+|+|||+|+|++|.|
T Consensus       393 ~~~~pi~~e~y~~~~~lGrFiLrd~~~TVa~G~I~~v~~  431 (449)
T PTZ00336        393 VPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVNK  431 (449)
T ss_pred             EECCCEEEECCCCCCCCCCEEEEECCEEEEEEEEEEEEC
T ss_conf             989928881356687876489998992799999999974


No 8  
>PTZ00141 elongation factor 1 alpha; Provisional
Probab=100.00  E-value=0  Score=695.31  Aligned_cols=377  Identities=32%  Similarity=0.509  Sum_probs=334.0

Q ss_pred             HCCCCEEEEEEEECCCCCHHHHHHHHHHH-----------HHHHHHCCCC--------CCCCHHHHHCCCEEEEEEEEEE
Q ss_conf             10388279999904689887899999987-----------6444200131--------2686869862920637899982
Q gi|254780263|r    7 VRNKESLGLSTIGHVDHGKTTLTAAITKY-----------YSEEKKEYGD--------IDSAPEEKLRGITIATAHVSYE   67 (392)
Q Consensus         7 ~~~k~~~ni~~iGhvd~GKSTL~~~L~~~-----------~~~~~~~~~~--------~D~~~~E~~rGiTi~~~~~~~~   67 (392)
                      -++|||+||+++||||||||||+|+|+..           +.++....++        ||++++||+||+|||+++++|+
T Consensus         2 ~~~k~~l~i~~~GhVD~GKSTL~G~Ll~~~g~v~~~~~~~~~~~~~~~g~~~~~~a~~~D~~~~Er~rGiTidv~~~~f~   81 (443)
T PTZ00141          2 GKEKTHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRTIEKFEKESAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFE   81 (443)
T ss_pred             CCCCCEEEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCEEHHHHCCCHHHHHCCCEEEEEEEEEE
T ss_conf             98887659999947798288889999987388468899999888887178720004453077667636710734799994


Q ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCC-------CHHHHHHHHHHCCCCCEEEEECCCCCCCCH
Q ss_conf             1990899984787302467798774002331452012344332-------106778888631876023310023335612
Q gi|254780263|r   68 TDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKP-------QTREHILLARQIGISSIVVYMNKVDAVDDD  140 (392)
Q Consensus        68 ~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~-------QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~  140 (392)
                      +++++|+|+|+|||++|++||++|++++|+|||||||++|+++       ||+||+.|+++|||+++||||||||+|+|+
T Consensus        82 t~~~~~~iiD~PGH~~fi~nmi~Gas~aD~ailvVdA~~G~~e~gf~~~gQTreH~~i~~~lgv~~iIVaVNKmD~v~~~  161 (443)
T PTZ00141         82 TPKYYYTVIDAPGHRDFIKNMITGTSQADVALLVVPAEVGGFEGAFSKEGQTREHALLAFTLGVKQIIVGINKMDTCDYK  161 (443)
T ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEEECCCCCH
T ss_conf             39889999989972888999996341077589999867785213466678639999999973997599999962156660


Q ss_pred             -HHHHHCCCCCCEEEEEEEEEE-EEECCCCEEEEEEECC--CCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCC
Q ss_conf             -221101232100111014532-2102331146764114--445652123320344310252222100001100000001
Q gi|254780263|r  141 -ELLDISEYEIRDLLKEHKYSD-DTPIIRGSALCALQGT--NKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSC  216 (392)
Q Consensus       141 -~~~~~i~~~i~~~l~~~~~~~-~~pii~~sa~~g~~~~--n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf  216 (392)
                       ++|++++.++.++|++.+|+. ++|++|+|++.|.+..  ...++||++++|+++|++ ++.|.++.++||||||+++|
T Consensus       162 e~~f~~i~~~~~~~l~~~g~~~~~i~~iPiSa~~Gdni~~~s~~~~Wy~G~tLle~Ld~-~~~~~~~~~~p~r~pI~~v~  240 (443)
T PTZ00141        162 EDRYEEIQKEVCGYLKKVGYNAEKVPFVPISGFEGDNMIEKSDKMPWYKGKTLVEALDT-MEPPKRPVDKPLRLPLQGVY  240 (443)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCEEHHHHHHHHHHC-CCCCCCCCCCCCCCCEEEEE
T ss_conf             99999999999999997399956661896341246653246655644235689999856-89875655566534050388


Q ss_pred             CCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCC-
Q ss_conf             3554454301487424534896799950687432125412100121144321001366641124543220211773267-
Q gi|254780263|r  217 GIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPG-  295 (392)
Q Consensus       217 ~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~-  295 (392)
                      +++|.|+|++|+|+||++++||++.++|++   ..++|++|+++++++++|.|||+|+++|++++..||+||||||++. 
T Consensus       241 ~~~g~gtvv~G~V~sG~i~~Gd~v~i~Ps~---~~~~VksI~~~~~~v~~A~aG~~V~i~L~~i~~~dI~rG~Vl~~~~~  317 (443)
T PTZ00141        241 KIGGIGTVPVGRVETGILKAGMVLTFAPSA---VTTECKSVEMHHEVVEEARPGDNVGFNVKNVSTKDIKRGHVASDSKN  317 (443)
T ss_pred             EECCCCEEEEEEEEEEEEECCCEEEECCCC---CEEEEEEEEECCCEECEECCCCEEEEECCCCCHHHCCCCEEEECCCC
T ss_conf             616873278767615699569789987799---88999899989969087869983799458986530278619766999


Q ss_pred             -CCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEE-------------CCCHHHHCCCCEEEEEEEE
Q ss_conf             -77630001689997105678755551159789999541477799996-------------1895570789769999997
Q gi|254780263|r  296 -SIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIIL-------------SPGSQAVMPGDRVDLEVEL  361 (392)
Q Consensus       296 -~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~-------------~~~~~~i~~g~~~~v~l~l  361 (392)
                       ++..+++|+|+++||+     ++.+++.||++.+++++.++.|++..             .++++++++||.|.|+|++
T Consensus       318 ~P~~~~~~F~A~v~~l~-----~~~~i~~G~~~~l~~~t~~~~~~i~~I~~~id~~t~~~~~~~p~~l~~nd~a~V~l~~  392 (443)
T PTZ00141        318 DPAKGCSKFTAQVIVLN-----HPGEIKNGYSPVVDCHTAHISCKFLNIDSKMDKRSGKVLEENPKTIKSGDAALVSLKP  392 (443)
T ss_pred             CCCCCCCEEEEEEEEEC-----CCCCCCCCCCEEEEECCCEEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCEEEEEEEE
T ss_conf             99762068999999968-----9876589963699934457999999988998678776547784364999889999998


Q ss_pred             CCCEEECCC------CEEEEEECCEEEEEEEEEEEEC
Q ss_conf             781775469------8499998996999899955319
Q gi|254780263|r  362 IYPIAMEPN------QTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       362 ~~pi~~e~~------~rfilRd~~~tig~G~I~~v~e  392 (392)
                      .+|+|+|+|      +||+|||+|+|+|+|+|++|.+
T Consensus       393 ~~pi~~e~y~~~~~lGrFiLrd~~~Tva~G~I~~V~~  429 (443)
T PTZ00141        393 KKPMVVETFTEYPPLGRFAVRDMKQTVAVGVIKSVEK  429 (443)
T ss_pred             CCEEEECCCCCCCCCCCEEEEECCEEEEEEEEEEEEC
T ss_conf             9856783677678876199998995799999999954


No 9  
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional
Probab=100.00  E-value=0  Score=685.22  Aligned_cols=373  Identities=25%  Similarity=0.337  Sum_probs=326.6

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHH-----------HHHHHHHCCCC----------CCCCHHHHHCCCEEEEEEEEE
Q ss_conf             038827999990468988789999998-----------76444200131----------268686986292063789998
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITK-----------YYSEEKKEYGD----------IDSAPEEKLRGITIATAHVSY   66 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~-----------~~~~~~~~~~~----------~D~~~~E~~rGiTi~~~~~~~   66 (392)
                      .+|++||++++||||||||||+|+|+.           .+.++.+..+.          ||.+++||+||||||+++.+|
T Consensus        23 ~~k~~l~~v~~GhVD~GKSTl~GrlL~~~~~v~~~~~~~~~~~s~~~g~~~~~~~~a~l~D~l~~ERe~GiTIdva~~~f  102 (475)
T PRK05124         23 QHKSLLRFLTCGSVDDGKSTLIGRLLHDTKQIYEDQLASLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYF  102 (475)
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHHCCCEEEEEEEEE
T ss_conf             47985799999055797788889999981997889999999999982887772224442059988986697169567899


Q ss_pred             ECCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH-HHHHH
Q ss_conf             21990899984787302467798774002331452012344332106778888631876023310023335612-22110
Q gi|254780263|r   67 ETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDD-ELLDI  145 (392)
Q Consensus        67 ~~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~-~~~~~  145 (392)
                      +|++|+|+++|+|||++|+|||++|+|+||+|||||||++|+++|||||+.|+++|||+++||||||||+|+|+ ++|++
T Consensus       103 ~t~~r~~~i~DaPGH~~f~~NMitGas~aD~aiLvVdA~~G~~~QTreH~~i~~llGI~~iIVaVNKMDlV~~~~~~f~~  182 (475)
T PRK05124        103 STEKRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLDQTRRHSFIATLLGIKHLVVAVNKMDLVDYSEEVFER  182 (475)
T ss_pred             ECCCEEEEEEECCCHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEECHHCCCCCHHHHHH
T ss_conf             53876899973796387788898888767889999989889478889999999865998599998504313543999999


Q ss_pred             CCCCCCEEEEEEEEEEEEECCCCEEEEEEECCC--CCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCC
Q ss_conf             123210011101453221023311467641144--456521233203443102522221000011000000013554454
Q gi|254780263|r  146 SEYEIRDLLKEHKYSDDTPIIRGSALCALQGTN--KELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGT  223 (392)
Q Consensus       146 i~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~n--~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~  223 (392)
                      ++.++.+++++.++..++++||+||+.|.|..+  ..++||++++|+++|++ ++.|.+..++||||||+++|+..+.++
T Consensus       183 I~~e~~~~l~~~g~~~~v~~IPISal~GdNIv~~S~~m~WY~GptLle~Le~-~~~~~~~~~~pfRlPVq~V~r~~~~~r  261 (475)
T PRK05124        183 IREDYLTFAEQLPGNLDIRFVPLSALEGDNVVSQSESMPWYSGPTLLEVLET-VDIQREVDAQPFRFPVQYVNRPNLDFR  261 (475)
T ss_pred             HHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHC-CCCCCCCCCCCCCCCCEEEECCCCCCE
T ss_conf             9999999999749988850775413457676215667874567539999855-888876555665566579862687731


Q ss_pred             CEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCC-CCCCEE
Q ss_conf             3014874245348967999506874321254121001211443210013666411245432202117732677-763000
Q gi|254780263|r  224 VVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGS-IQEYSR  302 (392)
Q Consensus       224 Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~-~~~~~~  302 (392)
                      .++|||+||++++||++.++|++   ..++|++|+.++.++++|.|||+|+++|+  +..|++||||||++++ |..+++
T Consensus       262 g~~G~I~sG~i~~GD~V~vlPsg---~~a~Vk~I~~~~~~~~~A~aG~sV~l~L~--deiDIsRGdVl~~~~~~p~~s~~  336 (475)
T PRK05124        262 GYAGTLASGVVKVGDRVKVLPSG---KESNVARIVTFDGDLEEAFAGEAITLVLE--DEIDISRGDLLVAADEAPPAAQH  336 (475)
T ss_pred             EEEEEEEECEECCCCEEEECCCC---CEEEEEEEEECCCCCCCCCCCCEEEEEEE--CCCCCCCCCEEECCCCCCCCCCE
T ss_conf             68899713327179989993899---75898999965865254389987999960--34468998389738998670258


Q ss_pred             EEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEEC-----------CCHHHHCCCCEEEEEEEECCCEEECCC-
Q ss_conf             16899971056787555511597899995414777999961-----------895570789769999997781775469-
Q gi|254780263|r  303 FRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILS-----------PGSQAVMPGDRVDLEVELIYPIAMEPN-  370 (392)
Q Consensus       303 f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~-----------~~~~~i~~g~~~~v~l~l~~pi~~e~~-  370 (392)
                      |+|+|+||+.      .++..|+++.+++++..+.|++...           ..+++|..||.+.|+|++.+|+|+|+| 
T Consensus       337 F~A~Ivwm~~------~pL~~G~~y~lk~~t~~v~a~i~~I~~kiD~~T~~~~~~~~L~~Ndia~V~i~~~~pI~~d~y~  410 (475)
T PRK05124        337 ASADVVWMAE------QPLQPGQSYDIKIAGKKTRARVDAIRYQVDINTLTQRDVENLPLNGIGLVELTFDEPLVLDPYQ  410 (475)
T ss_pred             EEEEEEEECC------CCCCCCCEEEEEECCCEEEEEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEECCCEEECCHH
T ss_conf             8999999548------7677998689998474998999873478857866717877118998899999989902612162


Q ss_pred             -----CEEEEE--ECCEEEEEEEEEEEEC
Q ss_conf             -----849999--8996999899955319
Q gi|254780263|r  371 -----QTFSMR--EGGKTVGAGLILEIIE  392 (392)
Q Consensus       371 -----~rfilR--d~~~tig~G~I~~v~e  392 (392)
                           +||+|+  .+|.|||+|+|++.++
T Consensus       411 ~~~~lGrFILIDr~t~~TVAaGmI~~~l~  439 (475)
T PRK05124        411 QNRDTGGFILIDRLTNVTVGAGMVREPVE  439 (475)
T ss_pred             HCCCCCCEEEEECCCCCEEEEEEEHHHHH
T ss_conf             39677858999879997899994803734


No 10 
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=0  Score=681.37  Aligned_cols=376  Identities=37%  Similarity=0.559  Sum_probs=339.4

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHH-----------HHHHHHHCCCC--------CCCCHHHHHCCCEEEEEEEEEEC
Q ss_conf             038827999990468988789999998-----------76444200131--------26868698629206378999821
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITK-----------YYSEEKKEYGD--------IDSAPEEKLRGITIATAHVSYET   68 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~-----------~~~~~~~~~~~--------~D~~~~E~~rGiTi~~~~~~~~~   68 (392)
                      ..|||+|++++||||||||||+|+|+.           ++.+++.+.++        ||++++|||||+||+.++++|++
T Consensus         3 ~~Kph~nl~~iGHVD~GKSTl~GrLly~~G~id~~tmeK~~~ea~~~gK~sf~fawvlD~tkeERerGvTi~~~~~~fet   82 (428)
T COG5256           3 SEKPHLNLVFIGHVDAGKSTLVGRLLYDLGEIDKRTMEKLEKEAKELGKESFKFAWVLDKTKEERERGVTIDVAHSKFET   82 (428)
T ss_pred             CCCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHCCEEEEEEEEEEEC
T ss_conf             87871289998378787034455657773797989999999999861977168999853886678666689977788643


Q ss_pred             CCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCC-------CCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH-
Q ss_conf             990899984787302467798774002331452012344-------332106778888631876023310023335612-
Q gi|254780263|r   69 DKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDG-------PKPQTREHILLARQIGISSIVVYMNKVDAVDDD-  140 (392)
Q Consensus        69 ~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G-------~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~-  140 (392)
                      +.+.+||+|||||+||++|||+|+||||+|+|||||+.|       +++|||||+.|++.+||+++||||||||.++|+ 
T Consensus        83 ~k~~~tIiDaPGHrdFvknmItGasqAD~aVLVV~a~~~efE~g~~~~gQtrEH~~La~tlGi~~lIVavNKMD~v~wde  162 (428)
T COG5256          83 DKYNFTIIDAPGHRDFVKNMITGASQADVAVLVVDARDGEFEAGFGVGGQTREHAFLARTLGIKQLIVAVNKMDLVSWDE  162 (428)
T ss_pred             CCCEEEEEECCCHHHHHHHHHCCHHHCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEECCCCCCCCH
T ss_conf             77058996078467789876313313367999998889831014365875167899998569756999997156666279


Q ss_pred             HHHHHCCCCCCEEEEEEEEEE-EEECCCCEEEEEEECC--CCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCC
Q ss_conf             221101232100111014532-2102331146764114--4456521233203443102522221000011000000013
Q gi|254780263|r  141 ELLDISEYEIRDLLKEHKYSD-DTPIIRGSALCALQGT--NKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCG  217 (392)
Q Consensus       141 ~~~~~i~~~i~~~l~~~~~~~-~~pii~~sa~~g~~~~--n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~  217 (392)
                      ++|++++.++..+++..+|++ +++|||+|+++|-|-.  ...++||++++|+++|+ .++.|+++.|+|||+||+++|.
T Consensus       163 ~rf~ei~~~v~~l~k~~G~~~~~v~FIPiSg~~G~Nl~~~s~~~pWY~GpTLleaLd-~~~~p~~~~d~Plr~pI~~v~~  241 (428)
T COG5256         163 ERFEEIVSEVSKLLKMVGYNPKDVPFIPISGFKGDNLTKKSENMPWYKGPTLLEALD-QLEPPERPLDKPLRLPIQDVYS  241 (428)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHH-CCCCCCCCCCCCEEEEEEEEEE
T ss_conf             999999999999999719986677079622446776332676786724871898974-5578987778881768001787


Q ss_pred             CCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCC
Q ss_conf             55445430148742453489679995068743212541210012114432100136664112454322021177326777
Q gi|254780263|r  218 IEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSI  297 (392)
Q Consensus       218 i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~  297 (392)
                      +.+.|+|..|||++|.|++||.+.+.|.+   ...+|+|+++|+++++.|.|||+|+++++|++..||+|||++++++++
T Consensus       242 i~~~gtv~vGrVEsG~i~~g~~v~~~p~~---~~~evksie~~~~~~~~a~~GD~i~~~vrgv~~~dI~~Gdv~~~~~n~  318 (428)
T COG5256         242 ISGIGTVPVGRVESGVIKPGQKVTFMPAG---VVGEVKSIEMHHEEISQAEPGDNVGFNVRGVEKNDIRRGDVIGHSDNP  318 (428)
T ss_pred             ECCCCEEEEEEEEEEEECCCCEEEEECCC---CEEEEEEEEECCCCCCCCCCCCEEEEEECCCCHHCCCCCCEECCCCCC
T ss_conf             16885478878861345169879996486---127876456126654447898768898357754316776574047888


Q ss_pred             CC-CEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEE-------------ECCCHHHHCCCCEEEEEEEECC
Q ss_conf             63-000168999710567875555115978999954147779999-------------6189557078976999999778
Q gi|254780263|r  298 QE-YSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRII-------------LSPGSQAVMPGDRVDLEVELIY  363 (392)
Q Consensus       298 ~~-~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~-------------~~~~~~~i~~g~~~~v~l~l~~  363 (392)
                      +. +..|.|++.+|+     ++..+..||++++|+++++++|++.             .++++.++++|+.+.|.+++.+
T Consensus       319 ~t~~~~f~a~i~vl~-----~p~~i~~Gyt~vlh~hta~~a~~i~~l~~k~d~~t~k~~~~~p~f~k~g~~~iv~i~~~k  393 (428)
T COG5256         319 PTVSPEFTAQIIVLW-----HPGIITSGYTPVLHAHTAQVACRIAELLSKLDPRTGKKLEENPQFLKRGDAAIVKIEPEK  393 (428)
T ss_pred             CCCCCCEEEEEEEEE-----CCCCCCCCCCCEEEECCCCEEEEHHHHHHHHCCCCCCCCCCCHHHHHCCCEEEEEEEECC
T ss_conf             643513167899980-----676324787617993253003357878875174324332468024425756899998247


Q ss_pred             CEEECC------CCEEEEEECCEEEEEEEEEEEEC
Q ss_conf             177546------98499998996999899955319
Q gi|254780263|r  364 PIAMEP------NQTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       364 pi~~e~------~~rfilRd~~~tig~G~I~~v~e  392 (392)
                      |+|+++      .+||+|||+|+|||+|+|.++.+
T Consensus       394 P~~~e~~~~~~~Lgrfalrd~g~tIA~G~v~~v~~  428 (428)
T COG5256         394 PLCLEKVSEIPQLGRFALRDMGQTIAAGKVLEVKK  428 (428)
T ss_pred             CEEEEECCCCCCCCEEEEEECCCEEEEEEEEECCC
T ss_conf             54763201077222489980797698479974169


No 11 
>KOG0460 consensus
Probab=100.00  E-value=0  Score=684.40  Aligned_cols=389  Identities=58%  Similarity=0.969  Sum_probs=373.3

Q ss_pred             HHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHH----HCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEEC
Q ss_conf             12421038827999990468988789999998764442----00131268686986292063789998219908999847
Q gi|254780263|r    3 EKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEK----KEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDC   78 (392)
Q Consensus         3 ~~~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~----~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~   78 (392)
                      ++.+.|+|||+|+++|||||||||||+.++|+.+.+.+    ..+..+|+-+|||.|||||+.++..|++..|+|.-+||
T Consensus        45 ~~~f~R~KPHvNVGTIGHVDHGKTTLTaAITkila~~g~A~~~kydeID~APEEkaRGITIn~aHveYeTa~RhYaH~DC  124 (449)
T KOG0460          45 KAVFVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEKGGAKFKKYDEIDKAPEEKARGITINAAHVEYETAKRHYAHTDC  124 (449)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHCCHHHHHCCCEEEEEEEEEECCCCCCCCCCC
T ss_conf             54412579865203300335772008999999997516501054766533826653561676435664224430014789


Q ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEE
Q ss_conf             87302467798774002331452012344332106778888631876023310023335612221101232100111014
Q gi|254780263|r   79 PGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHK  158 (392)
Q Consensus        79 PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~  158 (392)
                      |||+||+||||+|++|+|+|||||+|++|+|||||||+.||+..||++++|+|||.|+|++++..|+++.|++++|..++
T Consensus       125 PGHADYIKNMItGaaqMDGaILVVaatDG~MPQTrEHlLLArQVGV~~ivvfiNKvD~V~d~e~leLVEmE~RElLse~g  204 (449)
T KOG0460         125 PGHADYIKNMITGAAQMDGAILVVAATDGPMPQTREHLLLARQVGVKHIVVFINKVDLVDDPEMLELVEMEIRELLSEFG  204 (449)
T ss_pred             CCHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             96388998753273236734999974789884068888889872876499997120246888999999999999999729


Q ss_pred             EEE-EEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCC
Q ss_conf             532-2102331146764114445652123320344310252222100001100000001355445430148742453489
Q gi|254780263|r  159 YSD-DTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAG  237 (392)
Q Consensus       159 ~~~-~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~G  237 (392)
                      |+. +.|+|..||+|++++.++......+..|+|++|+++|.|+|+.++||.|||+++|+++|+|||++||++.|+|++|
T Consensus       205 f~Gd~~PvI~GSAL~ALeg~~peig~~aI~kLldavDsyip~P~R~~~~pFl~pie~vfsI~GRGTVvtGrlERG~lKkG  284 (449)
T KOG0460         205 FDGDNTPVIRGSALCALEGRQPEIGLEAIEKLLDAVDSYIPTPERDLDKPFLLPIEDVFSIPGRGTVVTGRLERGVLKKG  284 (449)
T ss_pred             CCCCCCCEEECCHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEEHHHEEEECCCCEEEEEEEEECCCCCC
T ss_conf             99887876632012222278842057999999998751589852135777404300246615883499877850221468


Q ss_pred             CEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCCCCCEEEEEEEEEEECCCCCC
Q ss_conf             67999506874321254121001211443210013666411245432202117732677763000168999710567875
Q gi|254780263|r  238 SDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGR  317 (392)
Q Consensus       238 d~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~~~~~~f~A~i~il~~~~~~~  317 (392)
                      +++.+++.+. ..+..|..||+|++.+++|.|||++|+.|+|+..+|++||+|+|.|++..+.+.|+|++++|+.+++++
T Consensus       285 ~e~eivG~~~-~lkttvtgiemF~K~ld~a~AGDn~G~LlRGik~~dvkRGmvl~~pGsvk~~~k~ea~~YiLsk~EGGR  363 (449)
T KOG0460         285 DEVEIVGHNK-TLKTTVTGIEMFRKSLDEAQAGDNLGALLRGIKREDVKRGMVLAKPGSVKPHNKFEAQLYILSKEEGGR  363 (449)
T ss_pred             CEEEEECCCC-CEEEEEEHHHHHHHHHHHCCCCCCEEHHHHCCCHHHHHCCCEEECCCCCCCCCEEEEEEEEEEHHHCCC
T ss_conf             8789850676-404686269999877775015562016451477878744528736886540311259999987634897


Q ss_pred             CCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEEEECCEEEEEEEEEEEEC
Q ss_conf             555115978999954147779999618955707897699999977817754698499998996999899955319
Q gi|254780263|r  318 TTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       318 ~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilRd~~~tig~G~I~~v~e  392 (392)
                      ..+|..+|++++|+.+|++++++.+....+.++|||.+.+++.|.+|+++|+++||.||++|+|||.|+|+++++
T Consensus       364 ~~pf~s~y~~q~fs~TwD~~~~v~~~~~~~mvMPGe~~~~~~~Li~pm~le~GqrFtiReGg~TvgtGvvt~~l~  438 (449)
T KOG0460         364 HKPFVSGYRPQMFSRTWDVTGRVDIPPEKEMVMPGENVKVEVTLIRPMPLEKGQRFTLREGGRTVGTGVVTDTLP  438 (449)
T ss_pred             CCCHHHCCCHHHEEEECCCCEEEECCCHHHCCCCCCCEEEEEEEECCCCCCCCCEEEECCCCEEEEEEEEEEEEE
T ss_conf             364343364333144225505897167374036788707999982034467886246703880353236752000


No 12 
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=0  Score=673.49  Aligned_cols=389  Identities=61%  Similarity=0.981  Sum_probs=370.3

Q ss_pred             CCHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHH----HHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEE
Q ss_conf             961242103882799999046898878999999876444----2001312686869862920637899982199089998
Q gi|254780263|r    1 MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEE----KKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHI   76 (392)
Q Consensus         1 m~~~~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~----~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~ii   76 (392)
                      |+|++|+|.|||+||++|||||||||||+.+|+..+.+.    +......|..+|||+|||||+.++..|++.+++|..+
T Consensus         1 mak~kf~r~kphVNigtiGHvdHGKTTLtaAit~~la~~~~~~~~~y~~id~aPeEk~rGITIntahveyet~~rhyahV   80 (394)
T COG0050           1 MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKKGGAEAKAYDQIDNAPEEKARGITINTAHVEYETANRHYAHV   80 (394)
T ss_pred             CCHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHCCCHHHHCCCEECCCEEEEECCCCEEEEC
T ss_conf             94455167987147878614247635289999999986324010333443048267645725401005886388148861


Q ss_pred             ECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEE
Q ss_conf             47873024677987740023314520123443321067788886318760233100233356122211012321001110
Q gi|254780263|r   77 DCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKE  156 (392)
Q Consensus        77 D~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~  156 (392)
                      |||||+||+||||+|++|+|+|||||+|++|++|||+||+++++..|+|+++|++||.|++++.++.++++.|++++|..
T Consensus        81 DcPGHaDYvKNMItgAaqmDgAILVVsA~dGpmPqTrEHiLlarqvGvp~ivvflnK~Dmvdd~ellelVemEvreLLs~  160 (394)
T COG0050          81 DCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLARQVGVPYIVVFLNKVDMVDDEELLELVEMEVRELLSE  160 (394)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             68974899998764077537628999847899986056420123428857999974223668689999999999999997


Q ss_pred             EEEE-EEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCC
Q ss_conf             1453-221023311467641144456521233203443102522221000011000000013554454301487424534
Q gi|254780263|r  157 HKYS-DDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIK  235 (392)
Q Consensus       157 ~~~~-~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~  235 (392)
                      ++|. ++.|++..||+.+++++..  ...++..|++++++++|.|+|+.++||+|||.++|+++|+|+|++|||+.|+++
T Consensus       161 y~f~gd~~Pii~gSal~ale~~~~--~~~~i~eLm~avd~yip~Per~~dkPflmpvEdvfsIsgrgtvvtGrVeRG~lk  238 (394)
T COG0050         161 YGFPGDDTPIIRGSALKALEGDAK--WEAKIEELMDAVDSYIPTPERDIDKPFLMPVEDVFSISGRGTVVTGRVERGILK  238 (394)
T ss_pred             CCCCCCCCCEEECHHHHHHCCCCC--HHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCCEEEEEEEEEEEEEC
T ss_conf             399987763341123331037721--678999999999854899986556652010100689757516898788401241


Q ss_pred             CCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCCCCCEEEEEEEEEEECCCC
Q ss_conf             89679995068743212541210012114432100136664112454322021177326777630001689997105678
Q gi|254780263|r  236 AGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEG  315 (392)
Q Consensus       236 ~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~~~~~~f~A~i~il~~~~~  315 (392)
                      +|+++.+.+.. ...+..+.+++||++..+++.|||+|++.|+|+.+.++.||++|+.|+++.+.++|+|++++|+.+++
T Consensus       239 vg~eveivG~~-~~~kttvtgvemfrk~ld~~~aGdnvg~llRg~~r~~veRGqvLakpgsi~ph~kfeaevyvL~keeg  317 (394)
T COG0050         239 VGEEVEIVGIK-ETQKTTVTGVEMFRKLLDEGQAGDNVGVLLRGVKREDVERGQVLAKPGSIKPHTKFEAEVYVLSKEEG  317 (394)
T ss_pred             CCCEEEEECCC-CCCEEEEEHHHHHHHHHHCCCCCCCCCEEEEECCCCCEECCEEECCCCCCCCCCEEEEEEEEEECCCC
T ss_conf             58779972564-55304887699999887404668985268972111335312076068866665210489999960217


Q ss_pred             CCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEEEECCEEEEEEEEEEEEC
Q ss_conf             75555115978999954147779999618955707897699999977817754698499998996999899955319
Q gi|254780263|r  316 GRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       316 ~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilRd~~~tig~G~I~~v~e  392 (392)
                      ++.++|..||+|++|+.++++++-+.+-++.+.+++||.+.+.++|.+|+++|++.||++|++|+|+|+|.|.++++
T Consensus       318 grhtpff~~yrpqfyfRttDVtg~~~lpeg~emvmpgdnv~~~veLi~pia~e~G~rFaIreGgrtvgaGvV~~i~~  394 (394)
T COG0050         318 GRHTPFFHGYRPQFYFRTTDVTGAITLPEGVEMVMPGDNVKMVVELIHPIAMEEGLRFAIREGGRTVGAGVVTKIIE  394 (394)
T ss_pred             CCCCCCCCCCCCEEEEEEEEEEEEEECCCCCCEECCCCCEEEEEEEEEEEECCCCCEEEEEECCEEEEEEEEEECCC
T ss_conf             88788646766405898401455676167850414888448999986323217887899976886651147830019


No 13 
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional
Probab=100.00  E-value=0  Score=624.97  Aligned_cols=369  Identities=26%  Similarity=0.336  Sum_probs=318.3

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHH-----------HHHHHHHCCCC----------CCCCHHHHHCCCEEEEEEEEE
Q ss_conf             038827999990468988789999998-----------76444200131----------268686986292063789998
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITK-----------YYSEEKKEYGD----------IDSAPEEKLRGITIATAHVSY   66 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~-----------~~~~~~~~~~~----------~D~~~~E~~rGiTi~~~~~~~   66 (392)
                      .+|++||++++||||||||||+|+|+.           .+.+..+..+.          ||.+++|||+|||||++|.+|
T Consensus         3 ~~k~~l~~~~~G~VD~GKSTliGrlL~dt~~i~~d~~~~~~~~s~~~g~~~~~~~~a~l~D~l~~EreqGiTIDva~~~F   82 (613)
T PRK05506          3 ERKTLLRFITCGSVDDGKSTLIGRLLYDSKMIFEDQLAALERDSKKVGTQGDEIDLALLVDGLAAEREQGITIDVAYRYF   82 (613)
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHCCCEEEEEEEEE
T ss_conf             77762589999366797888988999981996789999999999981898886035442148888985597168567788


Q ss_pred             ECCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH-HHHHH
Q ss_conf             21990899984787302467798774002331452012344332106778888631876023310023335612-22110
Q gi|254780263|r   67 ETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDD-ELLDI  145 (392)
Q Consensus        67 ~~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~-~~~~~  145 (392)
                      +|++|+|+|+|+|||++|++||++|+|+||+|||||||++|+++||++|+.|+++|||+++||||||||+|+|+ ++|+.
T Consensus        83 ~t~~r~~~i~DaPGH~~y~rNMitgAs~ad~AilliDa~~G~~~QTrrH~~i~~llGI~~iivaVNKMDlV~y~~~~f~~  162 (613)
T PRK05506         83 STPKRKFIVADTPGHEQYTRNMATGASTADLAIILVDARKGVLTQTRRHSFIASLLGIRHIVLAVNKMDLVDYDQEVFDR  162 (613)
T ss_pred             ECCCEEEEEECCCCHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHH
T ss_conf             43870599942896798998999878653879999988879515518999999872987599998520124781999999


Q ss_pred             CCCCCCEEEEEEEEEEEEECCCCEEEEEEECC--CCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCC
Q ss_conf             12321001110145322102331146764114--4456521233203443102522221000011000000013554454
Q gi|254780263|r  146 SEYEIRDLLKEHKYSDDTPIIRGSALCALQGT--NKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGT  223 (392)
Q Consensus       146 i~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~--n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~  223 (392)
                      ++.++..++++.++. ++.+||+||+.|.|..  +..++||++++|++.|++. +.+....+.|||||||.|++...-.+
T Consensus       163 I~~~~~~~~~~l~~~-~~~~IPISAl~GDNVv~~S~~m~WY~GptLle~Le~~-~~~~~~~~~~fR~PVQ~V~Rp~~dfR  240 (613)
T PRK05506        163 IVADYLAFAAKLGLT-DVTFIPISALKGDNVVTRSARTPWYEGPSLLEHLETV-EIAGDRNLKDFRFPVQYVNRPNLDFR  240 (613)
T ss_pred             HHHHHHHHHHHCCCC-CCEEEECCCCCCCEEEECCCCCCCCCCCCHHHHHHCC-CCCCCCCCCCCEEEEEEEECCCCCEE
T ss_conf             999999999657998-8759967357487476788788666786589997377-87866445671211178744787505


Q ss_pred             CEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCC-CCCCEE
Q ss_conf             3014874245348967999506874321254121001211443210013666411245432202117732677-763000
Q gi|254780263|r  224 VVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGS-IQEYSR  302 (392)
Q Consensus       224 Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~-~~~~~~  302 (392)
                      .++|||+||++++||++.++|++   .+++|++|+.++.++++|.+|+.|++.|.  +..|++|||+|+++++ |..+++
T Consensus       241 gyaGrI~sG~ikvGD~V~vlPSg---~~s~Vk~I~~~~~~~~~A~agqSVtltL~--dEIDISRGDvI~~~~~~p~~s~~  315 (613)
T PRK05506        241 GFAGTVASGVVRPGDEVVVLPSG---KTSRVKRIVTYDGELDEAFAGQAVTLTLA--DEIDISRGDMLARADNPPEVADQ  315 (613)
T ss_pred             EEEEEECCEEECCCCEEEECCCC---CEEEEEEEECCCCCHHHCCCCCEEEEEEC--CCEECCCCCEEECCCCCCCCCCE
T ss_conf             79999841367269989987899---87999999868997641338980899974--62643798689648998870108


Q ss_pred             EEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEE-----------CCCHHHHCCCCEEEEEEEECCCEEECCC-
Q ss_conf             1689997105678755551159789999541477799996-----------1895570789769999997781775469-
Q gi|254780263|r  303 FRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIIL-----------SPGSQAVMPGDRVDLEVELIYPIAMEPN-  370 (392)
Q Consensus       303 f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~-----------~~~~~~i~~g~~~~v~l~l~~pi~~e~~-  370 (392)
                      |+|+++||+..      ++..|.++.+-.++..+.+++..           ......+..||++.|+|++.+|+++++| 
T Consensus       316 f~A~lvWm~e~------pL~~gr~YllK~~t~~v~a~I~~I~~~iDinTl~~~~a~~L~lNdIg~V~l~l~~pI~~D~Y~  389 (613)
T PRK05506        316 FDATLVWMAEE------PLLPGRPYLLKHGTRTVPASVAAIKHRVDVNTLERLAAKRLELNEIGRCNLSLDAPIAFDPYA  389 (613)
T ss_pred             EEEEEEEECCC------CCCCCCEEEEEECCEEEEEEEEEEEEEECCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCHH
T ss_conf             78999994498------767998899998777999999621689726751324435337874189999958973468365


Q ss_pred             -----CEEEEEE--CCEEEEEEEEEE
Q ss_conf             -----8499998--996999899955
Q gi|254780263|r  371 -----QTFSMRE--GGKTVGAGLILE  389 (392)
Q Consensus       371 -----~rfilRd--~~~tig~G~I~~  389 (392)
                           ++|+|.|  ++.|+|+|+|..
T Consensus       390 ~n~~tGsFILID~~tn~TVaAGmI~~  415 (613)
T PRK05506        390 RNRTTGSFILIDRLTNATVGAGMIDF  415 (613)
T ss_pred             HCCCCCCEEEEECCCCCEEEEEEECH
T ss_conf             68666658999889995788983705


No 14 
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated
Probab=100.00  E-value=0  Score=608.19  Aligned_cols=354  Identities=32%  Similarity=0.488  Sum_probs=309.8

Q ss_pred             HHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC----------------
Q ss_conf             4210388279999904689887899999987644420013126868698629206378999821----------------
Q gi|254780263|r    5 RYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET----------------   68 (392)
Q Consensus         5 ~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~----------------   68 (392)
                      ++++.|||+||+++||||||||||+++|++.         .+|++++|++|||||+++|+++..                
T Consensus         1 ~~~~~~p~vNIgtiGHVDHGKTTLv~aLTg~---------~tdr~~eE~~RGiTI~LG~a~~~~~~~~~~~~~~~~~~~~   71 (410)
T PRK04000          1 MWEFVQPEVNIGMVGHVDHGKTTLVQALTGV---------WTDTHSEELKRGITIRLGYADATIYKCPNCEGPEAYTTEP   71 (410)
T ss_pred             CCCCCCCCCEEEEEEEECCCHHHHHHHHHCC---------CCCCCHHHHHCCCCCCCCCCCEEHHCCCCCCCCCCEEEEC
T ss_conf             9877899526999965178699999887397---------5423887886488121051010012054555444135302


Q ss_pred             ----------CCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCC-CCCHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             ----------9908999847873024677987740023314520123443-32106778888631876023310023335
Q gi|254780263|r   69 ----------DKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGP-KPQTREHILLARQIGISSIVVYMNKVDAV  137 (392)
Q Consensus        69 ----------~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~-~~QT~eh~~l~~~lgi~~iIv~iNKmD~v  137 (392)
                                ..++|+|||+|||++|++||++|++++|+|||||||++|+ ||||+||+.+++++||+++||++||||++
T Consensus        72 ~~~~~~~~~~~~r~is~VD~PGHe~fi~nMi~Gas~~D~alLVVaA~eG~p~pQT~EHl~i~~~lgi~~~iV~lnK~Dlv  151 (410)
T PRK04000         72 TCPKCGSETELLRRVSFVDAPGHETLMATMLSGAALMDGAVLVIAANEPCPQPQTKEHLMALDIIGIKNIVIVQNKIDLV  151 (410)
T ss_pred             CCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEECCCCC
T ss_conf             33444555443316999979887999999984021266799998657787677149999999980998379999625678


Q ss_pred             CCHHHHHHCCCCCCEEEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCC
Q ss_conf             61222110123210011101453221023311467641144456521233203443102522221000011000000013
Q gi|254780263|r  138 DDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCG  217 (392)
Q Consensus       138 ~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~  217 (392)
                      ++++..+ ..++++++|+... .++.|+||+||.++.          +++.|+++|++++|.|.++.++||||+|+++|.
T Consensus       152 ~~e~~~~-~~~ei~~~l~g~~-~~~~piipvSa~~g~----------~i~~L~~~l~~~~~~p~r~~~~~f~m~Vdr~F~  219 (410)
T PRK04000        152 SKEKALE-NYEQIKEFVKGTV-AENAPIIPVSALHGV----------NIDALIEAIEEEIPTPERDLDKPPLMYVARSFD  219 (410)
T ss_pred             CHHHHHH-HHHHHHHHHCCCC-CCCCCEEEEECCCCC----------CCCHHHHHHHHHCCCCCCCCCCCCEEEEEEEEE
T ss_conf             9899999-9999999870676-568999996477788----------940899989862778777888994489988885


Q ss_pred             CCCCCC--------CEEEEEEECCCCCCCEEEEEECCC---------CCCCEEEECCCCCCCCCCCCCCCHHHHHHHC--
Q ss_conf             554454--------301487424534896799950687---------4321254121001211443210013666411--
Q gi|254780263|r  218 IEGRGT--------VVTGCIKRGRIKAGSDVEIIGMGG---------KKLKVKCTDVEMFRKKLDEAIAGDNVGLLLR--  278 (392)
Q Consensus       218 i~g~G~--------Vv~GrV~sG~l~~Gd~i~i~p~~~---------~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lk--  278 (392)
                      +.|.|+        |++|+|++|++++||++.++|...         ++..++|++|++|++++++|.||+++|++++  
T Consensus       220 i~g~Gt~~~~~~G~VvtGtv~~G~ik~GD~vei~Pg~~~~~~~~~~~~pi~t~V~si~~~~~~~~~a~aG~~vai~~~ld  299 (410)
T PRK04000        220 VNKPGTPPEKLKGGVIGGSLIQGVLKVGDEIEIRPGIKVEKGGKTKWEPITTKITSLRAGGEKVEEARPGGLVGVGTKLD  299 (410)
T ss_pred             ECCCCCCCCCCCCCEEEEEEEEEEEECCCEEEEECCCCCCCCCCCCCCCCEEEEEEEEECCEEHHEECCCCEEEECCCCC
T ss_conf             05798655356441788899762784299899944743345665311221269989974783911013676585223345


Q ss_pred             -CCCCCEEECHHEEECCCCCCCC-EEEEEEEEEEECC----CCCCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCC
Q ss_conf             -2454322021177326777630-0016899971056----787555511597899995414777999961895570789
Q gi|254780263|r  279 -GVNRADVPRGRVVCAPGSIQEY-SRFRASVYILTAS----EGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPG  352 (392)
Q Consensus       279 -gi~~~di~rGdvl~~~~~~~~~-~~f~A~i~il~~~----~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g  352 (392)
                       ++...|+.||+|++.|+.++++ ..|++++.+|+..    +.....+++.++.+++|++++++.+++...+..      
T Consensus       300 ~~i~r~D~~rG~Vl~~pg~l~p~~~~~~~~~~ll~~~~g~~~~~~~~plk~~~~~~~~~gTa~~~g~v~~~~~~------  373 (410)
T PRK04000        300 PALTKADALAGSVAGKPGTLPPVWTSLTIEVHLLERVVGTKEELKVEPIKTGEPLMLNVGTATTVGVVTSAKKD------  373 (410)
T ss_pred             CCCCHHHHHCCCEEECCCCCCCCEEEEEEEEEEEHHHCCCCCCCCCCCCCCCCEEEEEEECCCEEEEEEECCCC------
T ss_conf             55335574156554359976874169999999980112653346667765796489998116278999977898------


Q ss_pred             CEEEEEEEECCCEEECCCCEEEE--EECCE--EEEEEEEE
Q ss_conf             76999999778177546984999--98996--99989995
Q gi|254780263|r  353 DRVDLEVELIYPIAMEPNQTFSM--REGGK--TVGAGLIL  388 (392)
Q Consensus       353 ~~~~v~l~l~~pi~~e~~~rfil--Rd~~~--tig~G~I~  388 (392)
                         .++++|.+|+|++.++||+|  |++++  |||+|.|.
T Consensus       374 ---~~~l~L~~Pv~~~~g~Rf~i~rr~~~r~rtIG~G~i~  410 (410)
T PRK04000        374 ---EAEVKLKRPVCAEEGSRVAISRRVGGRWRLIGYGIIK  410 (410)
T ss_pred             ---EEEEEECCCEECCCCCEEEEEEECCCCEEEEEEEEEC
T ss_conf             ---7999969436368899899998359953787258969


No 15 
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional
Probab=100.00  E-value=0  Score=601.76  Aligned_cols=335  Identities=27%  Similarity=0.407  Sum_probs=301.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC-CEEEEEEECCCCHHHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789998219-90899984787302467798774
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD-KRFYSHIDCPGHADYVKNMITGA   92 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~-~~~i~iiD~PGH~~f~~~mi~g~   92 (392)
                      -|+++||||||||||+.+||+.         ++|+++|||+|||||+++|++|..+ ++++.|||.|||++|++||++|+
T Consensus         2 IigTAGHVDHGKTsLvkALTG~---------dtDRL~EEk~RGiTIdLGFA~~~l~~g~~~g~VDVPGHErFIknMlAG~   72 (615)
T PRK10512          2 IIATAGHVDHGKTTLLQAITGV---------NADRLPEEKKRGMTIDLGYAYWPQPDGRVLGFIDVPGHEKFLSNMLAGV   72 (615)
T ss_pred             EEEEECCCCCCHHHHHHHHHCC---------CCCCCHHHHHHCCEEEECEEEEECCCCCEEEEEECCCHHHHHHHHHHHH
T ss_conf             8996365477899999998688---------8656977897187277130755579997899987998389999997446


Q ss_pred             HCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCEEEE
Q ss_conf             00233145201234433210677888863187602331002333561222110123210011101453221023311467
Q gi|254780263|r   93 TQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALC  172 (392)
Q Consensus        93 ~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~sa~~  172 (392)
                      +.+|.++|||+|+||+||||+||+.++++|||++++||+||+|+|+++ +.+.++++++++++... ..+.|++++|+.+
T Consensus        73 ~gid~vlLVVAAdeGvMPQT~EHl~Il~lLgi~~giV~lTK~Dlvd~e-~l~~v~~ei~~~l~~t~-l~~~pi~~vSa~t  150 (615)
T PRK10512         73 GGIDHALLVVACDDGVMAQTREHLAILQLTGNPMLTVALTKADRVDEA-RIDEVRRQVLEVLREYG-FAEAKLFVTAATE  150 (615)
T ss_pred             HHCCEEEEEEECCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHH-HHHHHHHHHHHHHHCCC-CCCCCEEECCCCC
T ss_conf             437889999988998772379999999981998289999776568979-99999999999984478-7679752014566


Q ss_pred             EEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCE
Q ss_conf             64114445652123320344310252222100001100000001355445430148742453489679995068743212
Q gi|254780263|r  173 ALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKV  252 (392)
Q Consensus       173 g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~  252 (392)
                      |          .+++.|.++|.... .+.++.+++||||||++|.++|.||||+|++.||++++||++.++|.+   ..+
T Consensus       151 g----------~Gi~~L~~~L~~l~-~~~~~~~~~fRL~IDRvFsvkG~GTVVTGTl~sG~v~~GD~l~i~P~~---~~~  216 (615)
T PRK10512        151 G----------RGIDALREHLLQLP-EREHASQHRFRLAIDRAFTVKGAGLVVTGTALSGEVKVGDTLWLTGVN---KPM  216 (615)
T ss_pred             C----------CCHHHHHHHHHHHC-CCCCCCCCCEEEEEEEEEECCCCCEEEEEEEECCEECCCCEEEECCCC---CEE
T ss_conf             6----------79999999998625-566676776178831189626885699999814714269989986999---679


Q ss_pred             EEECCCCCCCCCCCCCCCHHHHHHHCC-CCCCEEECHHEEECCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEE
Q ss_conf             541210012114432100136664112-4543220211773267776300016899971056787555511597899995
Q gi|254780263|r  253 KCTDVEMFRKKLDEAIAGDNVGLLLRG-VNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFM  331 (392)
Q Consensus       253 kv~si~~~~~~v~~a~aGd~v~l~Lkg-i~~~di~rGdvl~~~~~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~  331 (392)
                      +|++||.|++++++|.||++||+||+| ++.++|.|||+|+++++..+++++.+++.   .     ..+++++.+.++|+
T Consensus       217 rVR~iQ~h~~~v~~a~aG~R~AlNL~G~v~~~~i~RGd~L~~~~~~~~~~~~~v~l~---~-----~~~lk~~~~v~l~~  288 (615)
T PRK10512        217 RVRALHAQNQPTETAHAGQRIALNIAGDAEKEQINRGDWLLADAPPEPFTRVIVELQ---T-----HTPLTQWQPLHIHH  288 (615)
T ss_pred             EEEEHHHCCCCCCEECCCCEEEEEECCCCCHHHCCCCCEEECCCCCCCEEEEEEEEC---C-----CCCCCCCCEEEEEE
T ss_conf             873477679815573277459996125446723178668923888775359999957---8-----99865893799996


Q ss_pred             CCEEEEEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEEEE--CCEEEEEEEEEEE
Q ss_conf             4147779999618955707897699999977817754698499998--9969998999553
Q gi|254780263|r  332 DTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMRE--GGKTVGAGLILEI  390 (392)
Q Consensus       332 ~~~~v~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilRd--~~~tig~G~I~~v  390 (392)
                      |++++.||+.+.+.         +++++.|++|+++..+|||+||+  ..+|||+|.|+++
T Consensus       289 Gt~~v~~rv~ll~~---------~~aqL~Le~pv~~~~GDRfIlR~~Sp~~TIGGG~VLd~  340 (615)
T PRK10512        289 AASHVTGRVSLLED---------NLAELVFDTPLWLADNDRLVLRDISARNTLAGARVVML  340 (615)
T ss_pred             CCCCEEEEEEECCC---------CEEEEEECCCEEEECCCEEEEECCCCCEEEEEEEEECC
T ss_conf             45102799995488---------46999978945455397689962888826762799688


No 16 
>TIGR02034 CysN sulfate adenylyltransferase, large subunit; InterPro: IPR011779    Metabolic assimilation of sulphur from inorganic sulphate, requires sulphate activation by coupling to a nucleoside, for the production of high-energy nucleoside phosphosulphates. This pathway appears to be similar in all prokaryotic organisms. Activation is first achieved through sulphation of sulphate with ATP by sulphate adenylyltransferase (ATP sulphurylase) to produce 5'-phosphosulphate (APS), coupled by GTP hydrolysis. Subsequently, APS is phosphorylated by an APS kinase to produce 3'-phosphoadenosine-5'-phosphosulphate (PAPS) . In Escherichia coli, ATP sulphurylase is a heterodimer composed of two subunits encoded by cysD and cysN, with APS kinase encoded by cysC. These genes are located in a unidirectionally transcribed gene cluster, and have been shown to be required for the synthesis of sulphur-containing amino acids . Homologous to this E. coli activation pathway are nodPQH gene products found among members of the Rhizobiaceae family. These gene products have been shown to exhibit ATP sulphurase and APS kinase activity, yet are involved in Nod factor sulphation, and sulphation of other macromolecules . With members of the Rhizobiaceae family, nodQ often appears as a fusion of cysN (large subunit of ATP sulphurase) and cysC (APS kinase) , .; GO: 0016772 transferase activity transferring phosphorus-containing groups.
Probab=100.00  E-value=0  Score=603.59  Aligned_cols=360  Identities=27%  Similarity=0.402  Sum_probs=308.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHH-----------HHHH----HHHCCCC------CCCCHHHHHCCCEEEEEEEEEECCCE
Q ss_conf             7999990468988789999998-----------7644----4200131------26868698629206378999821990
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITK-----------YYSE----EKKEYGD------IDSAPEEKLRGITIATAHVSYETDKR   71 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~-----------~~~~----~~~~~~~------~D~~~~E~~rGiTi~~~~~~~~~~~~   71 (392)
                      |++.+||+||.|||||+|||++           .+..    ++.+.+.      +|.+..|||+|||||++|+||.|++|
T Consensus         1 LRflTCGSVDDGKSTLIGRLLhDtK~i~eDQL~~l~~DS~~~G~~G~~iD~ALLVDGL~AEREQGITIDVAYRYFsT~KR   80 (411)
T TIGR02034         1 LRFLTCGSVDDGKSTLIGRLLHDTKQIYEDQLAALERDSKKHGTQGEEIDLALLVDGLQAEREQGITIDVAYRYFSTDKR   80 (411)
T ss_pred             CCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCC
T ss_conf             93352054458731022222555521689999998852255347887652341330677443248612133132577876


Q ss_pred             EEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH-HHHHHCCCCC
Q ss_conf             899984787302467798774002331452012344332106778888631876023310023335612-2211012321
Q gi|254780263|r   72 FYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDD-ELLDISEYEI  150 (392)
Q Consensus        72 ~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~-~~~~~i~~~i  150 (392)
                      +|.+-|||||+.|+|||.+|||.||.|||+|||++|+..|||+|..++.+|||+|+|+||||||||+|+ +.|+.|+++.
T Consensus        81 kFIvADTPGHEQYTRNMATGAST~dlAvlLvDAR~Gvl~QTRRHs~i~sLLGIrh~VlAVNKmDLvdyd~~vF~~I~~~y  160 (411)
T TIGR02034        81 KFIVADTPGHEQYTRNMATGASTADLAVLLVDARKGVLEQTRRHSYIASLLGIRHVVLAVNKMDLVDYDEEVFENIKKDY  160 (411)
T ss_pred             CEEEECCCCCCCCCCCCCHHCCCCCEEEEEEEHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHH
T ss_conf             17884085594154430000131124665542102134567799999886045389999970111476578899999999


Q ss_pred             CEEEEEE-EEEEEEECCCCEEEEEEECC-C--CCCCCCCCCCHHHHHHCCCCCCC-CCCCCCCCEECCCCC--CC-CCCC
Q ss_conf             0011101-45322102331146764114-4--45652123320344310252222-100001100000001--35-5445
Q gi|254780263|r  151 RDLLKEH-KYSDDTPIIRGSALCALQGT-N--KELGEDSIHALMKAVDTHIPTPQ-RSLDAPFLMHIEGSC--GI-EGRG  222 (392)
Q Consensus       151 ~~~l~~~-~~~~~~pii~~sa~~g~~~~-n--~~~~~~~~~~Ll~~i~~~~~~p~-~~~~~p~r~~I~~vf--~i-~g~G  222 (392)
                      ..|-.++ ++. ++.+||.||+.|-|.. +  ..|+||.+|+|||.|++ +.... ...+.|||||||+|.  +. .++|
T Consensus       161 ~~fa~~L~g~~-~~~~iP~SAL~GdNv~y~~S~~MpWY~GPtLle~LEt-v~~~~G~~~~~~lRfPVQyVnRPn~tdFRG  238 (411)
T TIGR02034       161 LAFAEQLAGVR-DVTFIPLSALKGDNVVYSRSESMPWYSGPTLLEHLET-VEVERGDAQDLPLRFPVQYVNRPNLTDFRG  238 (411)
T ss_pred             HHHHHHCCCCC-EEEEEEEECCCCCCEEECCCCCCCCCCCCCHHHHCCC-CCCCCCCCCCCCCEEEEEEEECCCCCCCCC
T ss_conf             99998638983-4799873313687402256678887578806530040-000367422478720045652688866652


Q ss_pred             CCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCC-CCCCE
Q ss_conf             43014874245348967999506874321254121001211443210013666411245432202117732677-76300
Q gi|254780263|r  223 TVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGS-IQEYS  301 (392)
Q Consensus       223 ~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~-~~~~~  301 (392)
                        ..|+|.||++++||+|.++|++   ..++|..|-++..++++|.+||.|+|.|+  ++.||+|||+|..+|. |+.+.
T Consensus       239 --yaGt~asG~v~~Gd~v~vlPSG---~~srV~rIVt~dg~l~~A~aG~AvTL~L~--~eiDisRGDll~~~D~~p~~~~  311 (411)
T TIGR02034       239 --YAGTIASGSVKVGDEVVVLPSG---RSSRVARIVTFDGDLEQAVAGQAVTLVLD--DEIDISRGDLLAAADSAPEVAD  311 (411)
T ss_pred             --HHHHEECCEECCCCEEEEEECC---CEEEEEEEEECCCCHHHCCCCCEEEEEEE--CEEEEECCHHHHCCCCCCCCCH
T ss_conf             --2231022553459889996279---64435588704653300668753899860--0043320022122467787012


Q ss_pred             EEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEE-------C----CCHHHHC-CCCEEEEEEEECCCEEECC
Q ss_conf             01689997105678755551159789999541477799996-------1----8955707-8976999999778177546
Q gi|254780263|r  302 RFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIIL-------S----PGSQAVM-PGDRVDLEVELIYPIAMEP  369 (392)
Q Consensus       302 ~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~-------~----~~~~~i~-~g~~~~v~l~l~~pi~~e~  369 (392)
                      +|.|.+.||..+      ++.+|.++.+-.++..+.++|..       +    ...+.+. -|+++.|+|.+++|+++|+
T Consensus       312 ~F~a~lVWm~~~------~l~PG~~Y~lk~g~~~v~a~v~~I~~~vdvn~~~~~~A~~L~GLN~iG~v~l~~~~~~~fd~  385 (411)
T TIGR02034       312 QFAATLVWMADE------PLLPGRSYLLKLGTRKVRASVTAIKHKVDVNTLEKNAAKELEGLNEIGLVNLSLDEPIAFDA  385 (411)
T ss_pred             HHEEEEEEECCC------CCCCCCEEEEEECCEEEEEEEEEEEEEECCCCCCHHHHHHHHCCCCEEEEEEEECCCCCCCC
T ss_conf             001256620113------45889537887324277589987779972464310221231068705799983066101354


Q ss_pred             C------CEEEEEE--CCEEEEEEEE
Q ss_conf             9------8499998--9969998999
Q gi|254780263|r  370 N------QTFSMRE--GGKTVGAGLI  387 (392)
Q Consensus       370 ~------~rfilRd--~~~tig~G~I  387 (392)
                      |      |.|||-|  +|.|||+|||
T Consensus       386 Y~~nR~tG~FILIDr~sN~TVgAGmi  411 (411)
T TIGR02034       386 YAENRTTGAFILIDRLSNATVGAGMI  411 (411)
T ss_pred             HHHCCCCEEEEEEECCCCCEECCCCC
T ss_conf             22188410279998466871124569


No 17 
>TIGR00485 EF-Tu translation elongation factor Tu; InterPro: IPR004541   Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution.   EF1A (also known as EF-1alpha or EF-Tu) is a G-protein. It forms a ternary complex of EF1A-GTP-aminoacyltRNA. The binding of aminoacyl-tRNA stimulates GTP hydrolysis by EF1A, causing a conformational change in EF1A that causes EF1A-GDP to detach from the ribosome, leaving the aminoacyl-tRNA attached at the A-site. Only the cognate aminoacyl-tRNA can induce the required conformational change in EF1A through its tight anticodon-codon binding , . EF1A-GDP is returned to its active state, EF1A-GTP, through the action of another elongation factor, EF1B (also known as EF-Ts or EF-1beta/gamma/delta).   This entry represents EF1A (or EF-Tu) proteins found primarily in bacteria, mitochondria and chloroplasts. Eukaryotic and archaeal EF1A (IPR004539 from INTERPRO) are excluded from this entry. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors .   More information about these proteins can be found at Protein of the Month: Elongation Factors .; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005622 intracellular.
Probab=100.00  E-value=0  Score=574.45  Aligned_cols=389  Identities=59%  Similarity=0.974  Sum_probs=368.5

Q ss_pred             CCHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHH----HCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEE
Q ss_conf             9612421038827999990468988789999998764442----001312686869862920637899982199089998
Q gi|254780263|r    1 MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEK----KEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHI   76 (392)
Q Consensus         1 m~~~~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~----~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~ii   76 (392)
                      |++++|.|.|+|+||+++||||||||||..+++..+....    .....+|..++|++|||||+.++..|+++.++|.-+
T Consensus         1 ~~~~~f~r~k~h~n~GtiGhvdhGkttl~aa~~~~l~~~~~~~~~~y~~id~aPee~~rGiti~~~~vey~~~~rhyahv   80 (394)
T TIGR00485         1 MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKEGKAAAKKYDEIDKAPEEKARGITINTAHVEYETEKRHYAHV   80 (394)
T ss_pred             CCCHHHHCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCEEEEEEEEEECCCCCCEEEE
T ss_conf             96001011467033301210015505789999999875100356767765237211334515653355421467515763


Q ss_pred             ECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEE
Q ss_conf             47873024677987740023314520123443321067788886318760233100233356122211012321001110
Q gi|254780263|r   77 DCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKE  156 (392)
Q Consensus        77 D~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~  156 (392)
                      |||||.||++||++|++|+|+|+|||+|.+|++|||+||+.|++..|+|.+++++||.|.++++++.++++.+++++|..
T Consensus        81 dCPGhadyvknmitGaaqmdGailvv~~~d~~mPqt~ehill~~~vGvP~~vvflnk~d~~~~~el~~lv~~e~~~ll~~  160 (394)
T TIGR00485        81 DCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPKIVVFLNKVDMVDDEELLELVELEVRELLSE  160 (394)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHEEEECCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             18862678887641011117607999527888874112100100268765787640233224278999999999999874


Q ss_pred             EEEEE-EEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCC
Q ss_conf             14532-21023311467641144456521233203443102522221000011000000013554454301487424534
Q gi|254780263|r  157 HKYSD-DTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIK  235 (392)
Q Consensus       157 ~~~~~-~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~  235 (392)
                      ..|.. +.|++..||+.++++++  ....++..|++.+++++|.|.|..++||.|+|.++|.+.|+|+|++|||+.|.++
T Consensus       161 ~~f~G~~~Pi~~Gsal~al~~~~--~~~~~~~~l~~~vd~~i~~P~r~~~~~fl~~~ed~~~i~GrGtv~tGr~e~G~~~  238 (394)
T TIGR00485       161 YDFPGDDVPIVRGSALKALEGDA--EWEEKILELMEAVDEYIPTPEREVDKPFLLPIEDVFSITGRGTVVTGRVERGVVK  238 (394)
T ss_pred             CCCCCCCCCEEECHHHHHHHHHH--HHHHHHHHHHHHHHHHCCCCCHHHCCCEEEEEEEEEEEECCCEEEEEEEEECEEE
T ss_conf             07898652256114565420036--7999999999999865067511314411455310467504634785024304476


Q ss_pred             CCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCCCCCEEEEEEEEEEECCCC
Q ss_conf             89679995068743212541210012114432100136664112454322021177326777630001689997105678
Q gi|254780263|r  236 AGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEG  315 (392)
Q Consensus       236 ~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~~~~~~f~A~i~il~~~~~  315 (392)
                      +|+++.+.+... .....+.++++|++.++.+.|||++|+.|+|+...++.||.+|+.|++..+...|++.+++|..+++
T Consensus       239 v~~~v~~~G~~~-~~~~~vtGvemf~k~l~~~~aG~n~G~llrG~~~~~~~rG~v~~~P~~~~~~~~f~~~~y~l~k~eG  317 (394)
T TIGR00485       239 VGEEVEIVGLKD-TKKTTVTGVEMFRKELDEGEAGDNVGLLLRGIKKEEIERGMVLAKPGSIKPHKKFEAEVYVLKKEEG  317 (394)
T ss_pred             ECCEEEEEEEEC-CCCEEEHHHHHHHHHHHCCCCCCCEEEEEECCCHHHCCCCEEEECCCCCCCCCCCCEEEEEEECCCC
T ss_conf             446479987402-4540221478888874113355420101104531210156378437632300012048999961688


Q ss_pred             CCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEEEECCEEEEEEEEEEEEC
Q ss_conf             75555115978999954147779999618955707897699999977817754698499998996999899955319
Q gi|254780263|r  316 GRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       316 ~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilRd~~~tig~G~I~~v~e  392 (392)
                      ++..+|..+|+|++|..+.++++.+...++.+.+.|||...+.++|..|++++.+.||.+|++|+|+|+|.|.++++
T Consensus       318 Grh~~f~~~yrPqfy~rt~dvtG~~~~~~~~~mv~PGd~~~~~~~li~~~a~~~G~~f~~reGG~tvGaG~v~~~~~  394 (394)
T TIGR00485       318 GRHTPFFSGYRPQFYLRTTDVTGKIELPEGVEMVMPGDNVKLTVELISPVALEEGLRFAIREGGRTVGAGVVSKILE  394 (394)
T ss_pred             CCCCHHHHCCCCEEEEEEECEEEEEEECCCCEEEECCCCEEEEEEEEEEEHHCCCCEEEEECCCCEECCHHHHHHCC
T ss_conf             73003342278505788511035775213515761587258999774120002586666413871321106776509


No 18 
>KOG0458 consensus
Probab=100.00  E-value=0  Score=555.88  Aligned_cols=376  Identities=27%  Similarity=0.415  Sum_probs=326.8

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHH-----------HHHHHHHCCCC--------CCCCHHHHHCCCEEEEEEEEEEC
Q ss_conf             038827999990468988789999998-----------76444200131--------26868698629206378999821
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITK-----------YYSEEKKEYGD--------IDSAPEEKLRGITIATAHVSYET   68 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~-----------~~~~~~~~~~~--------~D~~~~E~~rGiTi~~~~~~~~~   68 (392)
                      ..|+|+|++++||||+|||||+|||+.           ++.++....+.        +|..++||+||+|++.+..+|++
T Consensus       173 ~~k~~l~lvv~GhVdaGKSTLmG~lLydLg~i~~~~m~kl~~es~~~Gk~Sf~yawiLDeT~eERerGvTm~v~~~~fes  252 (603)
T KOG0458         173 DPKDHLNLVVLGHVDAGKSTLMGHLLYDLGEISSRSMHKLERESKNLGKSSFAYAWILDETKEERERGVTMDVKTTWFES  252 (603)
T ss_pred             CCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHCCEEEEEEEEEEEC
T ss_conf             87661589997023454111023788873686578899999998752875302567743631245436367754689846


Q ss_pred             CCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC-------CCHHHHHHHHHHCCCCCEEEEECCCCCCCCH-
Q ss_conf             99089998478730246779877400233145201234433-------2106778888631876023310023335612-
Q gi|254780263|r   69 DKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPK-------PQTREHILLARQIGISSIVVYMNKVDAVDDD-  140 (392)
Q Consensus        69 ~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~-------~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~-  140 (392)
                      +.+.++|+|+|||+||++|||.|+++||+|+|||||+.|.+       +||+||+.+++.|||.++||+|||||+|+|+ 
T Consensus       253 ~~~~~tliDaPGhkdFi~nmi~g~sqaD~avLvvd~s~~~FE~gfd~~gQtrEha~llr~Lgi~qlivaiNKmD~V~Wsq  332 (603)
T KOG0458         253 KSKIVTLIDAPGHKDFIPNMISGASQADVAVLVVDASTGEFESGFDPGGQTREHALLLRSLGISQLIVAINKMDLVSWSQ  332 (603)
T ss_pred             CCEEEEEECCCCCCCCCHHHHCCCCCCCEEEEEEECCCCHHHHCCCCCCCHHHHHHHHHHCCCCEEEEEEECCCCCCCCH
T ss_conf             86169986078742355234336221566899998775433313487986589999998749525888863010127538


Q ss_pred             HHHHHCCCCCCEEE-EEEEEEEE-EECCCCEEEEEEE-----CCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECC
Q ss_conf             22110123210011-10145322-1023311467641-----14445652123320344310252222100001100000
Q gi|254780263|r  141 ELLDISEYEIRDLL-KEHKYSDD-TPIIRGSALCALQ-----GTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIE  213 (392)
Q Consensus       141 ~~~~~i~~~i~~~l-~~~~~~~~-~pii~~sa~~g~~-----~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~  213 (392)
                      +||+++++.+..|| +..+|.+. +.+||+|+++|-+     -+|....||++++||+.|++ +..|.++.++||||.|.
T Consensus       333 ~RF~eIk~~l~~fL~~~~gf~es~v~FIPiSGl~GeNL~k~~~~~~l~~WY~Gp~LL~~id~-~~~p~~~~~kPl~ltIs  411 (603)
T KOG0458         333 DRFEEIKNKLSSFLKESCGFKESSVKFIPISGLSGENLIKIEQENELSQWYKGPTLLSQIDS-FKIPERPIDKPLRLTIS  411 (603)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHH-CCCCCCCCCCCEEEEHH
T ss_conf             89999999899999985285047765695546567762123341355665338808888861-36888766677487830


Q ss_pred             CCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEE-
Q ss_conf             0013554454301487424534896799950687432125412100121144321001366641124543220211773-
Q gi|254780263|r  214 GSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVC-  292 (392)
Q Consensus       214 ~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~-  292 (392)
                      ++|..++.|..++|+|+||.++.||+++++|+..   ...|++|..+.++...|.|||.|.+.|.+++..+++.|+++| 
T Consensus       412 di~~~~~~~~~i~gkiesG~iq~gqkl~i~~s~e---~~~vk~l~~~~~~~~~a~AGD~Vsl~L~~i~~n~v~~g~i~~~  488 (603)
T KOG0458         412 DIYPLPSSGVSISGKIESGYIQPGQKLYIMTSRE---DATVKGLTSNDEPKTWAVAGDNVSLKLPGILPNLVQVGDIADS  488 (603)
T ss_pred             HEEECCCCEEEEEEEEECCCCCCCCEEEEECCCC---EEEEEEEECCCCCCEEEEECCEEEEECCCCCHHHCCCCEEEEC
T ss_conf             0543588706899997214213599899835753---0799855438986215761778998537657645355204522


Q ss_pred             CCCCC-CCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEE-------------ECCCHHHHCCCCEEEEE
Q ss_conf             26777-63000168999710567875555115978999954147779999-------------61895570789769999
Q gi|254780263|r  293 APGSI-QEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRII-------------LSPGSQAVMPGDRVDLE  358 (392)
Q Consensus       293 ~~~~~-~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~-------------~~~~~~~i~~g~~~~v~  358 (392)
                      .++.| +.+.+|.|++.||+..     .++..|....+|.|....++++.             .+..++++..|+.|.++
T Consensus       489 ~~~~~i~~~~~f~~~~~~f~~~-----~Pi~~g~~l~l~~~~~~~pa~~~~l~~~~~k~t~~i~kk~pR~L~~~~~a~ve  563 (603)
T KOG0458         489 GPQFPISKTTRFVARITTFDIN-----LPITKGSPLILHFGSLSEPAVLKKLTSSINKSTGEIVKKKPRCLTSNQSAIVE  563 (603)
T ss_pred             CCCCCCCCEEEEEEEEEEEECC-----CCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCCCCHHHCCCCEECCCCEEEEE
T ss_conf             7875432113799998886035-----64557861588823314355543223212357773222255011357424665


Q ss_pred             EEECCCEEECCC------CEEEEEECCEEEEEEEEEEEEC
Q ss_conf             997781775469------8499998996999899955319
Q gi|254780263|r  359 VELIYPIAMEPN------QTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       359 l~l~~pi~~e~~------~rfilRd~~~tig~G~I~~v~e  392 (392)
                      ++...|+|++.|      +||++|..|.|||+|+|++|..
T Consensus       564 le~~~pI~~etf~~~~~lgr~vlr~~g~TiAaG~V~~i~~  603 (603)
T KOG0458         564 LETERPICLETFAENRALGRVVLRKSGSTIAAGKVTEIIQ  603 (603)
T ss_pred             CCCCCCHHHHHHHHCHHHEEEEEECCCCEEEEEEEEEECC
T ss_conf             0346750054444341331578721674563116886039


No 19 
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional
Probab=100.00  E-value=0  Score=551.24  Aligned_cols=358  Identities=28%  Similarity=0.438  Sum_probs=302.9

Q ss_pred             HHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEE-----------------
Q ss_conf             421038827999990468988789999998764442001312686869862920637899982-----------------
Q gi|254780263|r    5 RYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYE-----------------   67 (392)
Q Consensus         5 ~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~-----------------   67 (392)
                      +-+++|+.+||+++||||||||||+.+|++.         .+|++++|++|||||+++|+.+.                 
T Consensus        30 e~~~~q~~vNIGtiGHVDHGKTTLvkALTgv---------~t~r~~eE~~RgiTI~LGya~~kiykc~~~~~p~~y~~~~  100 (460)
T PTZ00327         30 EVISRQATINIGTIGHVAHGKSTVVKALSGV---------KTVRFHREKVRNITIKLGYANAKIYKCTKCPPPACYKSYP  100 (460)
T ss_pred             HHHHCCCCEEEEEECCCCCCHHHHHHHHHCC---------CHHHCHHHHHCCCEEEECCCCEEEECCCCCCCCCCEECCC
T ss_conf             8962588218988746289899999998677---------5010656787587212054330111365677631010146


Q ss_pred             ----------------CCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCC-CCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             ----------------19908999847873024677987740023314520123443-3210677888863187602331
Q gi|254780263|r   68 ----------------TDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGP-KPQTREHILLARQIGISSIVVY  130 (392)
Q Consensus        68 ----------------~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~-~~QT~eh~~l~~~lgi~~iIv~  130 (392)
                                      +..|+|.|||+|||++|++||++|++++|+|||||||++|+ +|||+||+.+++.+|++++||+
T Consensus       101 s~~~~~~~c~~c~~~~t~~Rh~s~VDcPGH~~l~~nmi~Ga~~mD~aiLvvaa~eg~P~pQT~EHl~~~~~~gi~~~iv~  180 (460)
T PTZ00327        101 SSKPDNPQCPGCGHKMTLKRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAANESCPQPQTSEHLAAVEIMKLKHIIIL  180 (460)
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHCHHHCCEEEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEE
T ss_conf             66655544555565431220489986898799999987476337679999986888876468999999997289719999


Q ss_pred             ECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCE
Q ss_conf             00233356122211012321001110145322102331146764114445652123320344310252222100001100
Q gi|254780263|r  131 MNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLM  210 (392)
Q Consensus       131 iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~  210 (392)
                      +||+|++++++..+.. ++++++|+.. +.++.|+||+||..++          +++.|++++++++|.|.|+.++||+|
T Consensus       181 ~nK~DlV~~e~~~~~~-~ei~~~l~~t-~~~~~PIIpvSA~~~~----------nid~L~~~i~~~ip~P~R~~~~~~~m  248 (460)
T PTZ00327        181 QNKIDLIKEVQALDQY-EEIRNFIDGT-IAENAPIIPISAQLKY----------NIDVLLEYICTQIPIPKRDLTSPPRM  248 (460)
T ss_pred             ECCCCCCCHHHHHHHH-HHHHHHHCCC-CCCCCCEEECCHHHCC----------CHHHHHHHHHHHCCCCCCCCCCCCEE
T ss_conf             5354455889999999-9999985257-6779998756544505----------87999999997589998888999537


Q ss_pred             ECCCCCCCCC--------CCCCEEEEEEECCCCCCCEEEEEECC------C----CCCCEEEECCCCCCCCCCCCCCCHH
Q ss_conf             0000013554--------45430148742453489679995068------7----4321254121001211443210013
Q gi|254780263|r  211 HIEGSCGIEG--------RGTVVTGCIKRGRIKAGSDVEIIGMG------G----KKLKVKCTDVEMFRKKLDEAIAGDN  272 (392)
Q Consensus       211 ~I~~vf~i~g--------~G~Vv~GrV~sG~l~~Gd~i~i~p~~------~----~~~~~kv~si~~~~~~v~~a~aGd~  272 (392)
                      +|+++|.+.+        +|+|++|++++|.+++||++.+.|.-      +    .....+|.++++++.++++|.||+.
T Consensus       249 ~I~rsFdIngpg~~~~~lrGtVvtGti~~G~lkvGDeIEI~PG~~~~~~~~k~~~~pi~t~I~sl~~~~~~l~~a~pGGl  328 (460)
T PTZ00327        249 IVIRSFDVNKPGEDIENLRGGVAGGSILQGVLKVGDEVEIRPGIVSKDSGGKFTCSPIRTRIVSLKAEQNELQYAVPGGL  328 (460)
T ss_pred             EEEEEECCCCCCCCCCCCCCEEEEEEEEEEEEECCCEEEECCCEEEEECCCEEEEEEEEEEEEEEEECCCCHHHCCCCCE
T ss_conf             48746715789866567654599889988179369989982675324158659999999999988725852421256753


Q ss_pred             HHHH--H-CCCCCCEEECHHEEECCCCCCC-CEEEEEEEEEEECCCCCCCCCCCCCC---------EEEEEECCEEEEEE
Q ss_conf             6664--1-1245432202117732677763-00016899971056787555511597---------89999541477799
Q gi|254780263|r  273 VGLL--L-RGVNRADVPRGRVVCAPGSIQE-YSRFRASVYILTASEGGRTTGFMDNY---------RPQFFMDTADVTGR  339 (392)
Q Consensus       273 v~l~--L-kgi~~~di~rGdvl~~~~~~~~-~~~f~A~i~il~~~~~~~~~~~~~~~---------~~~~~~~~~~v~~~  339 (392)
                      +++.  | .++.+.|..+|+|++.|+++++ ...|++++++|....+.+..++..++         ..++.++++...++
T Consensus       329 igiGT~Ldp~ltr~D~l~GqVlgkPGslppv~~~~~~e~~lL~k~vG~~~~~~~~~~k~~~~~~~e~l~~~igt~~t~g~  408 (460)
T PTZ00327        329 IGVGTTIDPTLTRADRLVGQVLGEPGQLPEVYAEIEVQYYLLRRLVGAKSQDGKKAKKVQKLNVNEFLMINIGSTSTGGR  408 (460)
T ss_pred             EEECCCCCCCCCCCCCCCCCEEECCCCCCCCEEEEEEEEEEEHHHCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCEE
T ss_conf             65322014662113101467786699778752899999999812328746888767664344237359999886466769


Q ss_pred             EEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEEE----ECCEEEEEEEEEEEE
Q ss_conf             9961895570789769999997781775469849999----899699989995531
Q gi|254780263|r  340 IILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMR----EGGKTVGAGLILEII  391 (392)
Q Consensus       340 i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilR----d~~~tig~G~I~~v~  391 (392)
                      +...        ++...+.++|.+|+|++.++||++|    +.|||||||.|.+-.
T Consensus       409 V~~v--------~~d~~~~v~L~~PIc~~~G~r~AIsRrV~~~wRlIG~G~I~kg~  456 (460)
T PTZ00327        409 VTNI--------KTDDIAKLELTTPVCTSTGEKIAISRRVDKHWRLIGWGQIRKGV  456 (460)
T ss_pred             EEEE--------CCCCEEEEEECCCEECCCCCEEEEEEECCCCCEEEEEEEECCCE
T ss_conf             9986--------89957999937536568899899997418895798289982777


No 20 
>TIGR00475 selB selenocysteine-specific translation elongation factor; InterPro: IPR004535   In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3' or 5' non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation .   This family describes the elongation factor SelB, a close homologue of EF-Tu. It may function by replacing EF-Tu. A C-terminal domain not found in EF-Tu is in all SelB sequences in the seed alignment except that from Methanococcus jannaschii. This family should not include an equivalent protein for eukaryotes. ; GO: 0003723 RNA binding, 0003746 translation elongation factor activity, 0005525 GTP binding, 0001514 selenocysteine incorporation, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=544.75  Aligned_cols=351  Identities=26%  Similarity=0.427  Sum_probs=304.1

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHH-HCCCEEEEEEEEEECCC--EEEEEEECCCCHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698-62920637899982199--0899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEK-LRGITIATAHVSYETDK--RFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~-~rGiTi~~~~~~~~~~~--~~i~iiD~PGH~~f~~~mi   89 (392)
                      ++||+.||||||||||+.+||+..+.      -+|++|+|+ +||+|||+||+||..++  ++++|||+|||+.|++||+
T Consensus         1 ~~~at~GHvDHGKT~L~k~LTgi~st------sa~~lPeEkqKRG~tIDLGfAy~~l~~~n~~l~~iDvPGHe~fl~n~l   74 (627)
T TIGR00475         1 MIIATAGHVDHGKTTLLKALTGIDST------SADRLPEEKQKRGMTIDLGFAYLPLPDINKRLGFIDVPGHEKFLSNAL   74 (627)
T ss_pred             CEEEEECCCCHHHHHHHHHHCCCCCH------HHHCCCCCCCCCCCEEECCCEECCCCCCCCCCEEEECCCHHHHHHHHH
T ss_conf             96873124450479999985064301------231277410257662460420036777771334785597389999986


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCE
Q ss_conf             77400233145201234433210677888863187602331002333561222110123210011101453221023311
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGS  169 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~s  169 (392)
                      +|.+.+|+|||||||+||+++||+|||.+++.+|+|++||+|||||.+|++ +.+.+|.+++.+|.+..+..+..+|.+|
T Consensus        75 Ag~~~i~~alLvVda~eG~~~QT~EHL~vl~~l~~~~~ivvltK~D~~d~~-~~~~~E~~~~~~l~~~~~~~n~~~~~~S  153 (627)
T TIGR00475        75 AGIGGIDAALLVVDADEGVMTQTKEHLAVLKLLGIPELIVVLTKADRVDEE-EVKRVEEELKEILEEYEFLKNAKIFKTS  153 (627)
T ss_pred             HHHHHHHHHEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHH-HHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             675654010035415778853238999999970896199997346745658-9999999999998764321157479991


Q ss_pred             EEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCC
Q ss_conf             46764114445652123320344310252222100001100000001355445430148742453489679995068743
Q gi|254780263|r  170 ALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKK  249 (392)
Q Consensus       170 a~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~  249 (392)
                      |.+|--.+   .....+..|+|.++.     .|+.++||||+||++|.++|.|||++|++.+|.+++||++++.|.+   
T Consensus       154 A~tG~Gi~---~Lk~~L~~L~e~~~~-----~r~~~~~lr~~iD~aF~vKG~GtVvtGt~f~G~VkvGD~~~~~pig---  222 (627)
T TIGR00475       154 AKTGQGIE---ELKKELKNLLESLDI-----KRDKQKPLRLAIDRAFKVKGAGTVVTGTAFSGEVKVGDKLVLEPIG---  222 (627)
T ss_pred             CCCCCCHH---HHHHHHHHHHHHHHH-----HHCCCCCCCCCCCEEEEECCCEEEEEEEEEEEEEEECCEEEEEECC---
T ss_conf             34687778---999999865777655-----4201566651032155870302468755784168988889981058---


Q ss_pred             CCEEEECCCCCCCCCCCCCCCHHHHHHHC-CCCCCEEECHHEEECCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEE
Q ss_conf             21254121001211443210013666411-24543220211773267776300016899971056787555511597899
Q gi|254780263|r  250 LKVKCTDVEMFRKKLDEAIAGDNVGLLLR-GVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQ  328 (392)
Q Consensus       250 ~~~kv~si~~~~~~v~~a~aGd~v~l~Lk-gi~~~di~rGdvl~~~~~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~  328 (392)
                      ..++|++|+.|+.+++.|+|||++||||. +++...+.|||++|...|+.+..+.-.++  ..      ..++..+..++
T Consensus       223 ~~~rvk~~~~~~~~~~~A~AG~RiALnL~~~vd~~~~~RGDWll~~~p~~~~~~~v~~~--~a------~v~L~~~~~~~  294 (627)
T TIGR00475       223 KEVRVKAIQAQNQDVEKAVAGQRIALNLAADVDKEKLKRGDWLLILKPEDPKKRVVVKL--KA------EVPLKELQPYH  294 (627)
T ss_pred             CEEEEEEEECCCCCCCEEECHHHHHHHCCCCCCCCCCCCCCEEECCCCCCCCCEEEEEE--EE------ECCCCCCCEEE
T ss_conf             36788640205885221002013654123457612256651220278888553278999--85------11235374046


Q ss_pred             EEECCEEEEEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEEEE--CCEEEEEEEEEEE
Q ss_conf             9954147779999618955707897699999977817754698499998--9969998999553
Q gi|254780263|r  329 FFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMRE--GGKTVGAGLILEI  390 (392)
Q Consensus       329 ~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilRd--~~~tig~G~I~~v  390 (392)
                      +|.+..++++|+.+.++.. ...||..+.++.++.|+.+..++|+++||  ++.++|+..|.++
T Consensus       295 ~~~~~~~~~gk~sll~~~n-aakndrtl~l~~l~~~~~~~~~dkL~~~~~s~~n~laGArVl~~  357 (627)
T TIGR00475       295 IFHGMSETTGKISLLDKKN-AAKNDRTLALLVLDEPLILAKGDKLVLRDISSKNLLAGARVLEP  357 (627)
T ss_pred             EECCCCEEEEEEEEEECCC-CCCCCCEEEEEEECCCCEEECCCEEEEECCCCCCCCCCEEEECC
T ss_conf             4203401420488971776-43234427999845742010486578713663431123178324


No 21 
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]
Probab=100.00  E-value=0  Score=536.68  Aligned_cols=369  Identities=27%  Similarity=0.379  Sum_probs=308.0

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHH-----------HHHHHHH---CC-CC------CCCCHHHHHCCCEEEEEEEEE
Q ss_conf             038827999990468988789999998-----------7644420---01-31------268686986292063789998
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITK-----------YYSEEKK---EY-GD------IDSAPEEKLRGITIATAHVSY   66 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~-----------~~~~~~~---~~-~~------~D~~~~E~~rGiTi~~~~~~~   66 (392)
                      +.|+.||+.+|||||+|||||+|||+.           .+....+   .. ..      +|.+..|||+|||||++|.||
T Consensus         2 ~~k~lLRfiTcGSVDDGKSTLIGRLL~Dtk~i~eDQla~l~~dS~~~~t~g~~~D~ALLvDGL~AEREQGITIDVAYRyF   81 (431)
T COG2895           2 QHKSLLRFITCGSVDDGKSTLIGRLLYDTKAIYEDQLASLERDSKRKGTQGEKIDLALLVDGLEAEREQGITIDVAYRYF   81 (431)
T ss_pred             CCCCCEEEEEECCCCCCCHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEEC
T ss_conf             86541368975353686023244655310110577999875213123677875452563325688886496599876410


Q ss_pred             ECCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH-HHHHH
Q ss_conf             21990899984787302467798774002331452012344332106778888631876023310023335612-22110
Q gi|254780263|r   67 ETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDD-ELLDI  145 (392)
Q Consensus        67 ~~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~-~~~~~  145 (392)
                      .|++|+|.+.|||||+.|++||++|+|.||.|+|+|||++|+.+|||+|..++.+|||+|++++|||||+++|+ ++|+.
T Consensus        82 sT~KRkFIiADTPGHeQYTRNMaTGASTadlAIlLVDAR~Gvl~QTrRHs~I~sLLGIrhvvvAVNKmDLvdy~e~~F~~  161 (431)
T COG2895          82 STEKRKFIIADTPGHEQYTRNMATGASTADLAILLVDARKGVLEQTRRHSFIASLLGIRHVVVAVNKMDLVDYSEEVFEA  161 (431)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCHHHHHH
T ss_conf             36663089845996798764222362300379999964221677767789999972876799997410123567899999


Q ss_pred             CCCCCCEEEEEEEEEEEEECCCCEEEEEEECC--CCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCC--CCC
Q ss_conf             12321001110145322102331146764114--44565212332034431025222210000110000000135--544
Q gi|254780263|r  146 SEYEIRDLLKEHKYSDDTPIIRGSALCALQGT--NKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGI--EGR  221 (392)
Q Consensus       146 i~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~--n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i--~g~  221 (392)
                      +..+...|..++++... .+||+||+.|-|..  +..|+||.+++||+.|++. +.......+|||||||.+.+.  .++
T Consensus       162 I~~dy~~fa~~L~~~~~-~~IPiSAl~GDNV~~~s~~mpWY~GptLLe~LE~v-~i~~~~~~~~~RfPVQ~V~Rp~~dfR  239 (431)
T COG2895         162 IVADYLAFAAQLGLKDV-RFIPISALLGDNVVSKSENMPWYKGPTLLEILETV-EIADDRSAKAFRFPVQYVNRPNLDFR  239 (431)
T ss_pred             HHHHHHHHHHHCCCCCC-EEEECHHHCCCCCCCCCCCCCCCCCCCHHHHHHHC-CCCCCCCCCCEEECEEEECCCCCCCC
T ss_conf             99999999997699852-47743230487533465678864685099997412-23455436650102288617897621


Q ss_pred             CCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCC-CCCC
Q ss_conf             543014874245348967999506874321254121001211443210013666411245432202117732677-7630
Q gi|254780263|r  222 GTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGS-IQEY  300 (392)
Q Consensus       222 G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~-~~~~  300 (392)
                      |  ..|+|+||++++||++.++|++   ..++|++|..++.++++|.||+.|++.|.  +..|++|||+|++.+. |.++
T Consensus       240 G--yaGtiasG~v~~Gd~vvvlPsG---~~s~V~~Ivt~dg~~~~A~aG~aVtl~L~--deidisRGd~i~~~~~~~~~~  312 (431)
T COG2895         240 G--YAGTIASGSVKVGDEVVVLPSG---KTSRVKRIVTFDGELAQASAGEAVTLVLA--DEIDISRGDLIVAADAPPAVA  312 (431)
T ss_pred             C--CCEEEECCCEECCCEEEECCCC---CEEEEEEEECCCCCHHHCCCCCEEEEEEC--CEEECCCCCEEECCCCCCCHH
T ss_conf             0--0304403514059748994589---70357999646871654168842899980--002002573787068985522


Q ss_pred             EEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEE-----------CCCHHHHCCCCEEEEEEEECCCEEECC
Q ss_conf             001689997105678755551159789999541477799996-----------189557078976999999778177546
Q gi|254780263|r  301 SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIIL-----------SPGSQAVMPGDRVDLEVELIYPIAMEP  369 (392)
Q Consensus       301 ~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~-----------~~~~~~i~~g~~~~v~l~l~~pi~~e~  369 (392)
                      ..|.|.++||..+      ++.+|.++.+-.++..+.+++.-           .+..+.+..|+++.|++.+++|+++++
T Consensus       313 ~~f~A~vvWm~~~------pl~pGr~Y~lK~~t~~v~a~V~~i~~~ldvntl~~~~a~~l~lN~Ig~v~i~~~~pi~fd~  386 (431)
T COG2895         313 DAFDADVVWMDEE------PLLPGRSYDLKIATRTVRARVEEIKHQLDVNTLEQEGAESLPLNEIGRVRISFDKPIAFDA  386 (431)
T ss_pred             HHCCEEEEEECCC------CCCCCCEEEEEECCEEEEEEEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCEEECC
T ss_conf             3216069984377------7788846888841247789861127898435001000001477763599996378555032


Q ss_pred             C------CEEEEEE--CCEEEEEEEEEEEE
Q ss_conf             9------8499998--99699989995531
Q gi|254780263|r  370 N------QTFSMRE--GGKTVGAGLILEII  391 (392)
Q Consensus       370 ~------~rfilRd--~~~tig~G~I~~v~  391 (392)
                      |      ++|+|.|  +|.|+|+|+|..-+
T Consensus       387 Y~~N~atG~FIlID~~tn~TVgaGmI~~~l  416 (431)
T COG2895         387 YAENRATGSFILIDRLTNGTVGAGMILASL  416 (431)
T ss_pred             CCCCCCCCCEEEEECCCCCCEECEEEECHH
T ss_conf             014755564799975878851020351126


No 22 
>TIGR01394 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298   This bacterial (and Arabidopsis) protein, termed TypA or BipA, is a GTP-binding protein. It is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways, but the precise function is unknown.; GO: 0005525 GTP binding, 0005622 intracellular.
Probab=100.00  E-value=0  Score=539.49  Aligned_cols=331  Identities=28%  Similarity=0.374  Sum_probs=292.5

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHH-H-HH----HCCCCCCCCHHHHHCCCEEEEEEEEEECCC----EEEEEEECCCCHH
Q ss_conf             999990468988789999998764-4-42----001312686869862920637899982199----0899984787302
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYS-E-EK----KEYGDIDSAPEEKLRGITIATAHVSYETDK----RFYSHIDCPGHAD   83 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~-~-~~----~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~----~~i~iiD~PGH~~   83 (392)
                      |||||+|||||||||++.||+..+ . ++    .....||+++.||||||||-++.+...|++    ++|||||||||+|
T Consensus         3 NIAIIAHVDHGKTTLVD~LL~Qsgf~f~~~~~~~~ER~MDSNDLErERGITILaKNTav~y~g~dG~~~INIvDTPGHAD   82 (609)
T TIGR01394         3 NIAIIAHVDHGKTTLVDALLKQSGFTFRADNEAVAERVMDSNDLERERGITILAKNTAVRYNGKDGVTKINIVDTPGHAD   82 (609)
T ss_pred             CEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHCCCCCCCEEEEEEECCCCCEEEEEEEECCCCCC
T ss_conf             18999880699436898888876588641588321354067652100155201300366252889718997781689887


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEE---
Q ss_conf             46779877400233145201234433210677888863187602331002333561222110123210011101453---
Q gi|254780263|r   84 YVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYS---  160 (392)
Q Consensus        84 f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~---  160 (392)
                      |.+++.|.++++|+|||||||.||+|||||.+|..|-.+|.++ ||||||+|+  ++.|.+++.+++.++|-.++..   
T Consensus        83 FGGEVERvL~MVDGvlLlVDA~EGPMPQTrFVL~KAL~~gLkP-IVViNKiDr--p~ARP~eV~d~vFDLF~~LgA~deQ  159 (609)
T TIGR01394        83 FGGEVERVLGMVDGVLLLVDASEGPMPQTRFVLKKALELGLKP-IVVINKIDR--PSARPDEVVDEVFDLFIELGADDEQ  159 (609)
T ss_pred             CCCEEEEECEEEEEEEEEEECCCCCCCCCHHHHHHHHHCCCCE-EEEECCCCC--CCCCHHHHHHHHHHHHHHCCCCCCC
T ss_conf             8865887330240589998578889885347899999568936-999713478--8788378875787888853888001


Q ss_pred             EEEECCCCEEEEEEECCC-----CCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCC
Q ss_conf             221023311467641144-----456521233203443102522221000011000000013554454301487424534
Q gi|254780263|r  161 DDTPIIRGSALCALQGTN-----KELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIK  235 (392)
Q Consensus       161 ~~~pii~~sa~~g~~~~n-----~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~  235 (392)
                      .++|+++.||..||+..+     ......++..|+++|..++|.|..+.|+||+|.|...-|.+|.|+++.|||++|+||
T Consensus       160 LDFP~vYASa~~G~A~l~~~~dg~~~~~~~m~PLFd~I~~hvPaP~~~~d~PlQmlvt~ldy~~y~GRI~~GRv~~G~vk  239 (609)
T TIGR01394       160 LDFPIVYASARAGWASLDKDKDGLDDDSEDMAPLFDAILRHVPAPKGDLDEPLQMLVTNLDYDEYLGRIAIGRVHRGTVK  239 (609)
T ss_pred             CCHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCHHHEEEECCCCCCCCEEEEEEEEECEEC
T ss_conf             01256766523672014466577887220178999898640688898887624210001101467766999987505654


Q ss_pred             CCCEEEEEECC-CCCCCEEEECCCCC----CCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCCCCCEEEEEEEEEE
Q ss_conf             89679995068-74321254121001----21144321001366641124543220211773267776300016899971
Q gi|254780263|r  236 AGSDVEIIGMG-GKKLKVKCTDVEMF----RKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYIL  310 (392)
Q Consensus       236 ~Gd~i~i~p~~-~~~~~~kv~si~~~----~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~~~~~~f~A~i~il  310 (392)
                      +||.+.++... ++....||.++..|    |.++++|.|||+||++  |+.  |+..|++||+++.|.+..       .+
T Consensus       240 ~Gq~V~~~~~d~g~~~~~ri~~L~~f~GL~R~~~d~A~AGDIvAva--G~~--~~~IGeTiad~~~~~ALP-------~~  308 (609)
T TIGR01394       240 KGQQVALMKRDDGTIENGRISKLLGFEGLERVEIDEAGAGDIVAVA--GLE--DINIGETIADPEAPEALP-------LI  308 (609)
T ss_pred             CCCEEEEEECCCCEEEEEEEEEEEECCCCEEEECCCCCCCCEEEEE--CCC--CCCCCCEECCCCCCCCCC-------CC
T ss_conf             6864798724696897777645420157110004557987789990--779--887352113333467887-------11


Q ss_pred             ECCCCCCCCCCCCCCEEEEEEC-CEEEEEEEEECCCHHHHCCCCEEEEE
Q ss_conf             0567875555115978999954-14777999961895570789769999
Q gi|254780263|r  311 TASEGGRTTGFMDNYRPQFFMD-TADVTGRIILSPGSQAVMPGDRVDLE  358 (392)
Q Consensus       311 ~~~~~~~~~~~~~~~~~~~~~~-~~~v~~~i~~~~~~~~i~~g~~~~v~  358 (392)
                      ..++|..++.|..|.+|...-+ ..++|+|.+.+.-.+++..|=.-.|+
T Consensus       309 ~vDEPT~sMtF~vN~SPlAG~EVGk~VTSR~i~dRL~rEL~~NvALrVe  357 (609)
T TIGR01394       309 TVDEPTLSMTFSVNDSPLAGKEVGKFVTSRQIRDRLERELETNVALRVE  357 (609)
T ss_pred             CCCCCCEEEEEEECCCCCCCCCCCCEECCCCHHHHHHHHHHCCCEEEEE
T ss_conf             2588812899875288765532573032441578999986317145640


No 23 
>KOG0459 consensus
Probab=100.00  E-value=0  Score=524.86  Aligned_cols=373  Identities=29%  Similarity=0.448  Sum_probs=327.3

Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHH-----------HHHHHHHHCCCC--------CCCCHHHHHCCCEEEEEEEEEECC
Q ss_conf             3882799999046898878999999-----------876444200131--------268686986292063789998219
Q gi|254780263|r    9 NKESLGLSTIGHVDHGKTTLTAAIT-----------KYYSEEKKEYGD--------IDSAPEEKLRGITIATAHVSYETD   69 (392)
Q Consensus         9 ~k~~~ni~~iGhvd~GKSTL~~~L~-----------~~~~~~~~~~~~--------~D~~~~E~~rGiTi~~~~~~~~~~   69 (392)
                      +|+|+|++++||||+||||+.|.|+           .++..++++.++        ||++.+||++|.|+..+.++|+++
T Consensus        76 pk~hvn~vfighVdagkstigg~il~ltg~Vd~Rt~ekyereake~~rEswylsW~ldtn~EeR~kgKtvEvGrA~FEte  155 (501)
T KOG0459          76 PKEHVNAVFIGHVDAGKSTIGGNILFLTGMVDKRTLEKYEREAKEKNRESWYLSWALDTNGEERDKGKTVEVGRAYFETE  155 (501)
T ss_pred             CCCCCEEEEEEEEECCCCCCCCEEEEEEEEECHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHCCCEEEEEEEEEEEC
T ss_conf             77874489999996440126873678986543778999999987613332248999737601210265054125788713


Q ss_pred             CEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC-------CCHHHHHHHHHHCCCCCEEEEECCCC--CCCCH
Q ss_conf             9089998478730246779877400233145201234433-------21067788886318760233100233--35612
Q gi|254780263|r   70 KRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPK-------PQTREHILLARQIGISSIVVYMNKVD--AVDDD  140 (392)
Q Consensus        70 ~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~-------~QT~eh~~l~~~lgi~~iIv~iNKmD--~v~~~  140 (392)
                      +++++|+|+|||+.|++|||.|++|||.++||++|+.|.+       +|||||+++++++|++++||.|||||  .++|.
T Consensus       156 ~~~ftiLDApGHk~fv~nmI~GasqAD~~vLvisar~gefetgFerGgQTREha~Lakt~gv~~lVv~vNKMddPtvnWs  235 (501)
T KOG0459         156 NKRFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWS  235 (501)
T ss_pred             CEEEEEECCCCCCCCCHHHCCCCCHHHHHHHHHHHHHCHHHCCCCCCCCHHHHHHHHHHHCCCEEEEEEEECCCCCCCCC
T ss_conf             43677631676555560003661111233201132001121031036630578999886233257999995058866730


Q ss_pred             -HHHHHCCCCCCEEEEEEEEEE--EEECCCCEEEEEEECCCCC---CCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCC
Q ss_conf             -221101232100111014532--2102331146764114445---6521233203443102522221000011000000
Q gi|254780263|r  141 -ELLDISEYEIRDLLKEHKYSD--DTPIIRGSALCALQGTNKE---LGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEG  214 (392)
Q Consensus       141 -~~~~~i~~~i~~~l~~~~~~~--~~pii~~sa~~g~~~~n~~---~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~  214 (392)
                       +||+++++++..+|+..+|+.  +..++|+|+++|.+..+..   .+||.++.+++.+++ +|.+.|..|+||||||.+
T Consensus       236 ~eRy~E~~~k~~~fLr~~g~n~~~d~~f~p~sg~tG~~~k~~~~s~cpwy~gp~fl~~ld~-l~~~~R~~~GP~~~pI~~  314 (501)
T KOG0459         236 NERYEECKEKLQPFLRKLGFNPKPDKHFVPVSGLTGANVKDRTDSVCPWYKGPIFLEYLDE-LPHLERILNGPIRCPVAN  314 (501)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCHHHCCCCCCCCCCCCCCCEEHHC-CCCCCCCCCCCEEEEHHH
T ss_conf             5668999999999999844468998414202464555553446665884217755500202-676554689877855256


Q ss_pred             CCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECC
Q ss_conf             01355445430148742453489679995068743212541210012114432100136664112454322021177326
Q gi|254780263|r  215 SCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAP  294 (392)
Q Consensus       215 vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~  294 (392)
                      -|+  ..|||+.|+++||+++.||.+.++|.   +..++|.+|+....+++.+.|||++-+.|+|++..||+.|.+||++
T Consensus       315 Kyk--dmGTvv~GKvEsGsi~kg~~lvvMPn---k~~veV~~I~~dd~E~~~~~pGenvk~rlkgieeedi~~GfiL~~~  389 (501)
T KOG0459         315 KYK--DMGTVVGGKVESGSIKKGQQLVVMPN---KTNVEVLGIYSDDVETDRVAPGENVKLRLKGIEEEDISPGFILCSP  389 (501)
T ss_pred             HCC--CCCEEEEEEECCCCEECCCEEEECCC---CCCEEEEEEECCCCEEEECCCCCCEEEEECCCCHHHCCCCEEEECC
T ss_conf             205--56527887860260305984797258---8625789875165201001588515899645335424673487068


Q ss_pred             CCCCC-CEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEE------EEEEE------CCCHHHHCCCCEEEEEEEE
Q ss_conf             77763-00016899971056787555511597899995414777------99996------1895570789769999997
Q gi|254780263|r  295 GSIQE-YSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVT------GRIIL------SPGSQAVMPGDRVDLEVEL  361 (392)
Q Consensus       295 ~~~~~-~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~------~~i~~------~~~~~~i~~g~~~~v~l~l  361 (392)
                      ++|.. ...|.|+|.+|..     ..-+..||+.++|++++--.      |.+.+      ...+++++.++.++++|+.
T Consensus       390 ~n~~~s~~~F~aqi~IlE~-----~sIi~~GY~~VlHIht~ieEv~i~li~~idkktg~ksKkrprFvkq~~~~iarl~t  464 (501)
T KOG0459         390 NNPCKSGRTFDAQIVILEH-----KSIICAGYSCVLHIHTAVEEVEIKLIHLIDKKTGEKSKKRPRFVKQGQKCIARLET  464 (501)
T ss_pred             CCCCCCCCEEEEEEEEEEC-----CCEECCCCCEEEEEEEEHHHEEEEEEEEECCCCCCCCCCCCEEECCCCEEEEEEEC
T ss_conf             9855555488777899714-----73341584137653111100411224420011465445787200078689999703


Q ss_pred             CCCEEECCC------CEEEEEECCEEEEEEEEEEEEC
Q ss_conf             781775469------8499998996999899955319
Q gi|254780263|r  362 IYPIAMEPN------QTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       362 ~~pi~~e~~------~rfilRd~~~tig~G~I~~v~e  392 (392)
                      ..|+|+|++      +||.|||.|+|||+|+|++++|
T Consensus       465 ~~~iCle~fkd~pqmgRFtLRdegkTIAiGkV~k~~~  501 (501)
T KOG0459         465 EGPICLETFKDYPQMGRFTLRDEGKTIAIGKVLKVVE  501 (501)
T ss_pred             CCCEEHHHCCCCHHHCCEEEECCCCEEEEEEEEEECC
T ss_conf             7847301004654436167712893788878986049


No 24 
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=0  Score=464.40  Aligned_cols=335  Identities=29%  Similarity=0.475  Sum_probs=288.6

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789998219908999847873024677987740
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGAT   93 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~   93 (392)
                      .|+++||||||||||+.++++.         .+|+++||++||+|||++|.|+..+++.++|||+|||+||++||+.|++
T Consensus         2 ii~t~GhidHgkT~L~~altg~---------~~d~l~EekKRG~TiDlg~~y~~~~d~~~~fIDvpgh~~~i~~miag~~   72 (447)
T COG3276           2 IIGTAGHIDHGKTTLLKALTGG---------VTDRLPEEKKRGITIDLGFYYRKLEDGVMGFIDVPGHPDFISNLLAGLG   72 (447)
T ss_pred             EEEEEEEEECCCHHHHHHHCCC---------CCCCCHHHHHCCCEEEEEEEECCCCCCCEEEEECCCCHHHHHHHHHHHC
T ss_conf             6997400201430223330255---------3320545661584684205732577773688618984788999985405


Q ss_pred             CCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCEEEEE
Q ss_conf             02331452012344332106778888631876023310023335612221101232100111014532210233114676
Q gi|254780263|r   94 QADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCA  173 (392)
Q Consensus        94 ~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~sa~~g  173 (392)
                      ..|+|+|||++++|+++||.||+.++.++|++++|+++||+|++++.++.+    .+++++..+. ..+.++++.|+.+|
T Consensus        73 ~~d~alLvV~~deGl~~qtgEhL~iLdllgi~~giivltk~D~~d~~r~e~----~i~~Il~~l~-l~~~~i~~~s~~~g  147 (447)
T COG3276          73 GIDYALLVVAADEGLMAQTGEHLLILDLLGIKNGIIVLTKADRVDEARIEQ----KIKQILADLS-LANAKIFKTSAKTG  147 (447)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHH----HHHHHHHHCC-CCCCCCCCCCCCCC
T ss_conf             774589998475576643688999998619873289996223446788999----9999986502-00032301101257


Q ss_pred             EECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEE
Q ss_conf             41144456521233203443102522221000011000000013554454301487424534896799950687432125
Q gi|254780263|r  174 LQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVK  253 (392)
Q Consensus       174 ~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~k  253 (392)
                                .++..|-+.|.+....++++.++|||++||++|+++|+|||++|++.||++++||++++.|.+   ..++
T Consensus       148 ----------~Gi~~Lk~~l~~L~~~~e~d~~~~fri~IDraFtVKGvGTVVtGtv~sG~V~v~D~L~l~p~~---k~v~  214 (447)
T COG3276         148 ----------RGIEELKNELIDLLEEIERDEQKPFRIAIDRAFTVKGVGTVVTGTVLSGEVKVGDKLYLSPIN---KEVR  214 (447)
T ss_pred             ----------CCHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEECCCCEEEEEEEEEEEEEECCEEEEECCC---CEEE
T ss_conf             ----------877999999987520055404786599975579951331799867864358878889990589---7689


Q ss_pred             EECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECC
Q ss_conf             41210012114432100136664112454322021177326777630001689997105678755551159789999541
Q gi|254780263|r  254 CTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDT  333 (392)
Q Consensus       254 v~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~  333 (392)
                      |+|||.|++++++|.||++||++|+|++.+++.|||+|+++++..++++|.+.+.|...    -..++..+...++|.+.
T Consensus       215 VRsIq~~d~d~~~a~AG~RVglaL~~v~~eei~RG~~L~~~~~~~v~~~~~~~~~i~~~----~~~~l~~~~~~hi~~g~  290 (447)
T COG3276         215 VRSIQAHDVDVEEAKAGQRVGLALKGVEKEEIERGDWLLKPEPLEVTTRLIVELEIDPL----FKKTLKQGQPVHIHVGL  290 (447)
T ss_pred             EEEEEECCCCHHHCCCCCEEEEECCCCCHHHHHCCCEECCCCCCCCCEEEEEEEEECCC----CCCCCCCCCEEEEEEEC
T ss_conf             98632068645550122514542378877885112275157777762489999871401----03245789538999813


Q ss_pred             EEEEEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEEEECC--EEEEEEEEEE
Q ss_conf             4777999961895570789769999997781775469849999899--6999899955
Q gi|254780263|r  334 ADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGG--KTVGAGLILE  389 (392)
Q Consensus       334 ~~v~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilRd~~--~tig~G~I~~  389 (392)
                      .+++|++...+..          +++-+..|+..-.+++++||++.  .+.+++.++.
T Consensus       291 ~~~~~~i~~l~~~----------~~l~~~k~i~~~~~~~l~lr~~~a~~~~~g~rvl~  338 (447)
T COG3276         291 RSVTGRIVPLEKN----------AELNLVKPIALGDNDRLVLRDNSAVIKLAGARVLS  338 (447)
T ss_pred             CCCCEEEEECCCC----------CEEEEECCCCCCCCCEEEEECCCCEEEECCCEEEE
T ss_conf             5663576531465----------40455045455657459997266135633645985


No 25 
>COG5258 GTPBP1 GTPase [General function prediction only]
Probab=100.00  E-value=0  Score=459.92  Aligned_cols=363  Identities=29%  Similarity=0.440  Sum_probs=312.7

Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHHHHHHHH--HCCCCCCCCHHHHHCCCEEEEEEEEEEC------------------
Q ss_conf             38827999990468988789999998764442--0013126868698629206378999821------------------
Q gi|254780263|r    9 NKESLGLSTIGHVDHGKTTLTAAITKYYSEEK--KEYGDIDSAPEEKLRGITIATAHVSYET------------------   68 (392)
Q Consensus         9 ~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~--~~~~~~D~~~~E~~rGiTi~~~~~~~~~------------------   68 (392)
                      .++|++++++||||||||||+|.|+....+.+  ..+..+|..+||-+||.|-+++++-|-+                  
T Consensus       114 ~~~hv~Vg~aGhVdhGKSTlvG~LvtG~~DDG~G~tR~~ldv~kHEverGlsa~iS~~v~Gf~dgk~~rlknPld~aE~~  193 (527)
T COG5258         114 APEHVLVGVAGHVDHGKSTLVGVLVTGRLDDGDGATRSYLDVQKHEVERGLSADISLRVYGFDDGKVVRLKNPLDEAEKA  193 (527)
T ss_pred             CCCEEEEEEECCCCCCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCEEEECCCCCHHHHH
T ss_conf             99638999742445786359878984577788840211345416777616532226999972499267605852077776


Q ss_pred             -----CCEEEEEEECCCCHHHHHHHHHHHH--CCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHH
Q ss_conf             -----9908999847873024677987740--023314520123443321067788886318760233100233356122
Q gi|254780263|r   69 -----DKRFYSHIDCPGHADYVKNMITGAT--QADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDE  141 (392)
Q Consensus        69 -----~~~~i~iiD~PGH~~f~~~mi~g~~--~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~  141 (392)
                           .++.+.|+||-||+.|++++++|+-  ..|+.+|+|+|++|++..|+||+.++.++++| +||+++|+|+++++ 
T Consensus       194 ~vv~~aDklVsfVDtvGHEpwLrTtirGL~gqk~dYglLvVaAddG~~~~tkEHLgi~~a~~lP-viVvvTK~D~~~dd-  271 (527)
T COG5258         194 AVVKRADKLVSFVDTVGHEPWLRTTIRGLLGQKVDYGLLVVAADDGVTKMTKEHLGIALAMELP-VIVVVTKIDMVPDD-  271 (527)
T ss_pred             HHHHHCCCEEEEEECCCCCHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCC-EEEEEEECCCCCHH-
T ss_conf             7665203089998537862789988888732666627999981677303306765656461697-79999952568278-


Q ss_pred             HHHHCCCCCCEEEEEEE--------------------EEE-EEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCC
Q ss_conf             21101232100111014--------------------532-210233114676411444565212332034431025222
Q gi|254780263|r  142 LLDISEYEIRDLLKEHK--------------------YSD-DTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTP  200 (392)
Q Consensus       142 ~~~~i~~~i~~~l~~~~--------------------~~~-~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p  200 (392)
                      ++..+.+++..+|+..+                    .+. -+|++.+|+++|           .+-.+|+.+-..+|.-
T Consensus       272 r~~~v~~ei~~~Lk~v~Rip~~vk~~~d~v~aa~a~k~~~~vvPi~~tSsVTg-----------~GldlL~e~f~~Lp~r  340 (527)
T COG5258         272 RFQGVVEEISALLKRVGRIPLIVKDTDDVVLAAKAMKAGRGVVPIFYTSSVTG-----------EGLDLLDEFFLLLPKR  340 (527)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHCCCCEEEEEEEECCCC-----------CCHHHHHHHHHHCCCC
T ss_conf             89999999999999743465355055326776543323782577999822457-----------5389999999749850


Q ss_pred             CC-CCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEEC-CCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             21-0000110000000135544543014874245348967999506-874321254121001211443210013666411
Q gi|254780263|r  201 QR-SLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGM-GGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLR  278 (392)
Q Consensus       201 ~~-~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~-~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lk  278 (392)
                      .+ +..+||+|+|+++|++.|+|+|+.|.|.||.++.||++++.|. .+++..++|+||++|+..+++|.||++++++|+
T Consensus       341 r~~~d~g~flmYId~iYsVtGVGtVvsGsV~~G~l~~gd~vllGP~~~G~fr~v~vkSIemh~~rvdsa~aG~iig~Al~  420 (527)
T COG5258         341 RRWDDEGPFLMYIDKIYSVTGVGTVVSGSVKSGILHVGDTVLLGPFKDGKFREVVVKSIEMHHYRVDSAKAGSIIGIALK  420 (527)
T ss_pred             CCCCCCCCEEEEEEEEEEEEEEEEEEEEEEEEEEECCCCEEEECCCCCCCEEEEEEEEEEEEEEEECCCCCCCEEEEEEC
T ss_conf             02477897289987567774257898613776166059879974578995799999999976677032357758999962


Q ss_pred             CCCCCEEECHHEEECCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEEE
Q ss_conf             24543220211773267776300016899971056787555511597899995414777999961895570789769999
Q gi|254780263|r  279 GVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLE  358 (392)
Q Consensus       279 gi~~~di~rGdvl~~~~~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~  358 (392)
                      |+..+.+.||+||+.+..|.+++.|+|++.+|.     ||+.++.||.+.+|..+...+.++... ...++++||.+.++
T Consensus       421 gv~~e~lerGMVl~~~~~pkaVref~AeV~vl~-----HPT~I~aGye~v~H~etI~e~~~f~~i-d~~~L~~GD~g~vr  494 (527)
T COG5258         421 GVEKEELERGMVLSAGADPKAVREFDAEVLVLR-----HPTTIRAGYEPVFHYETIREAVYFEEI-DKGFLMPGDRGVVR  494 (527)
T ss_pred             CCCHHHHHCCEEECCCCCCHHHHEECCEEEEEE-----CCCEEECCCEEEEEEEEEEHEEEEEEC-CCCCCCCCCCCEEE
T ss_conf             668778734517527999604440112299994-----785775372356675470000589872-54544578864499


Q ss_pred             EEEC-CCEEECCCCEEEEEECCEEEEEEEEEEEE
Q ss_conf             9977-81775469849999899699989995531
Q gi|254780263|r  359 VELI-YPIAMEPNQTFSMREGGKTVGAGLILEII  391 (392)
Q Consensus       359 l~l~-~pi~~e~~~rfilRd~~~tig~G~I~~v~  391 (392)
                      ++|. +|-.++.+|+|++|+ |+|-|.|.|+++.
T Consensus       495 ~~fkyrP~~v~eGQ~fvFRe-GrskgvG~v~~~~  527 (527)
T COG5258         495 MRFKYRPHHVEEGQKFVFRE-GRSKGVGRVIRVD  527 (527)
T ss_pred             EEEEECCHHHCCCCEEEEEC-CCCCCCEEEECCC
T ss_conf             99971711120583899942-7776534774159


No 26 
>PRK10218 GTP-binding protein; Provisional
Probab=100.00  E-value=0  Score=456.13  Aligned_cols=282  Identities=32%  Similarity=0.413  Sum_probs=241.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHH----HHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             99999046898878999999876444----20013126868698629206378999821990899984787302467798
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEE----KKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~----~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      ||+||+|||||||||+++|+...+.-    ......||++++||||||||.++...++|++++|||||||||.||..++.
T Consensus         7 NiaIIAHvDhGKTTL~d~lL~~tG~~~~~~~~~~~~mD~~~~ErERGITI~a~~~~~~~~~~~iNiIDTPGH~DF~gEVe   86 (607)
T PRK10218          7 NIAIIAHVDHGKTTLVDKLLQQSGTFDSRAETQERVMDSNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVE   86 (607)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCHHHCCCCCHHHHHCCCEEEEEEEEEEECCEEEEEECCCCCCCCHHHHH
T ss_conf             48999756889889999999972898644541120147868898759726230489960878997865998543014889


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEE---EEEECC
Q ss_conf             77400233145201234433210677888863187602331002333561222110123210011101453---221023
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYS---DDTPII  166 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~---~~~pii  166 (392)
                      |+++++|+|+|||||.+|++|||+.++..|..+|+|. |++|||||+.+.  +++.+..++.+++...+..   .++|++
T Consensus        87 R~L~~~DGalLvVDA~eGv~pQT~~V~~~Al~~~l~~-IvvINKiDr~~A--~~~~V~~ei~dlfi~L~a~deqld~Pi~  163 (607)
T PRK10218         87 RVMSMVDSVLLVVDAFDGPMPQTRFVTKKAFAYGLKP-IVVINKVDRPGA--RPDWVVDQVFDLFVNLDATDEQLDFPIV  163 (607)
T ss_pred             HHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCE-EEEECCCCCCCC--CHHHHHHHHHHHHHCCCCCHHHHCCHHH
T ss_conf             7897668489999788786245899999999879975-997216676655--3578999999887404985677444355


Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECC
Q ss_conf             31146764114445652123320344310252222100001100000001355445430148742453489679995068
Q gi|254780263|r  167 RGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMG  246 (392)
Q Consensus       167 ~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~  246 (392)
                      ..|+.+||.+.+......++..|+++|.+++|.|..+.++||++.|.++++.+++|++.+|||.+|++++||++.++..+
T Consensus       164 ~asa~~G~a~~~~~~~~~dl~pLldaIv~~IPaP~~d~d~Plq~lV~~ldyD~YvGrI~igRV~sG~ik~Gd~V~~~~~~  243 (607)
T PRK10218        164 YASALNGIAGLDHEDMAEDMTPLYQAIVDHVPAPDVDLDGPFQMQISQLDYNSYVGVIGIGRIKRGKVKPNQQVTIIDSE  243 (607)
T ss_pred             HHHHHCCEECCCHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCCCEEEEEEEECCEECCCCEEEEECCC
T ss_conf             65540650126823433313608899985487989998888410101123567676489999965748589843663279


Q ss_pred             CCCCCEEEECCCCC----CCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCCCCCEE
Q ss_conf             74321254121001----211443210013666411245432202117732677763000
Q gi|254780263|r  247 GKKLKVKCTDVEMF----RKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSR  302 (392)
Q Consensus       247 ~~~~~~kv~si~~~----~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~~~~~~  302 (392)
                      ++....+|..++.+    +.++++|.|||+|++  +|+  .++..||+||+++.|.+...
T Consensus       244 g~~~~~kV~kl~~~~gl~r~ev~~a~AGDIVAI--aGl--~d~~iGDTl~d~~~p~~Lp~  299 (607)
T PRK10218        244 GKTRNAKVGKVLGHLGLERIETDLAEAGDIVAI--TGL--GELNISDTVCDTQNVEALPA  299 (607)
T ss_pred             CEEEEEEEEEEEECCCCCCCCCCEECCEEEEEE--ECC--CCCCCCCEECCCCCCCCCCC
T ss_conf             638843467995115777400546524059999--423--35777765215776556766


No 27 
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]
Probab=100.00  E-value=0  Score=437.27  Aligned_cols=316  Identities=31%  Similarity=0.398  Sum_probs=271.7

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHH----HHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHH
Q ss_conf             79999904689887899999987644----42001312686869862920637899982199089998478730246779
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSE----EKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNM   88 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~----~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~m   88 (392)
                      -|||||+|||||||||++.|++..+.    +......||+.+.||||||||-++.+...|++++|||+|||||+||.+++
T Consensus         6 RNIAIIAHVDHGKTTLVD~LLkQSGtf~~~e~v~ERvMDSnDlEkERGITILaKnTav~~~~~~INIvDTPGHADFGGEV   85 (603)
T COG1217           6 RNIAIIAHVDHGKTTLVDALLKQSGTFREREEVAERVMDSNDLEKERGITILAKNTAVNYNGTRINIVDTPGHADFGGEV   85 (603)
T ss_pred             CEEEEEEEECCCCCHHHHHHHHHCCCCCCCCCHHHHHCCCCCHHHHCCCEEEECCCEEECCCEEEEEECCCCCCCCCCHH
T ss_conf             30689998448810289999873165445652014403764234434938985152462088389876589867766254


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE---EEEEEC
Q ss_conf             87740023314520123443321067788886318760233100233356122211012321001110145---322102
Q gi|254780263|r   89 ITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY---SDDTPI  165 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~---~~~~pi  165 (392)
                      .|.++.+|+++|+|||.+|+|||||..+..|..+|+++| |+|||+|+.+  .+.+++..++.+++..++.   +.++|+
T Consensus        86 ERvl~MVDgvlLlVDA~EGpMPQTrFVlkKAl~~gL~PI-VVvNKiDrp~--Arp~~Vvd~vfDLf~~L~A~deQLdFPi  162 (603)
T COG1217          86 ERVLSMVDGVLLLVDASEGPMPQTRFVLKKALALGLKPI-VVINKIDRPD--ARPDEVVDEVFDLFVELGATDEQLDFPI  162 (603)
T ss_pred             HHHHHHCCEEEEEEECCCCCCCCHHHHHHHHHHCCCCCE-EEEECCCCCC--CCHHHHHHHHHHHHHHHCCCHHHCCCEE
T ss_conf             511432334899997555888731444899997499848-9996778999--8878999999999998199745578707


Q ss_pred             CCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEEC
Q ss_conf             33114676411444565212332034431025222210000110000000135544543014874245348967999506
Q gi|254780263|r  166 IRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGM  245 (392)
Q Consensus       166 i~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~  245 (392)
                      ++.|+..|+...+.......+..|+++|.+++|.|..+.++||+|.|...-+.+++|++..|||.+|++++|+.+.+...
T Consensus       163 vYAS~~~G~a~~~~~~~~~~m~pLfe~I~~hvp~P~~~~d~PlQ~qvt~Ldyn~y~GrIgigRi~~G~vk~~q~V~~i~~  242 (603)
T COG1217         163 VYASARNGTASLDPEDEADDMAPLFETILDHVPAPKGDLDEPLQMQVTQLDYNSYVGRIGIGRIFRGTVKPNQQVALIKS  242 (603)
T ss_pred             EEEECCCCEECCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEEEEEEECCCCCCCEEEEEEEECCCCCCCCEEEEECC
T ss_conf             98541475101586555553168999999758999899988807899852244545226899985272548976899847


Q ss_pred             CCCCCCEEEECCCCC----CCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCCCCCEEEEEEEEEEECCCCCCCCCC
Q ss_conf             874321254121001----2114432100136664112454322021177326777630001689997105678755551
Q gi|254780263|r  246 GGKKLKVKCTDVEMF----RKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGF  321 (392)
Q Consensus       246 ~~~~~~~kv~si~~~----~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~~~~~~f~A~i~il~~~~~~~~~~~  321 (392)
                      .++....+|..+..|    |.++++|.|||+|+++  |+  .++..||++|+++.+.+..       .+..++|..++.|
T Consensus       243 ~g~~~~gri~kll~f~GL~R~ei~eA~AGDIvaia--G~--~~~~igdTi~d~~~~~aLp-------~l~iDePTlsMtf  311 (603)
T COG1217         243 DGTTENGRITKLLGFLGLERIEIEEAEAGDIVAIA--GL--EDINIGDTICDPDNPEALP-------ALSVDEPTLSMTF  311 (603)
T ss_pred             CCCEEEEEEEEEEECCCEEEEEHHHCCCCCEEEEC--CC--CCCCCCCCCCCCCCCCCCC-------CCCCCCCCEEEEE
T ss_conf             99477557766655054233350012556789982--76--4355434135877766788-------7336898468999


Q ss_pred             CCCCEEEEEECCEEEEEEEEE
Q ss_conf             159789999541477799996
Q gi|254780263|r  322 MDNYRPQFFMDTADVTGRIIL  342 (392)
Q Consensus       322 ~~~~~~~~~~~~~~v~~~i~~  342 (392)
                      ..|.+|........+++|.+.
T Consensus       312 ~vN~SPfAG~EGk~vTSR~i~  332 (603)
T COG1217         312 SVNDSPFAGKEGKFVTSRQIR  332 (603)
T ss_pred             EECCCCCCCCCCCEEEHHHHH
T ss_conf             956887777678565589999


No 28 
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=0  Score=416.30  Aligned_cols=350  Identities=31%  Similarity=0.475  Sum_probs=294.7

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEE---C---------------C--
Q ss_conf             8827999990468988789999998764442001312686869862920637899982---1---------------9--
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYE---T---------------D--   69 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~---~---------------~--   69 (392)
                      +|.+||+++||||||||||+.+|++.         ++|++.+|.+|||||.++|+...   +               +  
T Consensus         8 Qp~vNIG~vGHVdHGKtTlv~AlsGv---------wT~~hseElkRgitIkLGYAd~~i~kC~~c~~~~~y~~~~~C~~c   78 (415)
T COG5257           8 QPEVNIGMVGHVDHGKTTLTKALSGV---------WTDRHSEELKRGITIKLGYADAKIYKCPECYRPECYTTEPKCPNC   78 (415)
T ss_pred             CCCEEEEEEEECCCCHHHHEEHHHCE---------EEECHHHHHHCCCEEEECCCCCCEEECCCCCCCCCCCCCCCCCCC
T ss_conf             86147623420146624110033133---------430206887568479840255745757777887662347877778


Q ss_pred             ------CEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCC-CCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHH
Q ss_conf             ------9089998478730246779877400233145201234-433210677888863187602331002333561222
Q gi|254780263|r   70 ------KRFYSHIDCPGHADYVKNMITGATQADGAILVCAAED-GPKPQTREHILLARQIGISSIVVYMNKVDAVDDDEL  142 (392)
Q Consensus        70 ------~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~-G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~  142 (392)
                            -|+++|+|+|||+-.+.+|+.|++.+|+|||||+|++ .++|||+||+..+..+|++++|++.||+|+|+.++.
T Consensus        79 g~~~~l~R~VSfVDaPGHe~LMATMLsGAAlMDgAlLvIaANEpcPQPQT~EHl~AleIigik~iiIvQNKIDlV~~E~A  158 (415)
T COG5257          79 GAETELVRRVSFVDAPGHETLMATMLSGAALMDGALLVIAANEPCPQPQTREHLMALEIIGIKNIIIVQNKIDLVSRERA  158 (415)
T ss_pred             CCCCCEEEEEEEEECCCHHHHHHHHHCCHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEECCCCEECHHHH
T ss_conf             99730799999740796699999886023442153899953898989731877887766265339999523011159998


Q ss_pred             HHHCCCCCCEEEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCC--C
Q ss_conf             11012321001110145322102331146764114445652123320344310252222100001100000001355--4
Q gi|254780263|r  143 LDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIE--G  220 (392)
Q Consensus       143 ~~~i~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~--g  220 (392)
                      .|.. +++++|++-. +.++.|+||+||...          ++++.|+++|.+++|.|.++.++|.+|.|.++|.+.  |
T Consensus       159 lE~y-~qIk~FvkGt-~Ae~aPIIPiSA~~~----------~NIDal~e~i~~~IptP~rd~~~~p~m~v~RSFDVNkPG  226 (415)
T COG5257         159 LENY-EQIKEFVKGT-VAENAPIIPISAQHK----------ANIDALIEAIEKYIPTPERDLDKPPRMYVARSFDVNKPG  226 (415)
T ss_pred             HHHH-HHHHHHHCCC-CCCCCCEEEEHHHHC----------CCHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCCCCCC
T ss_conf             8879-9999986263-347995443256430----------587999999998689986678999669998640358998


Q ss_pred             ------CCCCEEEEEEECCCCCCCEEEEEECC---------CCCCCEEEECCCCCCCCCCCCCCCHHHHHHHC---CCCC
Q ss_conf             ------45430148742453489679995068---------74321254121001211443210013666411---2454
Q gi|254780263|r  221 ------RGTVVTGCIKRGRIKAGSDVEIIGMG---------GKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLR---GVNR  282 (392)
Q Consensus       221 ------~G~Vv~GrV~sG~l~~Gd~i~i~p~~---------~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lk---gi~~  282 (392)
                            .|-|+.|.+.+|.+++||++.+.|.-         -.+..++|.||+.....+++|.||..+|+..+   .+.+
T Consensus       227 t~~~~L~GGViGGsl~~G~l~vGDEIEIrPGi~v~k~~k~~~~pi~T~i~Sl~ag~~~~~ea~PGGLvgvGT~lDP~ltK  306 (415)
T COG5257         227 TPPEELKGGVIGGSLVQGVLRVGDEIEIRPGIVVEKGGKTVWEPITTEIVSLQAGGEDVEEARPGGLVGVGTKLDPTLTK  306 (415)
T ss_pred             CCHHHCCCCEECCEEEEEEEECCCEEEECCCEEEECCCCEEEEEEEEEEEEEEECCEEEEECCCCCEEEEECCCCCCHHH
T ss_conf             99777247432220255368538757854881760399247787138999997377664312688368773344842100


Q ss_pred             CEEECHHEEECCCCCCCC-EEEEEEEEEEECCC----CCCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEE
Q ss_conf             322021177326777630-00168999710567----8755551159789999541477799996189557078976999
Q gi|254780263|r  283 ADVPRGRVVCAPGSIQEY-SRFRASVYILTASE----GGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDL  357 (392)
Q Consensus       283 ~di~rGdvl~~~~~~~~~-~~f~A~i~il~~~~----~~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v  357 (392)
                      .|--.|.|+..++.++++ ++|+.+..+|..-.    .....+++.|-..++.+|++.+.+.+..-...         .+
T Consensus       307 aD~L~G~V~G~pG~lPpv~~~~~ie~~LL~RvvG~~~e~kvepik~~E~Lml~VGtatT~GvV~~~k~d---------~~  377 (415)
T COG5257         307 ADALVGQVVGKPGTLPPVWTSIRIEYHLLERVVGTKEELKVEPIKTNEVLMLNVGTATTVGVVTSAKKD---------EI  377 (415)
T ss_pred             HHHHCCCCCCCCCCCCCCEEEEEEEEEEHHHHHCCCCCCCCCCCCCCCEEEEEEECCEEEEEEEEECCC---------EE
T ss_conf             123201202589889982478999742046664753201345456798699996233167899974075---------27


Q ss_pred             EEEECCCEEECCCCEEEE-E-E--CCEEEEEEEEEE
Q ss_conf             999778177546984999-9-8--996999899955
Q gi|254780263|r  358 EVELIYPIAMEPNQTFSM-R-E--GGKTVGAGLILE  389 (392)
Q Consensus       358 ~l~l~~pi~~e~~~rfil-R-d--~~~tig~G~I~~  389 (392)
                      ++.|.+|+|.+.++|.++ | -  .+|.||+|.|.+
T Consensus       378 ev~Lk~Pvcae~g~rvaisRri~~rWRLIG~G~ik~  413 (415)
T COG5257         378 EVKLKRPVCAEIGERVAISRRIGNRWRLIGYGTIKE  413 (415)
T ss_pred             EEEECCCEECCCCCEEEEEEEECCEEEEEEEEEEEC
T ss_conf             999635311377877987751015379975789833


No 29 
>TIGR01393 lepA GTP-binding protein LepA; InterPro: IPR006297   LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function of the proteins in this family are unknown. ; GO: 0005525 GTP binding.
Probab=100.00  E-value=0  Score=412.02  Aligned_cols=265  Identities=27%  Similarity=0.389  Sum_probs=221.9

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHH---HHHCCCCCCCCHHHHHCCCEEEEEEEEE------ECCCEEEEEEECCCCHHH
Q ss_conf             9999904689887899999987644---4200131268686986292063789998------219908999847873024
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSE---EKKEYGDIDSAPEEKLRGITIATAHVSY------ETDKRFYSHIDCPGHADY   84 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~---~~~~~~~~D~~~~E~~rGiTi~~~~~~~------~~~~~~i~iiD~PGH~~f   84 (392)
                      ||.||+|+|||||||.+||++..+.   +....-.||+|+.||||||||.+-...+      +.+.|.+||||||||+||
T Consensus         5 NFsIIAHIDHGKSTLADRlle~T~~~s~R~m~~Q~LD~MDlERERGITIK~qaV~l~Yk~~~DGe~Y~LNLIDTPGHVDF   84 (598)
T TIGR01393         5 NFSIIAHIDHGKSTLADRLLEKTGAVSEREMREQVLDSMDLERERGITIKAQAVRLKYKVAKDGETYVLNLIDTPGHVDF   84 (598)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHCCCCCCHHHHHCCCCCCCEEECCCCEEECCCEEEEEEEECCCCEEEEEEECCCCCCCC
T ss_conf             26788462489324889999861745620254305775100000582011563475337533887889964528897212


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             67798774002331452012344332106778888631876023310023335612221101232100111014532210
Q gi|254780263|r   85 VKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        85 ~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                      .-++-|+++.|.+|||||||+.|++.||-=++++|-...+. ||-+|||+||.+.|  .|.++.|+++++.   .. ...
T Consensus        85 sYEVSRSLAACEGALL~VDA~QGvEAQT~aN~YlAlE~dLe-IIPViNKIDLP~Ad--pe~v~~eIe~~iG---ld-~~~  157 (598)
T TIGR01393        85 SYEVSRSLAACEGALLLVDAAQGVEAQTLANVYLALENDLE-IIPVINKIDLPSAD--PERVKKEIEEVIG---LD-ASE  157 (598)
T ss_pred             CHHHHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHCCCE-EEEEECCCCCCCCC--HHHHHHHHHHHCC---CC-CCC
T ss_conf             73788888871640356141032358889999887561875-84778253688888--5899998765418---89-643


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCC-CCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEE
Q ss_conf             23311467641144456521233203443102522221000-01100000001355445430148742453489679995
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLD-APFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEII  243 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~-~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~  243 (392)
                      .|.+||.+|.          +++.+||+|.+.+|+|.-+.+ +||+..|+|+|+++|+|.|+.-||..|++++||+|.++
T Consensus       158 ai~~SAKtG~----------Gi~e~LEaIv~~vPpP~Gd~~DapLkALIFDS~YD~YrGVv~~vRv~~G~ik~gD~I~~M  227 (598)
T TIGR01393       158 AILASAKTGI----------GIEEILEAIVKRVPPPKGDPDDAPLKALIFDSHYDNYRGVVVLVRVFEGTIKKGDKIRFM  227 (598)
T ss_pred             CEEEEECCCC----------CHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEEECEECCCCEEEEE
T ss_conf             0387503678----------889998897101810011388866322788435438650899999952686469889995


Q ss_pred             ECCCCCCCEEEECCCCC-C-CCCCCCCCCHHHHHHHCCC-CCCEEECHHEEECCCCC
Q ss_conf             06874321254121001-2-1144321001366641124-54322021177326777
Q gi|254780263|r  244 GMGGKKLKVKCTDVEMF-R-KKLDEAIAGDNVGLLLRGV-NRADVPRGRVVCAPGSI  297 (392)
Q Consensus       244 p~~~~~~~~kv~si~~~-~-~~v~~a~aGd~v~l~Lkgi-~~~di~rGdvl~~~~~~  297 (392)
                      ..+.++...+|. +... - ...++..||| ||.-..|+ +..|++.||||+..++|
T Consensus       228 stgk~y~V~evG-~~~P~~~~~~~~L~aGe-VGy~~AgIK~v~D~~VGDTiT~~~~P  282 (598)
T TIGR01393       228 STGKEYEVDEVG-VFTPKLEVKTQELSAGE-VGYIIAGIKDVSDVKVGDTITSVKNP  282 (598)
T ss_pred             ECCCEEEEEEEE-EECCCCCCCCCCEECCC-EEEEEEEEEECCCEECCCEEECCCCC
T ss_conf             348766675500-34345201466200163-05999865310411205445256787


No 30 
>cd01884 EF_Tu EF-Tu subfamily.  This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts.  It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors.  The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family.  EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function.  When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors.  Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=100.00  E-value=0  Score=398.43  Aligned_cols=190  Identities=61%  Similarity=0.965  Sum_probs=173.9

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHH----CCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHH
Q ss_conf             8279999904689887899999987644420----013126868698629206378999821990899984787302467
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEEKK----EYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVK   86 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~----~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~   86 (392)
                      ||+||+++||||||||||+++|++.......    ....+|++++||+|||||++++..|+|++++++|||||||+||++
T Consensus         1 p~~Ni~iiGHVDhGKTTL~~~l~~~~~~~~~~~~~~~~~~D~~~~EreRGiTI~~~~~~~~~~~~~~~~IDtPGH~dF~~   80 (195)
T cd01884           1 PHVNVGTIGHVDHGKTTLTAAITKVLAKKGGAKFKKYDEIDKAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYIK   80 (195)
T ss_pred             CCEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCCCCHHCCCCHHHHCCCCCCCCEEEEEECCCEEEEECCCCCHHHHHH
T ss_conf             93799999605886989999999988663444411200100546665058861441899960881699626896077888


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE-EEEC
Q ss_conf             798774002331452012344332106778888631876023310023335612221101232100111014532-2102
Q gi|254780263|r   87 NMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD-DTPI  165 (392)
Q Consensus        87 ~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~-~~pi  165 (392)
                      ||++|++++|+|||||||.+|+++||+||+.+++.+|+|++||||||||+++++++++.++.++.++|.+.++.. ++|+
T Consensus        81 ~~i~g~~~~D~aiLVVdA~eGv~~QT~eh~~la~~lgi~~iiV~iNK~D~~~~~~~~~~v~~ei~~~l~~~g~~~~~~p~  160 (195)
T cd01884          81 NMITGAAQMDGAILVVSATDGPMPQTREHLLLARQVGVPYIVVFLNKADMVDDEELLELVEMEVRELLSKYGFDGDNTPI  160 (195)
T ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEE
T ss_conf             99863511362689985277874789999999998099962799968778987899999999999999842999556829


Q ss_pred             CCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCC
Q ss_conf             33114676411444565212332034431025222
Q gi|254780263|r  166 IRGSALCALQGTNKELGEDSIHALMKAVDTHIPTP  200 (392)
Q Consensus       166 i~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p  200 (392)
                      ||+||++|+++.+......++.+|+|+|++++|+|
T Consensus       161 ip~Sa~~g~~~~~~~~~~~~i~~Lldai~~~iP~P  195 (195)
T cd01884         161 VRGSALKALEGDDPNKWVKKILELLDALDSYIPTP  195 (195)
T ss_pred             EEEEHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCC
T ss_conf             99773875357888755369999999999648998


No 31 
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily.  EF1 is responsible for the GTP-dependent binding of aminoacyl-tRNAs to the ribosomes.  EF1 is composed of four subunits: the alpha chain which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains.  This subfamily is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF1-alpha) and eukaryotes (eEF1-alpha).  eEF1-alpha interacts with the actin of the eukaryotic cytoskeleton and may thereby play a role in cellular transformation and apoptosis.  EF-Tu can have no such role in bacteria.  In humans, the isoform eEF1A2 is overexpressed in 2/3 of breast cancers and has been identified as a putative oncogene.  This subfamily also includes Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation in
Probab=100.00  E-value=0  Score=388.67  Aligned_cols=186  Identities=40%  Similarity=0.578  Sum_probs=161.1

Q ss_pred             EEEEEECCCCCHHHHHHHHHHH-----------HHHHHHCCC--------CCCCCHHHHHCCCEEEEEEEEEECCCEEEE
Q ss_conf             9999904689887899999987-----------644420013--------126868698629206378999821990899
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKY-----------YSEEKKEYG--------DIDSAPEEKLRGITIATAHVSYETDKRFYS   74 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~-----------~~~~~~~~~--------~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~   74 (392)
                      ||+++||||||||||+|+|+..           +.+.+.+.+        .||++++||+||+||++++.+|+|++++||
T Consensus         1 Ni~iiGHvD~GKSTL~g~lL~~~g~i~~~~~~k~~~~~~~~gk~s~~~a~~lD~~~~ErerGiTI~~~~~~f~~~~~~~~   80 (219)
T cd01883           1 NLVVIGHVDAGKSTTTGHLLYLLGGVDKRTIEKYEKEAKEMGKGSFKYAWVLDTLKEERERGVTIDVGLAKFETEKYRFT   80 (219)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHCCCCEEEEEEEEEECCEEEE
T ss_conf             98999668998999999999985997688999999999854998750556613898798589258858999984993699


Q ss_pred             EEECCCCHHHHHHHHHHHHCCCCEEEEECCCCC-------CCCCHHHHHHHHHHCCCCCEEEEECCCCCC--CCH-HHHH
Q ss_conf             984787302467798774002331452012344-------332106778888631876023310023335--612-2211
Q gi|254780263|r   75 HIDCPGHADYVKNMITGATQADGAILVCAAEDG-------PKPQTREHILLARQIGISSIVVYMNKVDAV--DDD-ELLD  144 (392)
Q Consensus        75 iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G-------~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v--~~~-~~~~  144 (392)
                      |||||||+||++||++|++++|+|||||||.+|       +++||+||+.+++.+||+++||||||||++  +|+ ++|+
T Consensus        81 iiDtPGH~df~~~mi~g~~~ad~ailvvda~~g~~e~g~~~~~QTreH~~l~~~lGik~iIVavNKMD~v~~~y~~~rf~  160 (219)
T cd01883          81 ILDAPGHRDFVPNMITGASQADVAVLVVDARKGEFEAGFEKGGQTREHALLARTLGVKQLIVAVNKMDDVTVNWSEERYD  160 (219)
T ss_pred             EEECCCCHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHH
T ss_conf             98789726678899987753166899998576751036677765999999999849974899998753688652599999


Q ss_pred             HCCCCCCEEEEEEEEEE-EEECCCCEEEEEEECC--CCCCCCCCCCCHHHHHHCCCCCC
Q ss_conf             01232100111014532-2102331146764114--44565212332034431025222
Q gi|254780263|r  145 ISEYEIRDLLKEHKYSD-DTPIIRGSALCALQGT--NKELGEDSIHALMKAVDTHIPTP  200 (392)
Q Consensus       145 ~i~~~i~~~l~~~~~~~-~~pii~~sa~~g~~~~--n~~~~~~~~~~Ll~~i~~~~~~p  200 (392)
                      +++.++.+++++.++.. ++++||+||+.|.|..  ...++||++++|+++|++. ++|
T Consensus       161 ~i~~~~~~~l~~~g~~~~~~~~IPiSa~~GdNi~~~s~~m~WY~GptLl~~Ld~~-~~p  218 (219)
T cd01883         161 EIKKELSPFLKKVGYNPKDVPFIPISGLTGDNLIEKSENMPWYKGPTLLEALDSL-EPP  218 (219)
T ss_pred             HHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHCC-CCC
T ss_conf             9999999999982999566159993367663046678899898781699998478-998


No 32 
>cd04166 CysN_ATPS CysN_ATPS subfamily.  CysN, together with protein CysD, form the ATP sulfurylase (ATPS) complex in some bacteria and lower eukaryotes.  ATPS catalyzes the production of ATP sulfurylase (APS) and pyrophosphate (PPi) from ATP and sulfate.  CysD, which catalyzes ATP hydrolysis, is a member of the ATP pyrophosphatase (ATP PPase) family.  CysN hydrolysis of GTP is required for CysD hydrolysis of ATP; however, CysN hydrolysis of GTP is not dependent on CysD hydrolysis of ATP.  CysN is an example of lateral gene transfer followed by acquisition of new function.  In many organisms, an ATPS exists which is not GTP-dependent and shares no sequence or structural similarity to CysN.
Probab=100.00  E-value=0  Score=388.88  Aligned_cols=185  Identities=32%  Similarity=0.395  Sum_probs=159.7

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHH-----------HHHHCCC--------CCCCCHHHHHCCCEEEEEEEEEECCCEEEE
Q ss_conf             999990468988789999998764-----------4420013--------126868698629206378999821990899
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYS-----------EEKKEYG--------DIDSAPEEKLRGITIATAHVSYETDKRFYS   74 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~-----------~~~~~~~--------~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~   74 (392)
                      +|+++||||||||||+|+|+...+           +.....+        -||++++||+||+||++++.+|++++++|+
T Consensus         1 ~~vv~GHVD~GKSTL~g~LL~~~g~i~~~~~~~~~~~~~~~~~~~~~~a~~lD~~~~ErerGiTId~~~~~f~~~~~~~~   80 (208)
T cd04166           1 RFLTCGSVDDGKSTLIGRLLYDSKSIFEDQLAALESKSCGTGGEPLDLALLVDGLQAEREQGITIDVAYRYFSTPKRKFI   80 (208)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCHHHHHHCCCCHHHHHCCCCEEEEEEEEEECCCEEE
T ss_conf             96999748898889999999982996789999999887541676300034346868788269794105899981992699


Q ss_pred             EEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH-HHHHHCCCCCCEE
Q ss_conf             984787302467798774002331452012344332106778888631876023310023335612-2211012321001
Q gi|254780263|r   75 HIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDD-ELLDISEYEIRDL  153 (392)
Q Consensus        75 iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~-~~~~~i~~~i~~~  153 (392)
                      |||||||+||++||++|+++||+|+|||||.+|+++||+||+.+++.+|++++||||||||+++|+ ++|++++.++.++
T Consensus        81 iiDtPGH~dfi~nmi~gas~aD~ailVVda~~G~~~QT~eh~~~~~~lgi~~iIv~vNKmD~v~~~e~~f~~i~~~~~~~  160 (208)
T cd04166          81 IADTPGHEQYTRNMVTGASTADLAILLVDARKGVLEQTRRHSYILSLLGIRHVVVAVNKMDLVDYSEEVFEEIVADYLAF  160 (208)
T ss_pred             EEECCCCHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHH
T ss_conf             98789628899999999863774799997588872789999999997499839999988576899989999999999999


Q ss_pred             EEEEEEEEEEECCCCEEEEEEECCC--CCCCCCCCCCHHHHHHCCCCCC
Q ss_conf             1101453221023311467641144--4565212332034431025222
Q gi|254780263|r  154 LKEHKYSDDTPIIRGSALCALQGTN--KELGEDSIHALMKAVDTHIPTP  200 (392)
Q Consensus       154 l~~~~~~~~~pii~~sa~~g~~~~n--~~~~~~~~~~Ll~~i~~~~~~p  200 (392)
                      +++.++. ++++||+||++|.|..+  ..++||++++|+++|++ +|.|
T Consensus       161 l~~~~~~-~~~~IPiSa~~GdNi~~~s~~~~WY~G~tLle~Ld~-~~~~  207 (208)
T cd04166         161 AAKLGIE-DITFIPISALDGDNVVSRSENMPWYSGPTLLEHLET-VPIA  207 (208)
T ss_pred             HHHCCCC-CCEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHC-CCCC
T ss_conf             9974998-871998126778887869999989888349999847-7789


No 33 
>PRK05433 GTP-binding protein LepA; Provisional
Probab=100.00  E-value=0  Score=389.24  Aligned_cols=273  Identities=26%  Similarity=0.378  Sum_probs=223.3

Q ss_pred             CCHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHH---HHCCCCCCCCHHHHHCCCEEEEEEEEEECC-----CEE
Q ss_conf             961242103882799999046898878999999876444---200131268686986292063789998219-----908
Q gi|254780263|r    1 MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEE---KKEYGDIDSAPEEKLRGITIATAHVSYETD-----KRF   72 (392)
Q Consensus         1 m~~~~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~---~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~-----~~~   72 (392)
                      |.+.+++|     ||+|++|||||||||.++|+...+..   ......||+++.||||||||.+....+.|.     .|.
T Consensus         1 ~~~~~~IR-----Nf~IiAHIDhGKSTLaDrlL~~tg~i~~~~~~~q~lD~m~~ErERGITIka~~v~~~y~~~~g~~y~   75 (601)
T PRK05433          1 MMDMKNIR-----NFSIIAHIDHGKSTLADRLIELTGTLSEREMKAQVLDSMDLERERGITIKAQAVRLNYKAKDGETYQ   75 (601)
T ss_pred             CCCHHCCC-----EEEEEEECCCCHHHHHHHHHHHCCCCCCCCCHHHCCCCHHHHHHCCCEEEEEEEEEEEECCCCCEEE
T ss_conf             96332045-----5899994378888899999997099774432333145415576558369786799998848996799


Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCE
Q ss_conf             99984787302467798774002331452012344332106778888631876023310023335612221101232100
Q gi|254780263|r   73 YSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRD  152 (392)
Q Consensus        73 i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~  152 (392)
                      +||||||||.||..++.|+++.+|+|||||||.+|+++||..++.+|...+++ +|.+|||||+.+.+  .+.+..++.+
T Consensus        76 lNLIDTPGHVDF~~EVsRSL~aceGalLlVDa~qGVqaQT~an~~~A~~~~L~-iIpviNKIDlp~Ad--~e~v~~qi~~  152 (601)
T PRK05433         76 LNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENDLE-IIPVLNKIDLPAAD--PERVKQEIED  152 (601)
T ss_pred             EEEECCCCCCCCCEEEEEEHHHCCCEEEEEECCCCCCCHHHHHHHHHHHCCCC-EEEEEECCCCCCCC--HHHHHHHHHH
T ss_conf             99854898566450455603340725999976878560069999999987996-57778614688899--8999999998


Q ss_pred             EEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEEC
Q ss_conf             11101453221023311467641144456521233203443102522221000011000000013554454301487424
Q gi|254780263|r  153 LLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRG  232 (392)
Q Consensus       153 ~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG  232 (392)
                      ++.   .. .-.++.+||.+|+          +++.||+++.+.+|+|..+.++|||..|+++++++++|.++.+||.+|
T Consensus       153 ~ig---l~-~~eil~vSAKtG~----------GV~~lLdaIV~~iP~P~gd~~~PL~ALIFDS~yD~YrGvV~~vRV~~G  218 (601)
T PRK05433        153 IIG---ID-ASDAVLVSAKTGI----------GIEEVLEAIVERIPPPKGDPDAPLKALIFDSWYDPYRGVVVLVRVVDG  218 (601)
T ss_pred             HHC---CC-HHHHHHHHHHCCC----------CHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEEEECC
T ss_conf             868---96-4777777523388----------879999999974799999987343120123030467880799994088


Q ss_pred             CCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCC-CCCEEECHHEEECCCC
Q ss_conf             534896799950687432125412100121144321001366641124-5432202117732677
Q gi|254780263|r  233 RIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGV-NRADVPRGRVVCAPGS  296 (392)
Q Consensus       233 ~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi-~~~di~rGdvl~~~~~  296 (392)
                      +|++||++.++..+.+....++.-......+++++.|||. |..+.|+ +..|+..||++++.+.
T Consensus       219 ~lk~Gd~I~~~~t~~~~~v~evGi~~p~~~~~~~L~aGeV-GyiiagiK~~~d~~vGDTit~~~~  282 (601)
T PRK05433        219 TLKKGDKIKMMSTGKEYEVDEVGVFTPKMVPVDELSAGEV-GYIIAGIKDVRDARVGDTITLAKN  282 (601)
T ss_pred             EECCCCEEEEECCCCEEEEEEEECCCCCCCCCCEECCCCE-EEEEECCCCHHHCCCCCEEECCCC
T ss_conf             7725852564126971672024256898527450137844-799824544432334760554777


No 34 
>KOG0463 consensus
Probab=100.00  E-value=0  Score=379.03  Aligned_cols=359  Identities=24%  Similarity=0.350  Sum_probs=296.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCC--CCCCHHHHHCCCEEEEEEE-------------------EEEC---
Q ss_conf             799999046898878999999876444200131--2686869862920637899-------------------9821---
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGD--IDSAPEEKLRGITIATAHV-------------------SYET---   68 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~--~D~~~~E~~rGiTi~~~~~-------------------~~~~---   68 (392)
                      +++|++|+||+|||||+|.|++.-.+.++..++  +.++++|.|.|.|-.++.-                   +++|   
T Consensus       134 ~RVAVVGNVDAGKSTLLGVLTHgeLDnGRG~ARqkLFRHKHEiESGRTSSVGNDILGFD~~GNvVNKPD~Hg~~LdWvkI  213 (641)
T KOG0463         134 ARVAVVGNVDAGKSTLLGVLTHGELDNGRGAARQKLFRHKHEIESGRTSSVGNDILGFDVHGNVVNKPDPHGHNLDWVKI  213 (641)
T ss_pred             EEEEEEECCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCEEE
T ss_conf             79899712247722167665304434672277887765223103675445566202002546421588988886431343


Q ss_pred             ---CCEEEEEEECCCCHHHHHHHHHHHHC--CCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHH
Q ss_conf             ---99089998478730246779877400--2331452012344332106778888631876023310023335612221
Q gi|254780263|r   69 ---DKRFYSHIDCPGHADYVKNMITGATQ--ADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELL  143 (392)
Q Consensus        69 ---~~~~i~iiD~PGH~~f~~~mi~g~~~--~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~  143 (392)
                         ..+.|+|||..||++|+++++.|+..  .|+.+|.|.|..|+-++|+||+.+|.+|.+|. .|+++|+|+|...-+.
T Consensus       214 ce~saKviTFIDLAGHEkYLKTTvFGMTGH~PDf~MLMiGaNaGIiGmTKEHLgLALaL~VPV-fvVVTKIDMCPANiLq  292 (641)
T KOG0463         214 CEDSAKVITFIDLAGHEKYLKTTVFGMTGHMPDFTMLMIGANAGIIGMTKEHLGLALALHVPV-FVVVTKIDMCPANILQ  292 (641)
T ss_pred             CCCCCEEEEEEECCCHHHHHHEEEECCCCCCCCCEEEEECCCCCCEECCHHHHHHHHHHCCCE-EEEEEEECCCCHHHHH
T ss_conf             136422689886154155231144103367887258985166651114477654556426857-9999850558178999


Q ss_pred             HHCCCCCCEEEEEEEEE--------------------E--EEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCC-C
Q ss_conf             10123210011101453--------------------2--21023311467641144456521233203443102522-2
Q gi|254780263|r  144 DISEYEIRDLLKEHKYS--------------------D--DTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPT-P  200 (392)
Q Consensus       144 ~~i~~~i~~~l~~~~~~--------------------~--~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~-p  200 (392)
                      |..+ .+..+|+..+..                    .  -.||+.+|.++   |+|        -.||..+.+.++. -
T Consensus       293 EtmK-ll~rllkS~gcrK~PvlVrs~DDVv~~A~NF~Ser~CPIFQvSNVt---G~N--------L~LLkmFLNlls~R~  360 (641)
T KOG0463         293 ETMK-LLTRLLKSPGCRKLPVLVRSMDDVVHAAVNFPSERVCPIFQVSNVT---GTN--------LPLLKMFLNLLSLRR  360 (641)
T ss_pred             HHHH-HHHHHHCCCCCCCCCEEEECCCCEEEEECCCCCCCCCCEEEECCCC---CCC--------HHHHHHHHHHCCCCC
T ss_conf             9999-9999862877650757885156447861358621235407861566---778--------389999986437445


Q ss_pred             CCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEE-CCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCC
Q ss_conf             21000011000000013554454301487424534896799950-68743212541210012114432100136664112
Q gi|254780263|r  201 QRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIG-MGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRG  279 (392)
Q Consensus       201 ~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p-~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkg  279 (392)
                      ...++.|..|.|+++|.++|+|||++|+..+|+++.+|.+.+.| +.+.+....|+||+..|-+|..+.+||...|+|+.
T Consensus       361 ~~~E~~PAeFQIDD~Y~VpGVGTvvSGT~L~GtIrLND~LlLGPd~~G~F~pI~iKSIHRKRMpV~~VrcGQtASFALKK  440 (641)
T KOG0463         361 QLNENDPAEFQIDDIYWVPGVGTVVSGTLLSGTIRLNDILLLGPDSNGDFMPIPIKSIHRKRMPVGIVRCGQTASFALKK  440 (641)
T ss_pred             CCCCCCCCCEEECCEEECCCCCEEEECCEEEEEEEECCEEEECCCCCCCEEEEEHHHHHHCCCCCEEEECCCHHHHHHHH
T ss_conf             66657973035222485178522764225521577522788667888876453456645403661487526404367663


Q ss_pred             CCCCEEECHHEEECCC-CCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEEE
Q ss_conf             4543220211773267-776300016899971056787555511597899995414777999961895570789769999
Q gi|254780263|r  280 VNRADVPRGRVVCAPG-SIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLE  358 (392)
Q Consensus       280 i~~~di~rGdvl~~~~-~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~  358 (392)
                      +...++++|+|+.+|+ .|.++|.|+|+|.+|.     |++.++..|+.++|||+.++++.+... +..+++.||.+.|.
T Consensus       441 Ikr~~vRKGMVmVsp~lkPqAsweFEaEILVLH-----HPTTIsprYQAMvHcGSiRQTAtivsM-~kdcLRTGDka~V~  514 (641)
T KOG0463         441 IKRKDVRKGMVMVSPKLKPQASWEFEAEILVLH-----HPTTISPRYQAMVHCGSIRQTATIVSM-GKDCLRTGDKAKVQ  514 (641)
T ss_pred             CCHHHHHCCEEEECCCCCCCEEEEEEEEEEEEE-----CCCCCCCCHHHEEEECCCCCEEEEEEC-CHHHHHCCCCCEEE
T ss_conf             546665364188668778632357754689984-----687558141320342340012243314-75665337744389


Q ss_pred             EEEC-CCEEECCCCEEEEEECCEEEEEEEEEEEE
Q ss_conf             9977-81775469849999899699989995531
Q gi|254780263|r  359 VELI-YPIAMEPNQTFSMREGGKTVGAGLILEII  391 (392)
Q Consensus       359 l~l~-~pi~~e~~~rfilRd~~~tig~G~I~~v~  391 (392)
                      |.+. +|.|+.+++|+++|+ |+|.|+|.|.+++
T Consensus       515 FrFIkqPEYir~gqrlVFRE-GRTKAVGti~~~l  547 (641)
T KOG0463         515 FRFIKQPEYIRPGQRLVFRE-GRTKAVGTISSVL  547 (641)
T ss_pred             EEEECCCCEECCCCEEEEEC-CCCEEEEEECCCC
T ss_conf             99856832325774688623-6530101340236


No 35 
>PRK13351 elongation factor G; Reviewed
Probab=100.00  E-value=0  Score=352.21  Aligned_cols=265  Identities=26%  Similarity=0.353  Sum_probs=200.0

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHH------HHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHH
Q ss_conf             999990468988789999998764------44200131268686986292063789998219908999847873024677
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYS------EEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~------~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~   87 (392)
                      ||+++||||||||||+++|+...+      +...+...||++++||+|||||.++...++|+++.|||||||||.||..+
T Consensus        10 Ni~IiaHvd~GKTTL~d~Ll~~~g~i~~~g~v~~g~t~~D~~~~E~eRgITikss~~sl~~~~~~iNlIDTPGHvDF~~E   89 (687)
T PRK13351         10 NIGIMAHIDAGKTTLTERILFYTGKIHKMGSVEDGNTVSDWMPQEQERGISIESAAATCDWKNHRINLIDTPGHIDFTGE   89 (687)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEEEEEEEEEECCEEEEEEECCCCCCHHHH
T ss_conf             89999179989899999999974998758715478744788299997498776215999889989999809797430999


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCC--HHHHHHCCCCCCEEEE--E-------
Q ss_conf             9877400233145201234433210677888863187602331002333561--2221101232100111--0-------
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDD--DELLDISEYEIRDLLK--E-------  156 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~--~~~~~~i~~~i~~~l~--~-------  156 (392)
                      +.++++.+|+||+||||.+|+++||+..+..+...++| +|++|||||+...  ++..+.+++.+.....  +       
T Consensus        90 v~~aLr~~DgallVVDaveGv~~qT~~v~r~a~~~~lp-~il~iNK~DR~~~d~~~~l~~i~~~l~~~~~~~~~p~~~~~  168 (687)
T PRK13351         90 VERSLRVLDGAVVVIDAVTGVQPQTETVWEQADKYKIP-RLIFINKMDRVGADLFDVLEDIEEKFGKRPLPLQLPIGSGD  168 (687)
T ss_pred             HHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCC
T ss_conf             99999987868999978999868899999999987998-59999797789987667788999984896477860013565


Q ss_pred             -------------EEEEEE-------------------------------------------------------------
Q ss_conf             -------------145322-------------------------------------------------------------
Q gi|254780263|r  157 -------------HKYSDD-------------------------------------------------------------  162 (392)
Q Consensus       157 -------------~~~~~~-------------------------------------------------------------  162 (392)
                                   ..|...                                                             
T Consensus       169 ~~~~~id~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~e~~~~~dd~lle~~l~~~~~~~~~l~~~l~~~~~  248 (687)
T PRK13351        169 SFEGVVDLITEKELHFKEGDGGDTVEERPIPEELLEEVASAREKLIDALLEFDDELLELYLEGEEITAEQLRAPFRRGLR  248 (687)
T ss_pred             CCCCEEEECCCHHHCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCHHHHHHHHHHHHH
T ss_conf             55641663110122002455685057725628889999999999999998308999999874887889999999999998


Q ss_pred             ----EECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCC------------------CCCCCCCCEECCCCCCCCC
Q ss_conf             ----102331146764114445652123320344310252222------------------1000011000000013554
Q gi|254780263|r  163 ----TPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQ------------------RSLDAPFLMHIEGSCGIEG  220 (392)
Q Consensus       163 ----~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~------------------~~~~~p~r~~I~~vf~i~g  220 (392)
                          +|++..|+..          ..++..||+++.+++|.|.                  .+.++|+...|...+..++
T Consensus       249 ~~~~~Pv~~gsa~~----------~~Gv~~LLd~i~~~lPsP~e~~~~~~~~~~~~~~~~~~~~~~p~~a~V~K~~~~~~  318 (687)
T PRK13351        249 SGHLVPVLFGSALK----------NIGIRPLLDAVVEYLPSPLEGNPPAGSKGTEKKVLVNPDPEKPLLALVFKVQYDPY  318 (687)
T ss_pred             HCCCCHHHCCCCCC----------CCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCC
T ss_conf             48724123030335----------87858899999870899210345456566664001457999870899999787488


Q ss_pred             CCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCC----CCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCC
Q ss_conf             4543014874245348967999506874321254121001----211443210013666411245432202117732677
Q gi|254780263|r  221 RGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMF----RKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGS  296 (392)
Q Consensus       221 ~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~----~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~  296 (392)
                      .|.+.++||.||+|+.|+++++...+   ...++..++..    ..++++|.|||++++.  |+  +++..|++||+++.
T Consensus       319 ~g~~s~~RV~sGtL~~g~~v~~~~~~---~~e~i~~l~~~~g~~~~~v~~~~aG~Iv~i~--gl--~~~~~g~tl~~~~~  391 (687)
T PRK13351        319 AGKLTYLRVYQGTLRSGSQLYNGSGR---KREKVGRIFRLQGNKREEVDEAKAGDIVAVA--GL--KELETGDTLHDEEG  391 (687)
T ss_pred             CCEEEEEEEECCEECCCCEEEECCCC---CEEEECCEEEECCCCCCCCCEECCCCEEEEE--CC--CCCCCCCEECCCCC
T ss_conf             97589999853454579877634898---3599676146426775414886779889995--87--64756887058998


No 36 
>KOG0462 consensus
Probab=100.00  E-value=0  Score=357.78  Aligned_cols=261  Identities=28%  Similarity=0.363  Sum_probs=216.1

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHH---HHHCCCCCCCCHHHHHCCCEEEEEEEEEECCC---EEEEEEECCCCHHHHHH
Q ss_conf             9999904689887899999987644---42001312686869862920637899982199---08999847873024677
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSE---EKKEYGDIDSAPEEKLRGITIATAHVSYETDK---RFYSHIDCPGHADYVKN   87 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~---~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~---~~i~iiD~PGH~~f~~~   87 (392)
                      |++|++|||||||||.++|++..+.   .......||+++.||||||||.+..+.+.|.+   |..|+||||||.||..+
T Consensus        62 NfsIIAHVDHGKSTLaDrLLe~tg~i~~~~~q~q~LDkl~vERERGITIkaQtasify~~~~~ylLNLIDTPGHvDFs~E  141 (650)
T KOG0462          62 NFSIIAHVDHGKSTLADRLLELTGTIDNNIGQEQVLDKLQVERERGITIKAQTASIFYKDGQSYLLNLIDTPGHVDFSGE  141 (650)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEEEEEECCCCEEEEEECCCCCCCCCCE
T ss_conf             13799984277016899999982877888755664245445665284787512379997587328875058985555410


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCC
Q ss_conf             98774002331452012344332106778888631876023310023335612221101232100111014532210233
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIR  167 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~  167 (392)
                      +.|.++.+|+|||||||.+|+++||.-.+.+|...|+. +|.++||+|+-..+  .+.++.++.+++...    ..+.|.
T Consensus       142 VsRslaac~G~lLvVDA~qGvqAQT~anf~lAfe~~L~-iIpVlNKIDlp~ad--pe~V~~q~~~lF~~~----~~~~i~  214 (650)
T KOG0462         142 VSRSLAACDGALLVVDASQGVQAQTVANFYLAFEAGLA-IIPVLNKIDLPSAD--PERVENQLFELFDIP----PAEVIY  214 (650)
T ss_pred             EHEHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCCE-EEEEEECCCCCCCC--HHHHHHHHHHHHCCC----CCCEEE
T ss_conf             00126535715999976768128899999999985974-88865315789889--899999999986689----612488


Q ss_pred             CEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCC
Q ss_conf             11467641144456521233203443102522221000011000000013554454301487424534896799950687
Q gi|254780263|r  168 GSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGG  247 (392)
Q Consensus       168 ~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~  247 (392)
                      +||.+|++.          .++|+++...+|+|....|+||||.+.+.|++.+.|.+..++|..|.+++||++..+....
T Consensus       215 vSAK~G~~v----------~~lL~AII~rVPpP~~~~d~plr~Lifds~yD~y~G~I~~vrv~~G~vrkGdkV~~~~t~~  284 (650)
T KOG0462         215 VSAKTGLNV----------EELLEAIIRRVPPPKGIRDAPLRMLIFDSEYDEYRGVIALVRVVDGVVRKGDKVQSAATGK  284 (650)
T ss_pred             EEECCCCCH----------HHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEEEEEEEEECCCEEEEEECCC
T ss_conf             870257568----------8899999963799988888516777666335442535899998634462187888861376


Q ss_pred             CCCCEEEECCCCC-CC---CCCCCCCCHHHHHHHCCCCCCEEECHHEEECCC
Q ss_conf             4321254121001-21---144321001366641124543220211773267
Q gi|254780263|r  248 KKLKVKCTDVEMF-RK---KLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPG  295 (392)
Q Consensus       248 ~~~~~kv~si~~~-~~---~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~  295 (392)
                      + ..++..++... ..   +++.+++|++++ +.++  ..+.+.||++++..
T Consensus       285 ~-yev~~vgvm~p~~~~~~~l~agqvGyIi~-~mr~--~~ea~IGdTi~~~~  332 (650)
T KOG0462         285 S-YEVKVVGVMRPEMTPVVELDAGQVGYIIC-NMRN--VKEAQIGDTIAHKS  332 (650)
T ss_pred             C-EEEEEEEEECCCCEEEEEECCCCCCEEEE-CCCC--CCCCCCCCEEEECC
T ss_conf             0-67677577635761432321454253675-0446--65450023000003


No 37 
>PRK00007 elongation factor G; Reviewed
Probab=100.00  E-value=0  Score=350.03  Aligned_cols=276  Identities=24%  Similarity=0.322  Sum_probs=196.3

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHH------HHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC-CEEEEEEECCCCHHHHH
Q ss_conf             999990468988789999998764------44200131268686986292063789998219-90899984787302467
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYS------EEKKEYGDIDSAPEEKLRGITIATAHVSYETD-KRFYSHIDCPGHADYVK   86 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~------~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~-~~~i~iiD~PGH~~f~~   86 (392)
                      ||+++||+|||||||+++|+...+      +.......||++++||+|||||.++...+.|+ ++.|||||||||.||..
T Consensus        12 Ni~IiaHvd~GKTTL~e~lL~~sg~i~~~G~v~~g~t~~D~~~~E~eRgITI~s~~~s~~~~~~~~iNlIDTPGHvDF~~   91 (693)
T PRK00007         12 NIGIMAHIDAGKTTTTERILFYTGVSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWKDGHRINIIDTPGHVDFTI   91 (693)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCHHHHHCCCCEEECEEEEEECCCEEEEEEECCCCCCHHH
T ss_conf             99999169999899999999966984658424389855678288997698873222548826973899991979752489


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCC--HHHHHHCCCCCCEE--EEE------
Q ss_conf             79877400233145201234433210677888863187602331002333561--22211012321001--110------
Q gi|254780263|r   87 NMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDD--DELLDISEYEIRDL--LKE------  156 (392)
Q Consensus        87 ~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~--~~~~~~i~~~i~~~--l~~------  156 (392)
                      ++.++++.+|+||+||||.+|+++||+..+..|...++|. |++|||||+...  +...+.+++.+..-  .-+      
T Consensus        92 Ev~~aLrv~DgAvlVvDav~GV~~qT~~v~r~a~~~~lp~-i~fINK~Dr~~ad~~~~l~~i~~~l~~~~~~~~~pi~~~  170 (693)
T PRK00007         92 EVERSLRVLDGAVAVFCAVGGVEPQSETVWRQADKYKVPR-IVFVNKMDRTGADFLRVVEQIKDRLGANPVPIQLPIGAE  170 (693)
T ss_pred             HHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCE-EEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEEEEECCC
T ss_conf             9999999858689999889887777999999998759896-999979778999989999999998599768998400247


Q ss_pred             EEEEEEEECCCCEEEE------E--------------------------------------EECCCCC------------
Q ss_conf             1453221023311467------6--------------------------------------4114445------------
Q gi|254780263|r  157 HKYSDDTPIIRGSALC------A--------------------------------------LQGTNKE------------  180 (392)
Q Consensus       157 ~~~~~~~pii~~sa~~------g--------------------------------------~~~~n~~------------  180 (392)
                      ..|..-+.++...++.      |                                      +.+....            
T Consensus       171 ~~f~g~vdl~~~~~~~~~~~~~g~~~~~~~~p~~~~~~~~~~r~~l~e~vae~dd~lle~yl~~~~~~~~el~~~lr~~~  250 (693)
T PRK00007        171 DDFKGVVDLVKMKAIIWDDDDLGTTFEYEEIPADLKDKAEEYREKLVEAAAEADEELMEKYLEGEELTEEEIKAALRKGT  250 (693)
T ss_pred             CCCCCEEEEEEEEEEECCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             76433033000013321333468713770185899999999999999999854999999985578899999999999988


Q ss_pred             -----C--------CCCCCCCHHHHHHCCCCCCC--------------------CCCCCCCCEECCCCCCCCCCCCCEEE
Q ss_conf             -----6--------52123320344310252222--------------------10000110000000135544543014
Q gi|254780263|r  181 -----L--------GEDSIHALMKAVDTHIPTPQ--------------------RSLDAPFLMHIEGSCGIEGRGTVVTG  227 (392)
Q Consensus       181 -----~--------~~~~~~~Ll~~i~~~~~~p~--------------------~~~~~p~r~~I~~vf~i~g~G~Vv~G  227 (392)
                           .        ...+...||+++.+++|.|.                    .+.++||...|+.+...++.|.+.++
T Consensus       251 ~~~~~~Pv~~gsa~~~~Gv~~LLd~i~~~lPsP~e~~~~~~~~~~~~~~~~~~~~~~~~pl~a~vfK~~~dp~~G~ls~~  330 (693)
T PRK00007        251 LANEIVPVLCGSAFKNKGVQPMLDAVVDYLPSPLDVPAIKGILPDGEEEEVERKASDDEPFSALAFKIMTDPFVGKLTFF  330 (693)
T ss_pred             HHCCEEEHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCEECCCCCCCCCEEEECCCCCCCCEEEEEEEEECCCCCCEEEE
T ss_conf             72765661026543487899999999986799212565002068987403564269877714687556774899826889


Q ss_pred             EEEECCCCCCCEEEEEECCCCCCCEEEECCCC----CCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCC
Q ss_conf             87424534896799950687432125412100----12114432100136664112454322021177326777
Q gi|254780263|r  228 CIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEM----FRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSI  297 (392)
Q Consensus       228 rV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~----~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~  297 (392)
                      ||.||+|+.|+.++....+   ...++.+++.    .+.++++|.|||++++.  |+  ++...||+||+++.+
T Consensus       331 RV~SGtl~~g~~v~n~~~~---~~e~i~~l~~~~g~~~~~v~~~~AGdIvai~--gL--~~~~tgdTl~~~~~~  397 (693)
T PRK00007        331 RVYSGVLNSGSYVLNSTKG---KKERIGRILQMHANKREEIKEVRAGDIAAAV--GL--KDTTTGDTLCDPDNP  397 (693)
T ss_pred             EECCCCCCCCCEEECCCCC---CCCCCCCEEEEECCCCCEEEEECCCCEEEEE--CC--CCEEECCCCCCCCCC
T ss_conf             8225723689863146543---2113563389855885160077279648985--33--430525531476776


No 38 
>PRK00741 prfC peptide chain release factor 3; Provisional
Probab=100.00  E-value=0  Score=348.64  Aligned_cols=265  Identities=26%  Similarity=0.362  Sum_probs=193.7

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHH------HH----HHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHH
Q ss_conf             999990468988789999998764------44----20013126868698629206378999821990899984787302
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYS------EE----KKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHAD   83 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~------~~----~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~   83 (392)
                      |||++||+|||||||+++|+...+      ..    ......+|++++||+|||||.++...|+|++++|||||||||.|
T Consensus        12 niaIi~H~dAGKTTLtE~lL~~~GaI~~~G~V~~~~~~~~~~sD~~~~E~~RgiSI~ssv~~~e~~~~~iNliDTPGh~D   91 (526)
T PRK00741         12 TFAIISHPDAGKTTLTEKLLLFGGAIQEAGTVKGRKSGRHATSDWMEMEKQRGISVTSSVMQFPYRDCLINLLDTPGHED   91 (526)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCHHHHHCCCEEECCEEEEEECCEEEEEEECCCCHH
T ss_conf             79999378989899999999746752448466314678864678858899759648615177867898999990989467


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCC--CHHHHHHCCCCCCE---------
Q ss_conf             4677987740023314520123443321067788886318760233100233356--12221101232100---------
Q gi|254780263|r   84 YVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVD--DDELLDISEYEIRD---------  152 (392)
Q Consensus        84 f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~--~~~~~~~i~~~i~~---------  152 (392)
                      |..++.++++.+|+||+||||.+|+++||+..+..|+..++| .+++|||||+-.  +.+..+.+++.+..         
T Consensus        92 F~~e~~raL~a~D~Av~Vida~~GVe~qTe~~w~~~~~~~iP-~i~FINKmDR~~ad~~~~l~ei~~~lg~~~~p~~~Pi  170 (526)
T PRK00741         92 FSEDTYRTLTAVDSALMVIDAAKGVEPQTRKLMEVCRLRDTP-IFTFINKLDRDGREPLELLDEIEEVLGIACAPITWPI  170 (526)
T ss_pred             HHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             789999999873759999977755233368999998863998-8999965676789878988778887478736888303


Q ss_pred             -----------EEEEE--EEE-------------------------------------------------------EEEE
Q ss_conf             -----------11101--453-------------------------------------------------------2210
Q gi|254780263|r  153 -----------LLKEH--KYS-------------------------------------------------------DDTP  164 (392)
Q Consensus       153 -----------~l~~~--~~~-------------------------------------------------------~~~p  164 (392)
                                 ++...  -|.                                                       .-.|
T Consensus       171 g~g~~F~GvvDl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ee~el~~~~~~~~d~~~~~~G~l~P  250 (526)
T PRK00741        171 GMGKRFKGVYDLYNDEVELYQPGHGHTIQEFEIIKGLDNPELDEALGEDLAEQLREELELVQGASNEFDLEAFLAGELTP  250 (526)
T ss_pred             CCCCCEEEEEEECCCEEEECCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHCCCEEE
T ss_conf             67886037888013879980367788404660587787789998753899997553577773155510689997398028


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCC---------CCCCCCCEECCCCC--CC-CCCCCCEEEEEEEC
Q ss_conf             23311467641144456521233203443102522221---------00001100000001--35-54454301487424
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQR---------SLDAPFLMHIEGSC--GI-EGRGTVVTGCIKRG  232 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~---------~~~~p~r~~I~~vf--~i-~g~G~Vv~GrV~sG  232 (392)
                      +++.||+.          ..++..||+++.++.|+|..         +.+.||-..|+.+-  -. +++|++.+.||+||
T Consensus       251 Vf~GSA~~----------n~GV~~LLd~iv~~~PsP~~r~~~~~~v~p~~~~fsa~VFKiqanmDP~h~griaf~RV~SG  320 (526)
T PRK00741        251 VFFGSALN----------NFGVQEFLDAFVEWAPAPQPRQTDERVVEPTEEKFSGFVFKIQANMDPKHRDRIAFMRVCSG  320 (526)
T ss_pred             EEEEECCC----------CCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCEEEEEEEEEE
T ss_conf             99620003----------65699999999997799877777765447877774359999984037542543799997511


Q ss_pred             CCCCCCEEEEEECCCCCCCEEEECCCC----CCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCC
Q ss_conf             534896799950687432125412100----1211443210013666411245432202117732677
Q gi|254780263|r  233 RIKAGSDVEIIGMGGKKLKVKCTDVEM----FRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGS  296 (392)
Q Consensus       233 ~l~~Gd~i~i~p~~~~~~~~kv~si~~----~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~  296 (392)
                      +++.|++++....+.   ..|+.+++.    .++++++|.|||++|+.    +..+++.||+||+.++
T Consensus       321 ~l~~g~~v~n~r~gk---~eri~~l~~~~g~~r~~V~ea~AGDIvgl~----~~~~~~tGDTL~~~~~  381 (526)
T PRK00741        321 KFEKGMKVRHVRTGK---DVRISNALTFMAQDREHVEEAYAGDIIGLH----NHGTIQIGDTFTEGEK  381 (526)
T ss_pred             EECCCCEEEECCCCC---EEEHHHHHHHHCCCCEEEEEECCCCEEEEC----CCCCCCCCCEECCCCC
T ss_conf             885799898525795---366326778744352351387699899971----6663003755206885


No 39 
>PRK12740 elongation factor G; Reviewed
Probab=100.00  E-value=0  Score=349.29  Aligned_cols=261  Identities=27%  Similarity=0.419  Sum_probs=197.1

Q ss_pred             EECCCCCHHHHHHHHHHHHHH------HHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHH
Q ss_conf             904689887899999987644------42001312686869862920637899982199089998478730246779877
Q gi|254780263|r   18 IGHVDHGKTTLTAAITKYYSE------EKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITG   91 (392)
Q Consensus        18 iGhvd~GKSTL~~~L~~~~~~------~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g   91 (392)
                      +||||||||||+++|+...+.      ...+...||++++||+|||||.++...|.|+++.|||||||||.||..++.++
T Consensus         1 iaHvd~GKTTL~e~lL~~sg~i~~~G~v~~g~t~~D~~~~E~eRgITI~ss~~s~~~~~~~iNlIDTPGHvDF~~EV~~a   80 (670)
T PRK12740          1 VGHSGAGKTTLTEAILFYTGAIHRIGEVEDGTTTMDFMPEERERGISIQSAATTCEWKGHKINIIDTPGHVDFTGEVERA   80 (670)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEEEEEEEEEECCEEEEEEECCCCCCHHHHHHHH
T ss_conf             98998888899999999659987576143897146780999973997322138898899899999297975148999999


Q ss_pred             HHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCC--HHHHHHCCCCCCEEEE--E-----------
Q ss_conf             400233145201234433210677888863187602331002333561--2221101232100111--0-----------
Q gi|254780263|r   92 ATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDD--DELLDISEYEIRDLLK--E-----------  156 (392)
Q Consensus        92 ~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~--~~~~~~i~~~i~~~l~--~-----------  156 (392)
                      ++.+|+||+||||.+|+++||+..+..|...++| .|++|||||+...  ++..+.+++.+..-..  +           
T Consensus        81 Lrv~DgAvlvVDaveGV~~qT~~v~r~a~~~~lp-~ilvINKiDr~~a~~~~~l~~i~~~l~~~~~~~~~Pi~~~~~f~g  159 (670)
T PRK12740         81 LRVLDGAVVVVCAVGGVEVQTETVWRYAEEYGVP-RIAFVNKLDRAGADFRRVLAQLQEALGAPVVPLQLPIGEGDDFKG  159 (670)
T ss_pred             HHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCEEE
T ss_conf             9986868999978999737899999999987999-699997978999998999999999848983579855047884457


Q ss_pred             ---------EEEEEE---------------------------------------------------------------EE
Q ss_conf             ---------145322---------------------------------------------------------------10
Q gi|254780263|r  157 ---------HKYSDD---------------------------------------------------------------TP  164 (392)
Q Consensus       157 ---------~~~~~~---------------------------------------------------------------~p  164 (392)
                               +.|..+                                                               +|
T Consensus       160 ~iDl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~lle~i~e~dd~lle~yl~~~~~~~~~l~~~l~~~~~~~~~~P  239 (670)
T PRK12740        160 VVDLLSMKAYRYDDEGGPSEEIEIPAELLDRAEEAREELLEALAEFDDELMEKYLEGEEPSEEEIKAGLRKGTRAGSIVP  239 (670)
T ss_pred             EEECCCCEEEEECCCCCCEEECCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCEEE
T ss_conf             85220356899827899437723878899999999999999987425999999876799999999999999997097578


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCC------------------CCCCCCCCCEECCCCCCCCCCCCCEE
Q ss_conf             233114676411444565212332034431025222------------------21000011000000013554454301
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTP------------------QRSLDAPFLMHIEGSCGIEGRGTVVT  226 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p------------------~~~~~~p~r~~I~~vf~i~g~G~Vv~  226 (392)
                      ++..||..          ..++..||+++.+++|.|                  ..+.++||...|..++..++.|.+.+
T Consensus       240 v~~gSa~~----------~~Gv~~LLd~I~~~lPsP~e~~~~~~~~~~~~~~~~~~d~~~p~~a~VfK~~~d~~~G~i~~  309 (670)
T PRK12740        240 VFCGSALK----------NKGVQRLLDAVVDYLPSPTEVPPRLGTDGEDEEPVLAPDPDGPLSALVFKTMDDPFVGKLSL  309 (670)
T ss_pred             EEECCCCC----------CCCHHHHHHHHHHHCCCHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCEEEE
T ss_conf             98625435----------77889999999987899254254114477776321457999982899998478588974899


Q ss_pred             EEEEECCCCCCCEEEEEECCCCCCCEEEECCCCC----CCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCC
Q ss_conf             4874245348967999506874321254121001----211443210013666411245432202117732677
Q gi|254780263|r  227 GCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMF----RKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGS  296 (392)
Q Consensus       227 GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~----~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~  296 (392)
                      +||+||+|+.||++++...+   ...+|.+++..    ..++++|.|||++++.  |++  ++..||+||+++.
T Consensus       310 ~RV~sG~L~~g~~v~~~~~~---~~eki~~l~~~~g~~~~~v~~~~aG~Iv~i~--gl~--~~~tgdTL~~~~~  376 (670)
T PRK12740        310 VRVYSGTLKKGDTLLNSTTG---KKERVGRLYRMHGKQQEEIDEAVAGDIVAVV--KLK--EAATGDTLCDKGD  376 (670)
T ss_pred             EEEECCEECCCCEEEECCCC---CEEEEEEEEEECCCCCEEEEEEECCCEEEEE--CCC--CCCCCCEECCCCC
T ss_conf             99836675589989835875---1587123578715762488998059789984--566--6635886107887


No 40 
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily.  BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants.  BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well.  The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli.  It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes.  It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes.  In addition, BipA from enteropathogenic E. co
Probab=100.00  E-value=0  Score=350.61  Aligned_cols=184  Identities=32%  Similarity=0.437  Sum_probs=164.6

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHH----HCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             999990468988789999998764442----0013126868698629206378999821990899984787302467798
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEK----KEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~----~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      ||+++||||||||||+++|+...+...    .....+|..++||+|||||.+++..|+|++++|||||||||.||+++|+
T Consensus         4 Nv~iiGHvd~GKTTL~~~Ll~~tg~~~~~~~~~~~~~D~~~~E~ergiTI~~~~~~~~~~~~~~n~IDtPGH~dF~~~~~   83 (194)
T cd01891           4 NIAIIAHVDHGKTTLVDALLKQSGTFRENEEVEERVMDSNDLERERGITILAKNTAVTYKDTKINIVDTPGHADFGGEVE   83 (194)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEEECCCHHHHHCCCCEEEEEEEEEECCEEEEEEECCCCHHHHHHHH
T ss_conf             89999068987999999999974876304652168614758888728763345899998998899998998477777898


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE---EEECC
Q ss_conf             774002331452012344332106778888631876023310023335612221101232100111014532---21023
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD---DTPII  166 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~---~~pii  166 (392)
                      +|++++|+|||||||.+|+++||++|+.++..+|+| +||+|||||+.+.  +++++.+++++++...++..   ++|++
T Consensus        84 ~~~~~~D~ailVVdA~~Gv~~QT~~~l~~a~~~~~~-~iv~iNK~D~~~a--~~~~v~~ei~~~~~~~~~~~~~~~~pii  160 (194)
T cd01891          84 RVLSMVDGVLLLVDASEGPMPQTRFVLKKALELGLK-PIVVINKIDRPDA--RPEEVVDEVFDLFIELGATEEQLDFPVL  160 (194)
T ss_pred             HHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCC--CHHHHHHHHHHHHHHCCCCCCCCCCCEE
T ss_conf             776434467898653789758999999999872997-4998856458988--8999999999999863999333588578


Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCC
Q ss_conf             3114676411444565212332034431025222
Q gi|254780263|r  167 RGSALCALQGTNKELGEDSIHALMKAVDTHIPTP  200 (392)
Q Consensus       167 ~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p  200 (392)
                      ++||++||.++|....++++..||+++++++|.|
T Consensus       161 ~~SA~~G~~~d~~~~~~~~~~~ll~ai~~~iP~P  194 (194)
T cd01891         161 YASAKNGWASLNLEDPSEDLEPLFDTIIEHVPAP  194 (194)
T ss_pred             EEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCC
T ss_conf             7256553357788656465999999999658898


No 41 
>PRK12739 elongation factor G; Reviewed
Probab=100.00  E-value=0  Score=343.08  Aligned_cols=276  Identities=24%  Similarity=0.304  Sum_probs=197.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHH------HHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHH
Q ss_conf             999990468988789999998764------44200131268686986292063789998219908999847873024677
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYS------EEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~------~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~   87 (392)
                      ||+++||||||||||+++|+...+      +.......||.+++||+|||||.++...+.|+++.|||||||||.||..+
T Consensus        12 Ni~IvaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~s~~~~~~~iNLIDTPGHvDF~~E   91 (693)
T PRK12739         12 NIGIMAHIDAGKTTTTERILFYTGKIHKIGEVHDGAATMDWMEQEQERGITITSAATTAFWKDHRINIIDTPGHVDFTIE   91 (693)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCHHHHHCCCCEEECEEEEEECCEEEEEEECCCCCHHHHH
T ss_conf             99999079989899999999976985657334389756878099987598674552778459989999949697405899


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCC--HHHHHHCCCCCCE--EEEE------E
Q ss_conf             9877400233145201234433210677888863187602331002333561--2221101232100--1110------1
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDD--DELLDISEYEIRD--LLKE------H  157 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~--~~~~~~i~~~i~~--~l~~------~  157 (392)
                      +.++++.+|+||+||||.+|+++||+..+..|...++| .|++|||||+...  +...+.+.+.+..  +.-+      .
T Consensus        92 V~~alrv~DgalvvVDaveGV~~qT~~v~rqa~~~~lp-~il~iNKiDR~~ad~~~~~~~i~~~l~~~~~~~~~pi~~~~  170 (693)
T PRK12739         92 VERSLRVLDGAVAVFDAVSGVEPQSETVWRQADKYGVP-RIVFVNKMDRIGADFFRVVEQIKDRLGANAVPIQLPIGAED  170 (693)
T ss_pred             HHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             99999984879999978988767799999999986989-69999797889999899999999985897799974220365


Q ss_pred             EEEEEEECCCCEEE------EEEE--------------------------------------CCCC--------------
Q ss_conf             45322102331146------7641--------------------------------------1444--------------
Q gi|254780263|r  158 KYSDDTPIIRGSAL------CALQ--------------------------------------GTNK--------------  179 (392)
Q Consensus       158 ~~~~~~pii~~sa~------~g~~--------------------------------------~~n~--------------  179 (392)
                      +|..-+.++...++      .|++                                      +.+.              
T Consensus       171 ~f~g~vd~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~r~~l~e~v~e~dd~l~e~~l~~~~~~~~~l~~~l~~~~~  250 (693)
T PRK12739        171 DFKGVIDLIKMKAIIWDDETLGAKYEEEDIPADLKEKAEEYREKLIEAVAETDEELMEKYLEGEEITEEEIKAAIRKATI  250 (693)
T ss_pred             CCCCEEEEECCEEEEEECCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHH
T ss_conf             53311431005788850455798337810768899999999999999998652899999855877889999999999998


Q ss_pred             ---CC--------CCCCCCCHHHHHHCCCCCCC-------------------CCCCCCCCEECCCCCCCCCCCCCEEEEE
Q ss_conf             ---56--------52123320344310252222-------------------1000011000000013554454301487
Q gi|254780263|r  180 ---EL--------GEDSIHALMKAVDTHIPTPQ-------------------RSLDAPFLMHIEGSCGIEGRGTVVTGCI  229 (392)
Q Consensus       180 ---~~--------~~~~~~~Ll~~i~~~~~~p~-------------------~~~~~p~r~~I~~vf~i~g~G~Vv~GrV  229 (392)
                         ..        .......||+++.+++|.|.                   .+.++||...|..++..++.|.+.++||
T Consensus       251 ~~~~~Pv~~gs~~~~~gv~~Lld~I~~~lPsP~e~~~~~~~~~~~~~~~~~~~~~~~p~~a~v~K~~~d~~~G~ia~~RV  330 (693)
T PRK12739        251 NMEFFPVLCGSAFKNKGVQPLLDAVVDYLPSPLDIPAIKGINPDTGEEVERPASDDEPFAALAFKIMTDPFVGRLTFFRV  330 (693)
T ss_pred             HCCCCCCEECCCCCCCCHHHHHHHHHHHCCCHHHCCCCCCCCCCCCCEEEECCCCCCCCEEEEEEEEECCCCCCEEEEEC
T ss_conf             37600203232003878999999999768991223443344788764235036999883899999888489981789993


Q ss_pred             EECCCCCCCEEEEEECCCCCCCEEEECCCC----CCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCC
Q ss_conf             424534896799950687432125412100----12114432100136664112454322021177326777
Q gi|254780263|r  230 KRGRIKAGSDVEIIGMGGKKLKVKCTDVEM----FRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSI  297 (392)
Q Consensus       230 ~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~----~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~  297 (392)
                      .||+|+.|++++....   ....+|..++.    ...++++|.||+++++  .|+  +++..||+|++++.+
T Consensus       331 ~sGtl~~g~~v~n~~~---~~~~ki~~l~~~~g~~~~~v~~~~aG~Iv~i--~Gl--~~~~tgdtl~~~~~~  395 (693)
T PRK12739        331 YSGTLESGSYVLNTTK---GKKERIGRLLQMHANKREEIKEVYAGDIGAA--VGL--KDTTTGDTLCDEKAP  395 (693)
T ss_pred             CCCEECCCCEEECCCC---CCEEECCEEEEEECCCCEEEEEECCCCEEEE--ECC--CCCCCCCEECCCCCC
T ss_conf             4771469998964676---4224304047862687415217648976999--644--454137872389876


No 42 
>KOG1143 consensus
Probab=100.00  E-value=0  Score=341.83  Aligned_cols=360  Identities=23%  Similarity=0.313  Sum_probs=294.4

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCC--CCCCHHHHHCCCEEEEEEEEE---------------------ECC
Q ss_conf             799999046898878999999876444200131--268686986292063789998---------------------219
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGD--IDSAPEEKLRGITIATAHVSY---------------------ETD   69 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~--~D~~~~E~~rGiTi~~~~~~~---------------------~~~   69 (392)
                      +++|++|.+|+|||||+|.|++...+.+..+++  +.+++||.+.|.|-.+++--+                     +..
T Consensus       168 vRvAVlGg~D~GKSTLlGVLTQgeLDnG~GrARln~FRh~HEiqsGrTSsis~evlGFd~~g~vVNY~~~~taEEi~e~S  247 (591)
T KOG1143         168 VRVAVLGGCDVGKSTLLGVLTQGELDNGNGRARLNIFRHPHEIQSGRTSSISNEVLGFDNRGKVVNYAQNMTAEEIVEKS  247 (591)
T ss_pred             EEEEEECCCCCCCCEEEEEEECCCCCCCCCEEEEEHHCCHHHHCCCCCCCCCHHCCCCCCCCCCCCHHHCCCHHHHHHHH
T ss_conf             99998527656722366554105314788706630110636540576320010100536534300223204599987410


Q ss_pred             CEEEEEEECCCCHHHHHHHHHHHHC--CCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCC
Q ss_conf             9089998478730246779877400--23314520123443321067788886318760233100233356122211012
Q gi|254780263|r   70 KRFYSHIDCPGHADYVKNMITGATQ--ADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISE  147 (392)
Q Consensus        70 ~~~i~iiD~PGH~~f~~~mi~g~~~--~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~  147 (392)
                      .+.++|||..||.+|.+++|.|++.  +|+|+|||+|..|+..-|+||+.++.+|.+|. .|.|+|||+++.+-.- ...
T Consensus       248 SKlvTfiDLAGh~kY~~TTi~gLtgY~Ph~A~LvVsA~~Gi~~tTrEHLgl~~AL~iPf-FvlvtK~Dl~~~~~~~-~tv  325 (591)
T KOG1143         248 SKLVTFIDLAGHAKYQKTTIHGLTGYTPHFACLVVSADRGITWTTREHLGLIAALNIPF-FVLVTKMDLVDRQGLK-KTV  325 (591)
T ss_pred             CCEEEEEECCCCHHHHEEEEEECCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHCCCE-EEEEEEECCCCCHHHH-HHH
T ss_conf             23388765044223130452200367986279999868887654088888999717876-9999840123632178-999


Q ss_pred             CCCCEEEEEEEEE---------------------EE-EECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCC-----
Q ss_conf             3210011101453---------------------22-10233114676411444565212332034431025222-----
Q gi|254780263|r  148 YEIRDLLKEHKYS---------------------DD-TPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTP-----  200 (392)
Q Consensus       148 ~~i~~~l~~~~~~---------------------~~-~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p-----  200 (392)
                      .++.++|++.+..                     ++ .|++..|.++|   +        +..|+..+.+.+++.     
T Consensus       326 ~~l~nll~~~Gc~kvp~~Vt~~ddAv~Aaq~~~s~nivPif~vSsVsG---e--------gl~ll~~fLn~Lsp~~~~~e  394 (591)
T KOG1143         326 KDLSNLLAKAGCTKVPKRVTTKDDAVKAAQELCSGNIVPIFAVSSVSG---E--------GLRLLRTFLNCLSPAGTAEE  394 (591)
T ss_pred             HHHHHHHHHCCCCCCCEEEECHHHHHHHHHHHCCCCCEEEEEEEECCC---C--------CHHHHHHHHHHCCCCCCHHH
T ss_conf             999988742376326348505078878888753688114899850476---3--------26699999864387677277


Q ss_pred             -CCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEEC-CCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             -210000110000000135544543014874245348967999506-874321254121001211443210013666411
Q gi|254780263|r  201 -QRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGM-GGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLR  278 (392)
Q Consensus       201 -~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~-~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lk  278 (392)
                       .+-...|..|.|++.|+++.+|+|+.|.+.+|.++.|+.+.+.|. ++.+.+.+|-+|+..+..+....|||...+.|.
T Consensus       395 ~~~L~q~~~eFqvdEiy~Vp~VG~VVGG~Ls~G~l~Eg~~~~vGP~~DG~F~~itV~sI~Rnr~acrvvraGqaAslsl~  474 (591)
T KOG1143         395 RIQLVQLPAEFQVDEIYNVPHVGQVVGGMLSEGQLHEGADVLVGPMKDGTFEKITVGSIRRNRQACRVVRAGQAASLSLN  474 (591)
T ss_pred             HHHHHCCCCEEEHHHEECCCCCCCCCCCEEEECEECCCCEEEEECCCCCCEEEEEEEEEECCCCCEEEECCCCCEEEECC
T ss_conf             99986676226674705677656503115422323268605750479983467886236416642026327631155226


Q ss_pred             CCCCCEEECHHEEECCC-CCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEE
Q ss_conf             24543220211773267-77630001689997105678755551159789999541477799996189557078976999
Q gi|254780263|r  279 GVNRADVPRGRVVCAPG-SIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDL  357 (392)
Q Consensus       279 gi~~~di~rGdvl~~~~-~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v  357 (392)
                      .-|...+++|+||..++ +|+.+..|+|++.+|-     |.+.+..|++..+|+|+.++++-+........+.+|++|.|
T Consensus       475 d~D~~~LR~GMVl~~~~~nP~~c~~F~A~~~lLf-----HaT~i~~GFQ~TVhiGsvrqTAvi~~I~~~d~lrtg~~AvV  549 (591)
T KOG1143         475 DPDGVSLRRGMVLAEIDHNPPVCYEFTANLLLLF-----HATYICEGFQATVHIGSVRQTAVITHIDDADCLRTGKWAVV  549 (591)
T ss_pred             CCCCCCHHCCEEEEECCCCCCEEEEEEEEEHHHH-----HHHHHEECCEEEEEECCEEEEEEEEEECCCCCCCCCCEEEE
T ss_conf             8874311034189633789945799860002000-----26743022068999743565455541124022467863799


Q ss_pred             EEEEC-CCEEECCCCEEEEEECCEEEEEEEEEEEE
Q ss_conf             99977-81775469849999899699989995531
Q gi|254780263|r  358 EVELI-YPIAMEPNQTFSMREGGKTVGAGLILEII  391 (392)
Q Consensus       358 ~l~l~-~pi~~e~~~rfilRd~~~tig~G~I~~v~  391 (392)
                      .|.+. +|.++.++.++++|+ |.|.|+|.|++|.
T Consensus       550 ~f~F~~hPEyir~G~~ilfRe-G~tKGiG~Vt~Vf  583 (591)
T KOG1143         550 KFCFAYHPEYIREGSPILFRE-GKTKGIGEVTKVF  583 (591)
T ss_pred             EEEECCCCHHCCCCCEEEEEC-CCCCCCCEEEEEE
T ss_conf             999617833306787343305-6446651377888


No 43 
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2).  eIF2 is a heterotrimeric translation initiation factor that consists of alpha, beta, and gamma subunits.  The GTP-bound gamma subunit also binds initiator methionyl-tRNA and delivers it to the 40S ribosomal subunit.  Following hydrolysis of GTP to GDP, eIF2:GDP is released from the ribosome.  The gamma subunit has no intrinsic GTPase activity, but is stimulated by the GTPase activating protein (GAP) eIF5, and GDP/GTP exchange is stimulated by the guanine nucleotide exchange factor (GEF) eIF2B.  eIF2B is a heteropentamer, and the epsilon chain binds eIF2.  Both eIF5 and eIF2B-epsilon are known to bind strongly to eIF2-beta, but have also been shown to bind directly to eIF2-gamma.  It is possible that eIF2-beta serves simply as a high-affinity docking site for eIF5 and eIF2B-epsilon, or that eIF2-beta serves a regulatory role.  eIF2-gamma is found only in eukaryotes and archaea.  It is closely related to SelB, the sel
Probab=100.00  E-value=0  Score=347.12  Aligned_cols=169  Identities=35%  Similarity=0.532  Sum_probs=142.3

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC------------------------
Q ss_conf             79999904689887899999987644420013126868698629206378999821------------------------
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET------------------------   68 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~------------------------   68 (392)
                      +||+++||||||||||+++|++.         ..|+.++|++||+|++++++....                        
T Consensus         1 vNi~iiGHVDhGKSTLi~~L~g~---------~~~~~~~e~er~it~klg~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~   71 (203)
T cd01888           1 INIGTIGHVAHGKSTLVKALSGV---------WTVRFKEELERNITIKLGYANAKIYKCPNCGCPRPYCYRSKEDSPECE   71 (203)
T ss_pred             CEEEEEEEECCCHHHHHHHHHCC---------CHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCCEEE
T ss_conf             96999988578799999997085---------124407888677603111456666511121223101111012442145


Q ss_pred             ---------CCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCC-CCCHHHHHHHHHHCCCCCEEEEECCCCCCC
Q ss_conf             ---------9908999847873024677987740023314520123443-321067788886318760233100233356
Q gi|254780263|r   69 ---------DKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGP-KPQTREHILLARQIGISSIVVYMNKVDAVD  138 (392)
Q Consensus        69 ---------~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~-~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~  138 (392)
                               -.|+|+|||||||+||++||++|+++||+|+|||||++|+ ++||+||+.+++.+|++++||||||||+++
T Consensus        72 ~~~~~~~~~~~r~~tiiD~PGH~df~~nmi~Gas~aD~aiLvVdA~eG~~~~QT~eH~~l~~~lgv~~iIV~vNKmDlv~  151 (203)
T cd01888          72 CPGCGGETKLVRHVSFVDCPGHEILMATMLSGAAVMDGALLLIAANEPCPQPQTSEHLAALEIMGLKHIIIVQNKIDLVK  151 (203)
T ss_pred             ECCCCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCC
T ss_conf             31456543112479998689879999999976643476689864366775077999999999849986367750777788


Q ss_pred             CHHHHHHCCCCCCEEEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCC
Q ss_conf             1222110123210011101453221023311467641144456521233203443102522221
Q gi|254780263|r  139 DDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQR  202 (392)
Q Consensus       139 ~~~~~~~i~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~  202 (392)
                      +++..+ ..++++++++...+ .+.|+||+||++|.          +++.|+++|.+.+|+|+|
T Consensus       152 ~~~~~~-~~~ei~~~l~~~~~-~~~~iIPiSA~~G~----------NI~~ll~~i~~~ip~P~~  203 (203)
T cd01888         152 EEQALE-NYEQIKKFVKGTIA-ENAPIIPISAQLKY----------NIDVLLEYIVKKIPTPPR  203 (203)
T ss_pred             HHHHHH-HHHHHHHHHCCCCC-CCCEEEEEECCCCC----------CHHHHHHHHHHHCCCCCC
T ss_conf             678999-99999998552168-99859991478897----------999999999867829999


No 44 
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=0  Score=334.87  Aligned_cols=276  Identities=26%  Similarity=0.362  Sum_probs=199.0

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHH------HHCCCCCCCCHHHHHCCCEEEEEEEEEECCC-EEEEEEECCCCHH
Q ss_conf             82799999046898878999999876444------2001312686869862920637899982199-0899984787302
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEE------KKEYGDIDSAPEEKLRGITIATAHVSYETDK-RFYSHIDCPGHAD   83 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~------~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~-~~i~iiD~PGH~~   83 (392)
                      ...||+++||+|||||||+++|+.+.+..      ..+.+.||++++||+|||||.++.+.+.|++ ++|||||||||.|
T Consensus         9 ~~RNigI~aHidaGKTTltE~lL~~tG~i~k~G~v~~g~~~~D~~e~EqeRGITI~saa~s~~~~~~~~iNlIDTPGHVD   88 (697)
T COG0480           9 RIRNIGIVAHIDAGKTTLTERILFYTGIISKIGEVHDGAATMDWMEQEQERGITITSAATTLFWKGDYRINLIDTPGHVD   88 (697)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCEEEEEEEEEEECCCEEEEEECCCCCCC
T ss_conf             54079999604788077889999875975778556678654788788986697786405689970865899957997353


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH--HHHHHCCCCCCE---------
Q ss_conf             467798774002331452012344332106778888631876023310023335612--221101232100---------
Q gi|254780263|r   84 YVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDD--ELLDISEYEIRD---------  152 (392)
Q Consensus        84 f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~--~~~~~i~~~i~~---------  152 (392)
                      |+.++.|++..+|+|++||||.+|+++||+..+..|...++|+ |++|||||+...+  ...+.+...+..         
T Consensus        89 Ft~EV~rslrvlDgavvVvdaveGV~~QTEtv~rqa~~~~vp~-i~fiNKmDR~~a~~~~~~~~l~~~l~~~~~~v~~pI  167 (697)
T COG0480          89 FTIEVERSLRVLDGAVVVVDAVEGVEPQTETVWRQADKYGVPR-ILFVNKMDRLGADFYLVVEQLKERLGANPVPVQLPI  167 (697)
T ss_pred             CHHHHHHHHHHHCCEEEEEECCCCEEECHHHHHHHHHHCCCCE-EEEEECCCCCCCCHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             4778799888616509999887883003799999986559975-999978433556733509999998679832232111


Q ss_pred             -----------EEE--EEEEEE--EEEC--CCCEEEEE------------------------EECCC-------------
Q ss_conf             -----------111--014532--2102--33114676------------------------41144-------------
Q gi|254780263|r  153 -----------LLK--EHKYSD--DTPI--IRGSALCA------------------------LQGTN-------------  178 (392)
Q Consensus       153 -----------~l~--~~~~~~--~~pi--i~~sa~~g------------------------~~~~n-------------  178 (392)
                                 ++.  ...|..  ....  +|.+ ..+                        +++..             
T Consensus       168 g~~~~f~g~idl~~~~~~~~~~~~~~~~~~ip~~-~~~~~~e~r~~~~e~i~e~de~l~e~yl~g~e~~~~~i~~~i~~~  246 (697)
T COG0480         168 GAEEEFEGVIDLVEMKAVAFGDGAKYEWIEIPAD-LKEIAEEAREKLLEALAEFDEELMEKYLEGEEPTEEEIKKALRKG  246 (697)
T ss_pred             CCCCCCCCEEEHHHCCEEEECCCCCCCEEECCHH-HHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCHHHHHHHHHHH
T ss_conf             5730047636711067179757752431558778-876789999999998861579999998668876479999999876


Q ss_pred             -------CC-----CCCCCCCCHHHHHHCCCCCCCC--------------------CCCCCCCEECCCCCCCCCCCCCEE
Q ss_conf             -------45-----6521233203443102522221--------------------000011000000013554454301
Q gi|254780263|r  179 -------KE-----LGEDSIHALMKAVDTHIPTPQR--------------------SLDAPFLMHIEGSCGIEGRGTVVT  226 (392)
Q Consensus       179 -------~~-----~~~~~~~~Ll~~i~~~~~~p~~--------------------~~~~p~r~~I~~vf~i~g~G~Vv~  226 (392)
                             +.     ......+.||+++..++|.|..                    +.++||.+.+..+...+++|.+.+
T Consensus       247 ~~~~~~~pvl~gsa~kn~gv~~lLdav~~~lPsP~e~~~~~g~~~~~~~~~~~~~~~~e~p~~a~vfKi~~d~~~g~l~~  326 (697)
T COG0480         247 TIAGKIVPVLCGSAFKNKGVQPLLDAVVDYLPSPLDVPPIKGDLDDEIEKAVLRKASDEGPLSALVFKIMTDPFVGKLTF  326 (697)
T ss_pred             HHCCCEEEEEEEEECCCCCHHHHHHHHHHHCCCHHHCCCCCCCCCCCCCCHHCCCCCCCCCEEEEEEEEEECCCCCEEEE
T ss_conf             53266256775010257757999999998789956645444767753230000468888865999999686487875999


Q ss_pred             EEEEECCCCCCCEEEEEECCCCCCCEEEECCCC----CCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCC
Q ss_conf             487424534896799950687432125412100----121144321001366641124543220211773267
Q gi|254780263|r  227 GCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEM----FRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPG  295 (392)
Q Consensus       227 GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~----~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~  295 (392)
                      +||+||+|+.|++++....+.   +.++..|..    .+.+++++.|||++++.    ..++...||++|+.+
T Consensus       327 ~RvysGtl~~G~~v~n~~~~~---~erv~~l~~~~~~~~~~v~~~~AG~I~a~~----Gl~~~~tGdTl~~~~  392 (697)
T COG0480         327 VRVYSGTLKSGSEVLNSTKGK---KERVGRLLLMHGNEREEVDEVPAGDIVALV----GLKDATTGDTLCDEN  392 (697)
T ss_pred             EEEECCEECCCCEEEECCCCC---CEEEEEEEECCCCCEEECCCCCCCCEEEEE----CCCCCCCCCEEECCC
T ss_conf             998643773798899579985---378778987168950260540576489997----523554078565378


No 45 
>cd01889 SelB_euk SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner.  This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and euk
Probab=100.00  E-value=0  Score=341.96  Aligned_cols=172  Identities=28%  Similarity=0.489  Sum_probs=150.7

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEE--------------CCCEEEEEEEC
Q ss_conf             7999990468988789999998764442001312686869862920637899982--------------19908999847
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYE--------------TDKRFYSHIDC   78 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~--------------~~~~~i~iiD~   78 (392)
                      +||+++||||||||||+++|++..+.     ..+|++++||+|||||+++++.|.              +++++||||||
T Consensus         1 ~NV~iiGHVDhGKTTL~~~L~~~~~~-----~~~D~~~eE~eRGITi~~g~~~~~~~~~~~~~~~~~~~~~~~~i~~IDt   75 (192)
T cd01889           1 VNVGVLGHVDSGKTSLAKALSEIAST-----AAFDKNPQSQERGITLDLGFSSFYVDKPKHLRELINPGEENLQITLVDC   75 (192)
T ss_pred             CEEEEEEECCCCHHHHHHHHHHHCCC-----HHHHCCHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCEEEEEEEC
T ss_conf             98999976178999999999833350-----1221358899779716710013785144221123234677458999877


Q ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHH---HHHHCCCCCCEEEE
Q ss_conf             873024677987740023314520123443321067788886318760233100233356122---21101232100111
Q gi|254780263|r   79 PGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDE---LLDISEYEIRDLLK  155 (392)
Q Consensus        79 PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~---~~~~i~~~i~~~l~  155 (392)
                      |||+||++||++|++++|+|+|||||++|+++||+||+.+++.+|+| +|||+||||++++++   ++++++.++..++.
T Consensus        76 PGH~df~~~~~~g~~~~D~ailvVda~~G~~~QT~eh~~~~~~~~~~-~iv~iNK~D~v~~~~~~~~~~~i~~~l~~~l~  154 (192)
T cd01889          76 PGHASLIRTIIGGAQIIDLMLLVVDATKGIQTQTAECLVIGEILCKK-LIVVLNKIDLIPEEERERKIEKMKKKLQKTLE  154 (192)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             98388998888887432652799987888878999999999985899-79999741278815779999999999999986


Q ss_pred             EEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCC
Q ss_conf             0145322102331146764114445652123320344310252222
Q gi|254780263|r  156 EHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQ  201 (392)
Q Consensus       156 ~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~  201 (392)
                      ..++. +.|++|+||.+|.          ++..|.+.+.+.+|.|.
T Consensus       155 ~~~~~-~~~iipiSA~~G~----------gi~eL~~~i~~lip~p~  189 (192)
T cd01889         155 KTRFK-NSPIIPVSAKPGG----------GEAELGKDLNNLIVLPL  189 (192)
T ss_pred             HCCCC-CCEEEEEECCCCC----------CHHHHHHHHHHHCCCCC
T ss_conf             53899-9849995789884----------98999988876189996


No 46 
>PRK07560 elongation factor EF-2; Reviewed
Probab=100.00  E-value=0  Score=335.64  Aligned_cols=276  Identities=27%  Similarity=0.423  Sum_probs=194.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHH----HHHCCCCCCCCHHHHHCCCEEEEEEEE----EECCCEEEEEEECCCCHHH
Q ss_conf             79999904689887899999987644----420013126868698629206378999----8219908999847873024
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSE----EKKEYGDIDSAPEEKLRGITIATAHVS----YETDKRFYSHIDCPGHADY   84 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~----~~~~~~~~D~~~~E~~rGiTi~~~~~~----~~~~~~~i~iiD~PGH~~f   84 (392)
                      -||+++||+|||||||+++|+...+.    .......||.+++||+|||||.++...    +.|.++.|||||||||.||
T Consensus        21 RNI~IiaHvdaGKTTLtE~lL~~sg~i~~~~~~~~t~~D~~~~E~eRgITI~sa~~sl~~~~~~~~~~INlIDTPGh~DF  100 (730)
T PRK07560         21 RNIGIVAHIDHGKTTLSDNLLAGAGMISEELAGKQLALDYDEEEQARGITIKAANVSMVHEYEGKEYLINLIDTPGHVDF  100 (730)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCEECCCHHHHHHCCCCEEECCEEEEEEECCCCEEEEEECCCCCCHH
T ss_conf             28999937998989999999996499865347986417885999972985752110289875698378999819697305


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCC------HHHHH---HCCCCCCEEEE
Q ss_conf             6779877400233145201234433210677888863187602331002333561------22211---01232100111
Q gi|254780263|r   85 VKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDD------DELLD---ISEYEIRDLLK  155 (392)
Q Consensus        85 ~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~------~~~~~---~i~~~i~~~l~  155 (392)
                      +.++.++++.+|+||+||||.+|+++||+..|..+...++|.+ ++|||||+...      ++.++   .+...+..++.
T Consensus       101 ~~Ev~~aLrv~DgAvvVvdav~GV~~qTe~v~rqa~~~~~p~i-lfINKmDR~~~~l~~~~~~~~~~l~~~i~~~~~~i~  179 (730)
T PRK07560        101 GGDVTRAMRAVDGAIVVVDAVEGVMPQTETVLRQALEERVRPV-LFINKVDRLIKELKLTPQEMQQRLLKIIKDVNKLIE  179 (730)
T ss_pred             HHHHHHHHHHHCEEEEEEECCCCCCCHHHHHHHHHHHCCCCEE-EEEECCCCCHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999988587899997898877318999999987799979-998686623555377989998889889999999998


Q ss_pred             ---EEEEEE-------EEECCCCEEEEEEECCCC---------------------CC--CC-CCCCCHHHHHHCCCCCCC
Q ss_conf             ---014532-------210233114676411444---------------------56--52-123320344310252222
Q gi|254780263|r  156 ---EHKYSD-------DTPIIRGSALCALQGTNK---------------------EL--GE-DSIHALMKAVDTHIPTPQ  201 (392)
Q Consensus       156 ---~~~~~~-------~~pii~~sa~~g~~~~n~---------------------~~--~~-~~~~~Ll~~i~~~~~~p~  201 (392)
                         ...+.+       +..+...|+..+|...-.                     ..  .+ .....||+++.+++|.|.
T Consensus       180 ~~~~~~~~~~~~~~~~~~~v~~~sa~~~~~~~~~~~~~~~~~~~ei~~~~~~~~~~~l~~~~pl~~~lld~i~~~lPsP~  259 (730)
T PRK07560        180 GYAPEEFKEKWKVDVADGTVAFGSALYNWAISVPMMQKTGIKFKDIIDYYEKGKVKELAEKAPLHEVVLDMVIKHLPNPL  259 (730)
T ss_pred             HCCCHHHCCCEEECCCCCCHHHHHHHHCCCCCHHHHHHHCCCHHHHHHHHHCCHHHHHHHHCCHHHHHHHHHHHHCCCHH
T ss_conf             63715537550524433420544234275234699987187778999998531288876538479999999998689957


Q ss_pred             C-------------------------CCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEEC
Q ss_conf             1-------------------------000011000000013554454301487424534896799950687432125412
Q gi|254780263|r  202 R-------------------------SLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTD  256 (392)
Q Consensus       202 ~-------------------------~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~s  256 (392)
                      .                         +.++||...|+.+...++.|.+.++||+||+|+.|+++++...+.   ..|+..
T Consensus       260 ea~~~ri~~~~~g~~~~~~~~~~~~~d~~~pl~~~vfK~~~dp~~g~is~~RV~sG~L~~g~~v~n~~~~~---~eki~~  336 (730)
T PRK07560        260 EAQKYRIPKIWKGDLNSEIGKAMLNCDPNGPLVMMVTKIIVDPHAGEVATGRVFSGTIRRGQEVYLVGAKK---KARVQQ  336 (730)
T ss_pred             HHCCCCCCCCCCCCCCCHHHEEEEECCCCCCCEEEEEEEEECCCCCEEEEEEEECCEECCCCEEEECCCCC---CEEEEE
T ss_conf             72210356445788765101012204899871457754556698864899998434664798754047774---125215


Q ss_pred             CCCC----CCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCC
Q ss_conf             1001----211443210013666411245432202117732677
Q gi|254780263|r  257 VEMF----RKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGS  296 (392)
Q Consensus       257 i~~~----~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~  296 (392)
                      ++..    ..++++|.|||++++.    ...+...||+||+++.
T Consensus       337 l~~~~g~~~~~v~~~~aGdI~ai~----gL~~~~tGdTl~~~~~  376 (730)
T PRK07560        337 VGIYMGPEREEVDEIPAGNIAAVT----GLKDARAGETVVSPEY  376 (730)
T ss_pred             EEEEECCCEEEEEEECCCCEEEEE----CCCCCCCCCEEECCCC
T ss_conf             787206965781051678789995----6655411665425876


No 47 
>KOG0461 consensus
Probab=100.00  E-value=0  Score=335.31  Aligned_cols=342  Identities=26%  Similarity=0.454  Sum_probs=269.2

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC---------CCEEEEEEECCC
Q ss_conf             88279999904689887899999987644420013126868698629206378999821---------990899984787
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET---------DKRFYSHIDCPG   80 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~---------~~~~i~iiD~PG   80 (392)
                      .-++|++++||||+|||||..+|....+..+     -|..+..++||||.|++|..+.-         +.-.++++||||
T Consensus         5 p~n~N~GiLGHvDSGKTtLarals~~~STaA-----FDk~pqS~eRgiTLDLGFS~~~v~~parLpq~e~lq~tlvDCPG   79 (522)
T KOG0461           5 PSNLNLGILGHVDSGKTTLARALSELGSTAA-----FDKHPQSTERGITLDLGFSTMTVLSPARLPQGEQLQFTLVDCPG   79 (522)
T ss_pred             CCEEEEEEEEECCCCHHHHHHHHHHHCCHHH-----HCCCCCCCCCCEEEEECCEEEECCCCCCCCCCCCCEEEEEECCC
T ss_conf             7202443574025764899999986314033-----22487531046267412204413572337876641269971797


Q ss_pred             CHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHH---HHCCCCCCEEEEEE
Q ss_conf             302467798774002331452012344332106778888631876023310023335612221---10123210011101
Q gi|254780263|r   81 HADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELL---DISEYEIRDLLKEH  157 (392)
Q Consensus        81 H~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~---~~i~~~i~~~l~~~  157 (392)
                      |...+++.|.|+...|.++||||+.+|.++||.||+.+...+. ++++|++||+|...+.+|.   +.....+++-|+..
T Consensus        80 HasLIRtiiggaqiiDlm~lviDv~kG~QtQtAEcLiig~~~c-~klvvvinkid~lpE~qr~ski~k~~kk~~KtLe~t  158 (522)
T KOG0461          80 HASLIRTIIGGAQIIDLMILVIDVQKGKQTQTAECLIIGELLC-KKLVVVINKIDVLPENQRASKIEKSAKKVRKTLEST  158 (522)
T ss_pred             HHHHHHHHHCCHHHHEEEEEEEEHHCCCCCCCCHHHHHHHHHC-CCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             0889999971012001346788610176665214544376644-626999950122653024567899999999778745


Q ss_pred             EEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCC
Q ss_conf             45322102331146764114445652123320344310252222100001100000001355445430148742453489
Q gi|254780263|r  158 KYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAG  237 (392)
Q Consensus       158 ~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~G  237 (392)
                      +|.++.||+++|+..|+.      ....++.|.++|.+.+-.|.|+.++||.|.|+..|.++|.|||.+|+|.+|.++.|
T Consensus       159 ~f~g~~PI~~vsa~~G~~------~~~~i~eL~e~l~s~if~P~Rd~~gpflm~vDHCF~IKGQGTV~TGTvl~G~~~ln  232 (522)
T KOG0461         159 GFDGNSPIVEVSAADGYF------KEEMIQELKEALESRIFEPKRDEEGPFLMAVDHCFAIKGQGTVLTGTVLRGVLRLN  232 (522)
T ss_pred             CCCCCCCEEEEECCCCCC------CHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEEEECC
T ss_conf             768888526764378754------06678999999997624777688887589864257862671588634787689628


Q ss_pred             CEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCCCCCEEEEEEEEEEECCCCCC
Q ss_conf             67999506874321254121001211443210013666411245432202117732677763000168999710567875
Q gi|254780263|r  238 SDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGR  317 (392)
Q Consensus       238 d~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~~~~~~f~A~i~il~~~~~~~  317 (392)
                      +++.+...+   ..-+|+|+|||+.++.+|.+||++|+.+...|..-+.|| ++|.|++++++...-+.+--..-    -
T Consensus       233 ~~iE~PAL~---e~rkVKslqmf~~~vtsa~~GdR~g~cVtqFd~klleRg-i~~~pg~Lk~~~avl~~vepI~y----f  304 (522)
T KOG0461         233 TEIEFPALN---EKRKVKSLQMFKQRVTSAAAGDRAGFCVTQFDEKLLERG-ICGPPGTLKSTKAVLATVEPIQY----F  304 (522)
T ss_pred             CEEEECCCC---HHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHCC-CCCCCCCCCEEEEEEEEECCHHH----H
T ss_conf             688504333---144444699875120023215622434001378887375-65797643012155676023088----7


Q ss_pred             CCCCCCCCEEEEEECCEEEEEEEEE----------------------CCCHHHHCCCCEEEEEEEECCCEEECCCC
Q ss_conf             5551159789999541477799996----------------------18955707897699999977817754698
Q gi|254780263|r  318 TTGFMDNYRPQFFMDTADVTGRIIL----------------------SPGSQAVMPGDRVDLEVELIYPIAMEPNQ  371 (392)
Q Consensus       318 ~~~~~~~~~~~~~~~~~~v~~~i~~----------------------~~~~~~i~~g~~~~v~l~l~~pi~~e~~~  371 (392)
                      ...++...+.++.++...++++...                      +-.|..+.+++...+.+++.+|+...++.
T Consensus       305 r~~i~sk~K~Hi~VgheTVMa~~~ff~d~d~~~~tf~~~kEye~~E~d~~Pa~~~~~~~~~aL~~FEkpv~~P~~s  380 (522)
T KOG0461         305 RKSINSKSKIHIAVGHETVMAECQFFKDTDGTTSTFQLDKEYENGEFDMLPALLAPCDVIQALFSFEKPVFLPEYS  380 (522)
T ss_pred             HHHHHHHHEEEEEEEHHHHHHEEEEEECCCCCCCCCCCCHHHHCCCCCCCHHHCCCCHHEEEEEEECCCCCCCCCC
T ss_conf             6554010048898403421011577513688643110235665264335755508742101344533651374423


No 48 
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=330.15  Aligned_cols=262  Identities=27%  Similarity=0.386  Sum_probs=213.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHH---HHHCCCCCCCCHHHHHCCCEEEEEEEEEEC-----CCEEEEEEECCCCHHHH
Q ss_conf             9999904689887899999987644---420013126868698629206378999821-----99089998478730246
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSE---EKKEYGDIDSAPEEKLRGITIATAHVSYET-----DKRFYSHIDCPGHADYV   85 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~---~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~-----~~~~i~iiD~PGH~~f~   85 (392)
                      |+.||+|+|||||||.++|++..+.   +.-..-.+|+++.||||||||.+-...+.|     +.|.+||||||||.||.
T Consensus        11 NFsIIAHIDHGKSTLaDRlle~t~~~~~Rem~~Q~LDsMdiERERGITIKaq~v~l~Yk~~~g~~Y~lnlIDTPGHVDFs   90 (603)
T COG0481          11 NFSIIAHIDHGKSTLADRLLELTGGLSEREMRAQVLDSMDIERERGITIKAQAVRLNYKAKDGETYVLNLIDTPGHVDFS   90 (603)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEEEECCCCEEEEEECCCCCCCCEE
T ss_conf             22799984278204889999984676767888875221346766284587327899999479977999972799844367


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEEC
Q ss_conf             77987740023314520123443321067788886318760233100233356122211012321001110145322102
Q gi|254780263|r   86 KNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPI  165 (392)
Q Consensus        86 ~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pi  165 (392)
                      .++-|+++.+.+|||||||+.|++.||.-..++|-..+.. +|-++||+|+...+  .+.++.|+.+.+.-   . ....
T Consensus        91 YEVSRSLAACEGalLvVDAsQGveAQTlAN~YlAle~~Le-IiPViNKIDLP~Ad--pervk~eIe~~iGi---d-~~da  163 (603)
T COG0481          91 YEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLE-IIPVLNKIDLPAAD--PERVKQEIEDIIGI---D-ASDA  163 (603)
T ss_pred             EEEHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCCE-EEEEEECCCCCCCC--HHHHHHHHHHHHCC---C-CCCC
T ss_conf             7761337637771899987655378899999999876967-99753225688789--78999999987098---9-5200


Q ss_pred             CCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEEC
Q ss_conf             33114676411444565212332034431025222210000110000000135544543014874245348967999506
Q gi|254780263|r  166 IRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGM  245 (392)
Q Consensus       166 i~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~  245 (392)
                      +-+||.+|+          +++.+|++|.+.+|+|..+.++||+..|.++|++++.|.|+.-||..|++++||++.++..
T Consensus       164 v~~SAKtG~----------gI~~iLe~Iv~~iP~P~g~~~~pLkALifDS~yD~Y~GVv~~vRi~dG~ik~gdki~~m~t  233 (603)
T COG0481         164 VLVSAKTGI----------GIEDVLEAIVEKIPPPKGDPDAPLKALIFDSWYDNYLGVVVLVRIFDGTLKKGDKIRMMST  233 (603)
T ss_pred             EEEECCCCC----------CHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCCCEEEEEEEEEECEECCCCEEEEEEC
T ss_conf             467634689----------9799999999628989899987515888841234554289999986243447998999746


Q ss_pred             CCCCCCEEEECCCC-CCCCCCCCCCCHHHHHHHCCC-CCCEEECHHEEECC
Q ss_conf             87432125412100-121144321001366641124-54322021177326
Q gi|254780263|r  246 GGKKLKVKCTDVEM-FRKKLDEAIAGDNVGLLLRGV-NRADVPRGRVVCAP  294 (392)
Q Consensus       246 ~~~~~~~kv~si~~-~~~~v~~a~aGd~v~l~Lkgi-~~~di~rGdvl~~~  294 (392)
                      +.+....++. +.. ....+++..||| ||+-..|+ +..|.+.||+++..
T Consensus       234 g~~y~V~evG-vftP~~~~~~~L~aGe-VG~~~a~iK~v~d~~VGDTiT~~  282 (603)
T COG0481         234 GKEYEVDEVG-IFTPKMVKVDELKAGE-VGYIIAGIKDVRDARVGDTITLA  282 (603)
T ss_pred             CCEEEEEEEE-ECCCCCCCCCCCCCCC-EEEEEEEEEECCCCCCCCEEECC
T ss_conf             9768888875-1167633246445773-44899851111568655567506


No 49 
>KOG0466 consensus
Probab=100.00  E-value=0  Score=334.68  Aligned_cols=354  Identities=26%  Similarity=0.416  Sum_probs=282.8

Q ss_pred             HHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEE---ECC-------------
Q ss_conf             2103882799999046898878999999876444200131268686986292063789998---219-------------
Q gi|254780263|r    6 YVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSY---ETD-------------   69 (392)
Q Consensus         6 ~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~---~~~-------------   69 (392)
                      -+.++.++||++||||.|||||++.++++.         .+=+.+.|-||.|||.++|++.   .++             
T Consensus        32 visRQATiNIGTIGHVAHGKSTvVkAiSGv---------~TvrFK~ELERNITIKLGYANAKIYkc~~~kCprP~cy~s~  102 (466)
T KOG0466          32 VISRQATINIGTIGHVAHGKSTVVKAISGV---------HTVRFKNELERNITIKLGYANAKIYKCDDPKCPRPGCYRSF  102 (466)
T ss_pred             HHHHEEEEEECCEECCCCCCCEEEEEECCC---------EEEEEHHHHHCCEEEEECCCCCEEEECCCCCCCCCCHHHCC
T ss_conf             951201443021110025740244540461---------48871334421526885135445785589889996630204


Q ss_pred             ---------------------CEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCC-CCCCCHHHHHHHHHHCCCCCE
Q ss_conf             ---------------------9089998478730246779877400233145201234-433210677888863187602
Q gi|254780263|r   70 ---------------------KRFYSHIDCPGHADYVKNMITGATQADGAILVCAAED-GPKPQTREHILLARQIGISSI  127 (392)
Q Consensus        70 ---------------------~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~-G~~~QT~eh~~l~~~lgi~~i  127 (392)
                                           -|++.|+|+|||.-.+.+|+.|++.+|+|+|+|++++ .++|||.||+.....+..+++
T Consensus       103 gS~k~d~~~c~~~g~~~~~klvRHVSfVDCPGHDiLMaTMLnGaAvmDaalLlIA~NEsCPQPQTsEHLaaveiM~Lkhi  182 (466)
T KOG0466         103 GSSKEDRPPCDRPGCEGKMKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAVEIMKLKHI  182 (466)
T ss_pred             CCCCCCCCCCCCCCCCCCEEEEEEEEECCCCCHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCEE
T ss_conf             78999999865689987458999877514796188998874326775433410104888989850667888778631418


Q ss_pred             EEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCC
Q ss_conf             33100233356122211012321001110145322102331146764114445652123320344310252222100001
Q gi|254780263|r  128 VVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAP  207 (392)
Q Consensus       128 Iv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p  207 (392)
                      ++..||+|++.+++..+.. +++.+|++.. ..+..|++|+||.          ..|+++.++|+|.+.+|.|.|+...|
T Consensus       183 iilQNKiDli~e~~A~eq~-e~I~kFi~~t-~ae~aPiiPisAQ----------lkyNId~v~eyivkkIPvPvRdf~s~  250 (466)
T KOG0466         183 IILQNKIDLIKESQALEQH-EQIQKFIQGT-VAEGAPIIPISAQ----------LKYNIDVVCEYIVKKIPVPVRDFTSP  250 (466)
T ss_pred             EEEECHHHHHHHHHHHHHH-HHHHHHHHCC-CCCCCCEEEEHHH----------HCCCHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             9982123354377889889-9999997456-5579952101364----------33676799999986189882014789


Q ss_pred             CCEECCCCCCC--CC------CCCCEEEEEEECCCCCCCEEEEEEC------C----CCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             10000000135--54------4543014874245348967999506------8----74321254121001211443210
Q gi|254780263|r  208 FLMHIEGSCGI--EG------RGTVVTGCIKRGRIKAGSDVEIIGM------G----GKKLKVKCTDVEMFRKKLDEAIA  269 (392)
Q Consensus       208 ~r~~I~~vf~i--~g------~G~Vv~GrV~sG~l~~Gd~i~i~p~------~----~~~~~~kv~si~~~~~~v~~a~a  269 (392)
                      .||.|-+.|.+  +|      .|.|+.|.+.+|.|++||++.+.|.      +    .....+++.|++..+.+++.|+|
T Consensus       251 prlIVIRSFDVNkPG~ev~~lkGgvaggsil~Gvlkvg~~IEiRPGiv~kd~~g~~~C~Pi~SrI~sL~AE~n~L~~AvP  330 (466)
T KOG0466         251 PRLIVIRSFDVNKPGSEVDDLKGGVAGGSILKGVLKVGQEIEIRPGIVTKDENGNIKCRPIFSRIVSLFAEQNDLQFAVP  330 (466)
T ss_pred             CCEEEEEEECCCCCCCHHHCCCCCCCCCHHHHHHHHCCCEEEECCCEEEECCCCCEEEEEHHHHHHHHHHHHCCCEEECC
T ss_conf             72899986236899841221457420305543242048588862761555589967875678877888753235024258


Q ss_pred             CHHHHHHHC---CCCCCEEECHHEEECCCCCC-CCEEEEEEEEEEECCCCCCCCC---------CCCCCEEEEEECCEEE
Q ss_conf             013666411---24543220211773267776-3000168999710567875555---------1159789999541477
Q gi|254780263|r  270 GDNVGLLLR---GVNRADVPRGRVVCAPGSIQ-EYSRFRASVYILTASEGGRTTG---------FMDNYRPQFFMDTADV  336 (392)
Q Consensus       270 Gd~v~l~Lk---gi~~~di~rGdvl~~~~~~~-~~~~f~A~i~il~~~~~~~~~~---------~~~~~~~~~~~~~~~v  336 (392)
                      |..+|+..+   .+...|-..|.||.+.+.++ ....++...++|....+.++.+         +..+-..++.+|+...
T Consensus       331 GGLIGVGT~~DPtlcraDrlVGqVlG~~G~LP~if~elei~y~Llrrllgvrt~~~~k~~kv~kL~k~E~lmvNIGS~sT  410 (466)
T KOG0466         331 GGLIGVGTKMDPTLCRADRLVGQVLGAVGTLPDIFTELEISYFLLRRLLGVRTKGDKKQAKVSKLVKNEILMVNIGSTST  410 (466)
T ss_pred             CCEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEEEHHHHHHHHCCCCCCCCCCCHHHHCCCCCEEEEEECCCCC
T ss_conf             85564125328540026678888875126776102677761555667762113564332013322668579998535655


Q ss_pred             EEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEE--EE--CCEEEEEEEEEE
Q ss_conf             799996189557078976999999778177546984999--98--996999899955
Q gi|254780263|r  337 TGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSM--RE--GGKTVGAGLILE  389 (392)
Q Consensus       337 ~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfil--Rd--~~~tig~G~I~~  389 (392)
                      -+|+.....         ..+++.|..|+|.+-+++++|  |-  .+|.||||.|.+
T Consensus       411 G~~v~~vk~---------d~~k~~Lt~P~CteigEkiAlSRrvekhWRLIGwg~I~~  458 (466)
T KOG0466         411 GGRVSAVKA---------DMAKIQLTSPVCTEIGEKIALSRRVEKHWRLIGWGQIKA  458 (466)
T ss_pred             CCEEEEEEC---------CEEEEEECCCHHCCCCHHHHHHHHHHHHEEEECCEEEEC
T ss_conf             736898833---------211368537122011112445566543307730036707


No 50 
>KOG0052 consensus
Probab=100.00  E-value=0  Score=326.56  Aligned_cols=325  Identities=31%  Similarity=0.464  Sum_probs=268.2

Q ss_pred             HCCCCEEEEEEEECCCCCHHHHHHHH--------HHHHHHHHHCC--------CCCCCCHHHHHCCCEEEEEEEEEECCC
Q ss_conf             10388279999904689887899999--------98764442001--------312686869862920637899982199
Q gi|254780263|r    7 VRNKESLGLSTIGHVDHGKTTLTAAI--------TKYYSEEKKEY--------GDIDSAPEEKLRGITIATAHVSYETDK   70 (392)
Q Consensus         7 ~~~k~~~ni~~iGhvd~GKSTL~~~L--------~~~~~~~~~~~--------~~~D~~~~E~~rGiTi~~~~~~~~~~~   70 (392)
                      .++|+|+|+.++||||+||||+.+-.        ..++.+++.+.        -.+|+++.|++||+||+.+...|++..
T Consensus         2 ~~~~~~~ni~~i~h~~s~~stt~~~~~g~id~~~~~k~~keaa~~~kgsf~~a~~~dk~~ae~~r~i~I~~~l~~~~t~k   81 (391)
T KOG0052           2 GKEKIHINIVVIGHVDSGKSTTTGYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSK   81 (391)
T ss_pred             CCCCCCCCEEEEEEEEEEEEEEEEEECCCCCCHHHHHHCHHHHHHCCCEEEEEEEECHHHHCCCCCEEEEEEEECCCCEE
T ss_conf             87765302589876322126898630366453013330667776356416655431111211146548999850433106


Q ss_pred             EEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC-------CCHHHHHHHHHHCCCCCEEEEECCCCCCCC---H
Q ss_conf             089998478730246779877400233145201234433-------210677888863187602331002333561---2
Q gi|254780263|r   71 RFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPK-------PQTREHILLARQIGISSIVVYMNKVDAVDD---D  140 (392)
Q Consensus        71 ~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~-------~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~---~  140 (392)
                      +.++++|+|||.||.+||++|.++||.|+|.|+|..|.+       +||+||++++..+|++++|+++||||...+   +
T Consensus        82 ~~i~iid~pgh~d~~k~mitg~sqaD~avliva~~~gefEagiskngqt~ehalla~tlgv~qliv~v~k~D~~~~~~s~  161 (391)
T KOG0052          82 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE  161 (391)
T ss_pred             EEEEEECCCCCCCEEEEEEEEEEEECCEEEEEEEECCCEEEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCC
T ss_conf             77998537788742146876687623058999750353355203351144565553103531456776034336887334


Q ss_pred             HHHHHCCCCCCEEEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCC
Q ss_conf             22110123210011101453221023311467641144456521233203443102522221000011000000013554
Q gi|254780263|r  141 ELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEG  220 (392)
Q Consensus       141 ~~~~~i~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g  220 (392)
                      .++.++..+.+...+..+++...  +                                             .+++|++.|
T Consensus       162 ~r~~ei~k~~~~~~~~~g~n~~~--~---------------------------------------------~~~~~~~~g  194 (391)
T KOG0052         162 ARYEEIKKEVSSYIKKIGYNPAA--V---------------------------------------------LQDVYKIGG  194 (391)
T ss_pred             CCHHHHEEEEEEEEEECCCCCHH--H---------------------------------------------HCCCCEECC
T ss_conf             63231002210122003557635--5---------------------------------------------216303311


Q ss_pred             CCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCC--CCC
Q ss_conf             454301487424534896799950687432125412100121144321001366641124543220211773267--776
Q gi|254780263|r  221 RGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPG--SIQ  298 (392)
Q Consensus       221 ~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~--~~~  298 (392)
                      .|      +..|.++.++.+...|..   .+.++.+.+++++.-+++.+|++++++.+|+...++.+|+++.+..  ++.
T Consensus       195 ~~------~~t~iie~~~~v~~~~~~---~~~~vk~~~~~~~a~s~~~p~~~vG~~~~~v~v~~i~~gnV~~dsK~~p~~  265 (391)
T KOG0052         195 IG------VETGISEPGMDVTFAPSG---VTTEVKSVKVHHEAGSEDLPGDNVGFNVKNVSVKDIDRGNVVGDSKNDPPV  265 (391)
T ss_pred             EE------EECEECCCCCCEECCCCC---CCCCCCCEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCCEECCCCCCCCC
T ss_conf             11------100002475420136656---544124588883157777886266454036666652134243233567753


Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEE-------------CCCHHHHCCCCEEEEEEEECCCE
Q ss_conf             30001689997105678755551159789999541477799996-------------18955707897699999977817
Q gi|254780263|r  299 EYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIIL-------------SPGSQAVMPGDRVDLEVELIYPI  365 (392)
Q Consensus       299 ~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~-------------~~~~~~i~~g~~~~v~l~l~~pi  365 (392)
                      ....|.||+++|+     |+..+..+|.|.+.|++.+++||+..             +..++++++++.+.+...+.+|+
T Consensus       266 ~~~g~t~qviiln-----hpgqis~gy~pvldcht~hiacKfael~~Kid~~sg~~~e~~pk~~~~~daai~~~vp~kp~  340 (391)
T KOG0052         266 EAAGFTAQVIILN-----HPGQISVGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDEPKFLKSGDAAIVEMVPGKPL  340 (391)
T ss_pred             CCCCCCEEEEEEC-----CCCCCCCCCCCCCCCCCCCEEEEECCCCHHEECCCCCEECCCCCCCCCCCCEEEEECCCCCC
T ss_conf             2366402479943-----75544788535123644531566012431001257622137875245776304663157864


Q ss_pred             EECCC------CEEEEEECCEEEEEEEEEEEEC
Q ss_conf             75469------8499998996999899955319
Q gi|254780263|r  366 AMEPN------QTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       366 ~~e~~------~rfilRd~~~tig~G~I~~v~e  392 (392)
                      |+|.+      +||.+||+.+|+|.|.|..+.+
T Consensus       341 ~ve~~~~~~~l~rfav~d~~~tvavgvikav~k  373 (391)
T KOG0052         341 CVESFSDYVPLGRFAVRDMRQTVAVGVIKAVDK  373 (391)
T ss_pred             CCCCCCCCCCCCCHHHHHHHCCCCCCCEEEEEE
T ss_conf             002544346655432212211235660243241


No 51 
>TIGR00484 EF-G translation elongation factor G; InterPro: IPR004540   Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution.   EF-G is a large, five-domain GTPase that promotes the directional movement of mRNA and tRNAs on the ribosome in a GTP-dependent manner. Unlike other GTPases, but by analogy to the myosin motor, EF-G performs its function of powering translocation in the GDP-bound form; that is, in a kinetically stable ribosome-EF-G(GDP) complex formed by GTP hydrolysis on the ribosome. The complex undergoes an extensive structural rearrangement, in particular affecting the small ribosomal subunit, which leads to mRNA-tRNA movement. Domain 4, which extends from the 'body' of the EF-G molecule much like a lever arm, appears to be essential for the structural transition to take place. In a hypothetical model, GTP hydrolysis induces a conformational change in the G domain of EF-G, which affects the interactions with neighbouring domains within EF-G. The resulting rearrangement of the domains relative to each other generates conformational strain in the ribosome to which EF-G is fixed. Because of structural features of the tRNA-ribosome complex, this conformational strain results in directional tRNA-mRNA movement. The functional parallels between EF-G and motor proteins suggest that EF-G differs from classical G-proteins in that it functions as a force-generating mechanochemical device rather than a conformational switch .   Every completed bacterial genome has at least one copy, but some species have additional EF-G-like proteins. The closest homolog to canonical (e.g. Escherichia coli) EF-G in the spirochetes clusters as if it is derived from mitochondrial forms, while a more distant second copy is also present. Synechocystis sp. (strain PCC 6803) has a few proteins more closely related to EF-G than to any other characterised protein. Two of these resemble E. coli EF-G more closely than does the best match from the spirochetes; it may be that both function as authentic EF-G.   More information about these proteins can be found at Protein of the Month: Elongation Factors . ; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005622 intracellular.
Probab=100.00  E-value=0  Score=323.01  Aligned_cols=268  Identities=25%  Similarity=0.322  Sum_probs=201.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHH------HHHHHHH--HCCCCCCCCHHHHHCCCEEEEEEEEEECCC------EEEEEEEC
Q ss_conf             799999046898878999999------8764442--001312686869862920637899982199------08999847
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAIT------KYYSEEK--KEYGDIDSAPEEKLRGITIATAHVSYETDK------RFYSHIDC   78 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~------~~~~~~~--~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~------~~i~iiD~   78 (392)
                      -||+|.+|+||||||+++|++      ++.+...  .+.+.|||++.||||||||.++.+..+|++      +.+|||||
T Consensus        11 RNiGI~AHIDaGKTT~~ERILFy~g~~HkIgE~~g~dG~a~MDwME~E~ERGITItSAAT~~~Wk~~~~~~~~~~N~IDT   90 (705)
T TIGR00484        11 RNIGISAHIDAGKTTTTERILFYTGRIHKIGEVHGKDGAATMDWMEQEKERGITITSAATTVEWKGMAKQYDHRINIIDT   90 (705)
T ss_pred             CCCCEEEEECCCCCCCHHEEEECCCCCCCEEECCCCCCCEECCHHHHCCCCCEEEECHHCCHHHHHHHHCCCCEEEEEEC
T ss_conf             55432786338873201010001375010000016788511231230035871421001101021010001403788737


Q ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEE
Q ss_conf             87302467798774002331452012344332106778888631876023310023335612221101232100111014
Q gi|254780263|r   79 PGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHK  158 (392)
Q Consensus        79 PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~  158 (392)
                      |||.||+-++.|+++..|+|++|.||..|++|||...+..+..++||+++ +|||||++..+  |..+..+++.-|....
T Consensus        91 PGHVDFT~EVERSlRVLDGAv~V~~a~~GV~pQ~~TVwRQa~~Y~VPRi~-FVNK~Dk~GAn--f~~~~~~~~~rL~~~~  167 (705)
T TIGR00484        91 PGHVDFTVEVERSLRVLDGAVAVLDAVGGVQPQSETVWRQANKYEVPRIV-FVNKMDKTGAN--FLRVVNQLKSRLGANA  167 (705)
T ss_pred             CCCEEEEEEEEEHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCEEE-EEECCCCCCCC--HHHHHHHHHHHHCCCC
T ss_conf             89412578852012256456653330268664115677654326886289-97155645787--8899999998746773


Q ss_pred             E-------------------------------------------------------------------------------
Q ss_conf             5-------------------------------------------------------------------------------
Q gi|254780263|r  159 Y-------------------------------------------------------------------------------  159 (392)
Q Consensus       159 ~-------------------------------------------------------------------------------  159 (392)
                      .                                                                               
T Consensus       168 ~~~qlpiGaE~~f~GviDLv~~ka~~~~~~~~g~~~~~~~iP~~~~~~~~~~~~~l~e~~a~~~~~LM~~yl~G~e~~~~  247 (705)
T TIGR00484       168 VPIQLPIGAEDKFIGVIDLVEMKAYFFEEGDKGTKIDEKEIPSDLLEQAKELRENLVEAVAELDEELMEKYLEGEELTIE  247 (705)
T ss_pred             EEEEECCCCCCCCCEEEEEEEEEEEEECCCCCCCEEHHHCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCCCHH
T ss_conf             46641125665631045543015677506776640012226478999999999999998842007889985089653689


Q ss_pred             -----------EEE-EECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCC--------------------CCCCC
Q ss_conf             -----------322-1023311467641144456521233203443102522221--------------------00001
Q gi|254780263|r  160 -----------SDD-TPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQR--------------------SLDAP  207 (392)
Q Consensus       160 -----------~~~-~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~--------------------~~~~p  207 (392)
                                 +.+ +|++..||+.          ..++..|||++.+|+|.|..                    +.+.|
T Consensus       248 ~ik~~~r~g~l~~~~~pv~~GSafK----------NKGv~~lLDAV~~yLP~P~dv~~~~~~~~~~~~~e~~~~~sd~~~  317 (705)
T TIGR00484       248 EIKNAIRKGVLNLELIPVLCGSAFK----------NKGVQLLLDAVVDYLPSPTDVPAIKGIDPDTNEEEIELKASDEEP  317 (705)
T ss_pred             HHHHHHHCCEEEEEEEEEEECCCCH----------HHHHHHHHHHHHHHCCCCCCHHHHHCCCCCCCCCCEEEEECCCCC
T ss_conf             9988875131124688887503300----------025888999999747897431543023556677613675156765


Q ss_pred             CCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCC-CCCCCCCCCCHHHHHHHCCCCCCEEE
Q ss_conf             10000000135544543014874245348967999506874321254121001-21144321001366641124543220
Q gi|254780263|r  208 FLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMF-RKKLDEAIAGDNVGLLLRGVNRADVP  286 (392)
Q Consensus       208 ~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~-~~~v~~a~aGd~v~l~Lkgi~~~di~  286 (392)
                      |.-.-+.+...+++|...+-||++|.|+.|+.+.....+.+....++.+.+.. ++++++..|||++|+    +..+|..
T Consensus       318 f~~LAFK~~tdpfvG~LTf~RvY~G~l~~G~~v~Ns~~~k~ervgRl~~MHa~~re~I~~~~aGdI~A~----~Glkd~~  393 (705)
T TIGR00484       318 FVALAFKVATDPFVGQLTFVRVYSGVLKSGSYVKNSRKSKKERVGRLVKMHANKREEIKEVRAGDIAAA----IGLKDTT  393 (705)
T ss_pred             CEEEEEEECCCCCCCEEEEEEEEEEEECCCCEEEECHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEE----ECCEECC
T ss_conf             122345640587311278999976151279777602000014432333100377210012135636887----3130025


Q ss_pred             CHHEEECCCCC
Q ss_conf             21177326777
Q gi|254780263|r  287 RGRVVCAPGSI  297 (392)
Q Consensus       287 rGdvl~~~~~~  297 (392)
                      +||+||+++..
T Consensus       394 TGdTl~d~~~~  404 (705)
T TIGR00484       394 TGDTLCDEKAD  404 (705)
T ss_pred             CCCCCCCCCCC
T ss_conf             67632256420


No 52 
>cd00881 GTP_translation_factor GTP translation factor family.  This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation.  In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function.
Probab=100.00  E-value=0  Score=313.88  Aligned_cols=175  Identities=39%  Similarity=0.637  Sum_probs=147.0

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHH----CCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             9999904689887899999987644420----013126868698629206378999821990899984787302467798
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKK----EYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~----~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      ||+++||+|||||||+++|++..+....    ....+|..++||+||+||++++..|+|++++|||||||||++|+++|+
T Consensus         1 Nv~iiGh~d~GKTTL~~~Ll~~~~~~~~~~~~~~~~~d~~~~E~~rgiTi~~~~~~~~~~~~~i~~iDTPGh~~f~~~~~   80 (189)
T cd00881           1 NVGIAGHVDHGKTTLTERLLYVTGDIERDGTVEETFLDVLKEERERGITIKSGVATFEWPDRRVNFIDTPGHEDFSSEVI   80 (189)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHCCCEEEEEEEEEEECCEEEEEEECCCCHHHHHHHH
T ss_conf             98999179989999999999764723568625888505777888638413222799998998999996998188999999


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE----------
Q ss_conf             7740023314520123443321067788886318760233100233356122211012321001110145----------
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY----------  159 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~----------  159 (392)
                      +|++.+|+|||||||.+|+++||++|+.+++..++| +||||||||++++++ ++++..++++.|...++          
T Consensus        81 ~~l~~aD~ailvVda~~G~~~qt~~~~~~~~~~~~p-~iv~iNKiD~~~~~~-~~~~~~ei~~~l~~~~~~~~~~~~~~~  158 (189)
T cd00881          81 RGLSVSDGAILVVDANEGVQPQTREHLRIAREGGLP-IIVAINKIDRVGEED-LEEVLREIKELLGLIGFISTKEEGTRN  158 (189)
T ss_pred             HHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCHHH-HHHHHHHHHHHHHHHCCHHHHHHCCCC
T ss_conf             998646856999987989987899999999976998-799998971877562-999999999998753210232110125


Q ss_pred             EEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCC
Q ss_conf             32210233114676411444565212332034431025222
Q gi|254780263|r  160 SDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTP  200 (392)
Q Consensus       160 ~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p  200 (392)
                      ...+|++|+||++|.          ++..|++++.+++|+|
T Consensus       159 ~~~~piv~iSA~~G~----------gv~~Lld~i~~~lP~p  189 (189)
T cd00881         159 GLLVPIVPGSALTGI----------GVEELLEAIVEHLPPP  189 (189)
T ss_pred             CCCCEEEEEECCCCC----------CHHHHHHHHHHHCCCC
T ss_conf             887759998886786----------9799999999768799


No 53 
>PRK12312 infB translation initiation factor IF-2; Provisional
Probab=100.00  E-value=2.8e-45  Score=299.43  Aligned_cols=238  Identities=29%  Similarity=0.382  Sum_probs=183.0

Q ss_pred             HCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHH
Q ss_conf             10388279999904689887899999987644420013126868698629206378999821990899984787302467
Q gi|254780263|r    7 VRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVK   86 (392)
Q Consensus         7 ~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~   86 (392)
                      .+++|.+ +.++||||||||||++.|-+. .-...+           .-|||...+....++++..|+|||||||+-|..
T Consensus       113 l~~R~Pv-VtimGHVDHGKTsLLD~iR~t-~V~~~E-----------aGGITQhIGA~~v~~~~~~itFiDTPGHeAFt~  179 (610)
T PRK12312        113 LEKRPPI-VTIMGHVDHGKTTLLDTIRKT-NVVASE-----------AGGITQHIGAYQVEYQGKKITFIDTPGHEAFTE  179 (610)
T ss_pred             CCCCCCE-EEEECCCCCCHHHHHHHHHCC-CCCCCC-----------CCCCCCEECEEEEEECCCEEEEECCCCHHHHHH
T ss_conf             6788998-999677257722588998548-641346-----------776644004499986797689972896798999


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEE-EEEEEEEEEEEC
Q ss_conf             7987740023314520123443321067788886318760233100233356122211012321001-110145322102
Q gi|254780263|r   87 NMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDL-LKEHKYSDDTPI  165 (392)
Q Consensus        87 ~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~-l~~~~~~~~~pi  165 (392)
                      =-.||++.+|.|+|||||++|++|||.|.+.+++..++| ||||+||||+.+.+  .+.++.++.++ +..-.|..++++
T Consensus       180 mR~RGa~vtDI~iLVVaaddGv~pQTiEaI~~ak~a~vp-iiVAiNKiDkp~a~--~~~v~~~L~~~g~~~E~~GGdv~~  256 (610)
T PRK12312        180 MRARGAKVTDIVILVVAADDGVKPQTEEAIDHAKAANVP-IIVFVNKMDKPNAN--PDRIKNELSKYDLVPEEWGGDTPF  256 (610)
T ss_pred             HHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCC--HHHHHHHHHHHCCCHHHHCCCCEE
T ss_conf             997077654579999975789774269999999975998-89985044678898--789999998707667885794459


Q ss_pred             CCCEEEEEEECCCCCCCCCCCCCHHHHHHCCC--CCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEE
Q ss_conf             33114676411444565212332034431025--2222100001100000001355445430148742453489679995
Q gi|254780263|r  166 IRGSALCALQGTNKELGEDSIHALMKAVDTHI--PTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEII  243 (392)
Q Consensus       166 i~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~--~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~  243 (392)
                      +|+||.+|.          +++.||++|.-..  .....+.+.|.+-.|-++...+|.|.+++--|.+|+|++||.+...
T Consensus       257 V~iSAktg~----------GId~LLe~IlL~AE~leLka~~~~~a~G~VIEsk~dkg~G~vatviVq~GtLk~GD~iV~G  326 (610)
T PRK12312        257 VYGSALKNE----------GIDELLDSILLLAEILNLKANPNRLAIGTVIEAKLDKGKGPVATLIVQNGTLKVGDFIVAG  326 (610)
T ss_pred             EEEECCCCC----------CHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCCCCCEEEEEEECCEEECCCEEEEC
T ss_conf             990368798----------9999999999999987652278986069999978616876368999835878159989989


Q ss_pred             ECCCCCCCEEEECCCCC-CCCCCCCCCCHHHHH
Q ss_conf             06874321254121001-211443210013666
Q gi|254780263|r  244 GMGGKKLKVKCTDVEMF-RKKLDEAIAGDNVGL  275 (392)
Q Consensus       244 p~~~~~~~~kv~si~~~-~~~v~~a~aGd~v~l  275 (392)
                      +.     ..+|+++... ++++++|.|+..|-+
T Consensus       327 ~~-----~GkVRam~d~~g~~lk~A~PS~pV~I  354 (610)
T PRK12312        327 ST-----YGKIRSMEDENGKKLKKALPSTPVKV  354 (610)
T ss_pred             CC-----CCCCCEEECCCCCCCCCCCCCCCEEE
T ss_conf             86-----68621577367861434179985798


No 54 
>cd01890 LepA LepA subfamily.  LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome.  LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea.  This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont.  Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype.
Probab=100.00  E-value=2.8e-45  Score=299.96  Aligned_cols=170  Identities=29%  Similarity=0.446  Sum_probs=140.3

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHH---HHHCCCCCCCCHHHHHCCCEEEEEEEEEECC-----CEEEEEEECCCCHHHH
Q ss_conf             9999904689887899999987644---4200131268686986292063789998219-----9089998478730246
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSE---EKKEYGDIDSAPEEKLRGITIATAHVSYETD-----KRFYSHIDCPGHADYV   85 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~---~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~-----~~~i~iiD~PGH~~f~   85 (392)
                      ||+++||+|||||||+++|+...+.   .......+|++++|++|||||+++...+.|.     .+.+||||||||.||.
T Consensus         2 NiaiiGHvd~GKTTL~~~ll~~tg~i~~~~~~~~~~D~~~~E~eRgiTi~~~~~~~~~~~~~~~~~~in~iDtPGh~dF~   81 (179)
T cd01890           2 NFSIIAHIDHGKSTLADRLLELTGTVSKREMKEQVLDSMDLERERGITIKAQTVRLNYKAKDGQEYLLNLIDTPGHVDFS   81 (179)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEECCCCHHHHHCCCEEEEEEEEEEEECCCCCCEEEEEEECCCCCCCH
T ss_conf             59999489989899999999985995414573244165176786386687433688841367871489999899864517


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEEC
Q ss_conf             77987740023314520123443321067788886318760233100233356122211012321001110145322102
Q gi|254780263|r   86 KNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPI  165 (392)
Q Consensus        86 ~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pi  165 (392)
                      ++|++|++.+|+|||||||.+|+++||++|+.++..+|+| +|+++||||+.+++  ++.+.+++++.+.   +. ..++
T Consensus        82 ~~~~~al~~~D~allVVda~~Gv~~qT~~~~~~a~~~~~p-~ivviNKiD~~~ad--~~~v~~~i~~~~g---~~-~~~~  154 (179)
T cd01890          82 YEVSRSLAACEGALLLVDATQGVEAQTLANFYLALENNLE-IIPVINKIDLPSAD--PERVKQQIEDVLG---LD-PSEA  154 (179)
T ss_pred             HHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCC--HHHHHHHHHHHHC---CC-CCCE
T ss_conf             7898899754427899864778737489999999876998-89998655567789--9999999999868---89-7674


Q ss_pred             CCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCC
Q ss_conf             33114676411444565212332034431025222
Q gi|254780263|r  166 IRGSALCALQGTNKELGEDSIHALMKAVDTHIPTP  200 (392)
Q Consensus       166 i~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p  200 (392)
                      +|+||.+|.          ++..|+++|.+.+|+|
T Consensus       155 v~vSA~~g~----------gv~~Ll~~i~~~ip~p  179 (179)
T cd01890         155 ILVSAKTGL----------GVEDLLEAIVERIPPP  179 (179)
T ss_pred             EEEECCCCC----------CHHHHHHHHHHHCCCC
T ss_conf             884378897----------9899999999648898


No 55 
>CHL00189 infB translation initiation factor 2; Provisional
Probab=100.00  E-value=1.3e-44  Score=295.82  Aligned_cols=250  Identities=28%  Similarity=0.326  Sum_probs=185.4

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC----CCEEEEEEECCCCHH
Q ss_conf             0388279999904689887899999987644420013126868698629206378999821----990899984787302
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET----DKRFYSHIDCPGHAD   83 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~----~~~~i~iiD~PGH~~   83 (392)
                      .++|.+ +.|+||||||||||++.|-. ..-...+           .-|||..++....++    +++.|||||||||+-
T Consensus       269 ~~RpPV-VTIMGHVDHGKTsLLD~iR~-t~Va~~E-----------aGGITQhIGAy~V~~~~~~~~~~ITFlDTPGHeA  335 (770)
T CHL00189        269 IRRPPI-VTILGHVDHGKTTLLDAIRK-TNIAQKE-----------AGGITQKIGAYEVEVPYKDQNQKIVFLDTPGHEA  335 (770)
T ss_pred             CCCCCE-EEEECCCCCCHHHHHHHHHC-CCCCCCC-----------CCCCCCEECEEEEEECCCCCCCEEEEECCCCHHH
T ss_conf             778998-99857725772037888852-8851345-----------6765550352999751578897589955994688


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEE-EEEEEEEEE
Q ss_conf             4677987740023314520123443321067788886318760233100233356122211012321001-110145322
Q gi|254780263|r   84 YVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDL-LKEHKYSDD  162 (392)
Q Consensus        84 f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~-l~~~~~~~~  162 (392)
                      |..=-.||+...|.++|||+|++|++|||.|.+..|++.++| |||||||||..+.+  .+.++.++.++ +..-.|.++
T Consensus       336 Ft~MRaRGA~vTDIvILVVAADDGVmPQTiEAI~hakaA~VP-iIVAINKiDkp~an--~~rVk~eL~e~gli~EewGGd  412 (770)
T CHL00189        336 FSSMRSRGANVTDIAILIVAADDGVKPQTIEAINHIQAANVP-IIVAINKIDKENAN--IDRVKQELSKYNLISEKWGGQ  412 (770)
T ss_pred             HHHHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCC--HHHHHHHHHHCCCCHHHCCCC
T ss_conf             999986278666679999965788567279999999876998-89998774589988--578999999869552223795


Q ss_pred             EECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCC--CCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEE
Q ss_conf             102331146764114445652123320344310252--222100001100000001355445430148742453489679
Q gi|254780263|r  163 TPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIP--TPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDV  240 (392)
Q Consensus       163 ~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~--~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i  240 (392)
                      ++++++||.+|.          +++.|||+|.-.-.  .-..+.+.|.+-.|-++...+|+|.|++--|.+|+|++||.+
T Consensus       413 ~~~V~ISAktg~----------gId~LLE~IlL~AEvlELkAnp~~~A~GvVIES~ldkgrG~VATvLVQ~GTLkvGD~i  482 (770)
T CHL00189        413 TPMIPISALQGT----------NIDKLLEMILLLAEIENLQADPTQLAQGTILEAHLDKTKGPVATLLVQNGTLRIGDII  482 (770)
T ss_pred             EEEEEEEECCCC----------CHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCCCEEEEEEECCEECCCCEE
T ss_conf             599996616798----------8799999999998787523688986149999976516867768999954844039999


Q ss_pred             EEEECCCCCCCEEEECCCCC-CCCCCCCCCCHHHHH-HHCCCCCCEEECHHEEE
Q ss_conf             99506874321254121001-211443210013666-41124543220211773
Q gi|254780263|r  241 EIIGMGGKKLKVKCTDVEMF-RKKLDEAIAGDNVGL-LLRGVNRADVPRGRVVC  292 (392)
Q Consensus       241 ~i~p~~~~~~~~kv~si~~~-~~~v~~a~aGd~v~l-~Lkgi~~~di~rGdvl~  292 (392)
                      ....     ...||+++..+ ++.+++|.|+..|-+ .|+++.    ..||.+.
T Consensus       483 VaG~-----~~GKVRaM~Dd~Gk~vkeA~PS~PVeIlGl~~vP----~AGD~f~  527 (770)
T CHL00189        483 VAGT-----SLGKIRGMINSAGNKINEAGPSSPVEIWGLSSVP----ATGEYFQ  527 (770)
T ss_pred             EECC-----CEEEEEEEECCCCCCCCCCCCCCCEEEECCCCCC----CCCCEEE
T ss_conf             9836-----3447889889999844554899868987787898----7798899


No 56 
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=2.1e-44  Score=294.42  Aligned_cols=273  Identities=25%  Similarity=0.363  Sum_probs=197.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHH----------HHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHH
Q ss_conf             9999904689887899999987----------644420013126868698629206378999821990899984787302
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKY----------YSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHAD   83 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~----------~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~   83 (392)
                      ++|||.|.|||||||+..|+-.          .++.....++.||++-||+|||+|.++..+|+|+++.+||+|||||+|
T Consensus        14 TFAIISHPDAGKTTlTEkLLlfGgaIq~AGtVk~rk~~~~a~SDWM~iEkqRGISVtsSVMqF~Y~~~~iNLLDTPGHeD   93 (528)
T COG4108          14 TFAIISHPDAGKTTLTEKLLLFGGAIQEAGTVKGRKSGKHAKSDWMEIEKQRGISVTSSVMQFDYADCLVNLLDTPGHED   93 (528)
T ss_pred             CEEEEECCCCCCCCHHHHHHHHCCHHHHCCEEEECCCCCCCCCHHHHHHHHCCCEEEEEEEEEECCCEEEECCCCCCCCC
T ss_conf             03688568888511889999723034305501222577634227788887568558765787603884886147998654


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCC--HHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             46779877400233145201234433210677888863187602331002333561--2221101232100111014532
Q gi|254780263|r   84 YVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDD--DELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        84 f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~--~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      |.-.+.|-+..+|+|++||||.+|+++||+.-+..|++-++| |+-+|||||+..-  =|+.+++++++.--    .+.-
T Consensus        94 FSEDTYRtLtAvDsAvMVIDaAKGiE~qT~KLfeVcrlR~iP-I~TFiNKlDR~~rdP~ELLdEiE~~L~i~----~~Pi  168 (528)
T COG4108          94 FSEDTYRTLTAVDSAVMVIDAAKGIEPQTLKLFEVCRLRDIP-IFTFINKLDREGRDPLELLDEIEEELGIQ----CAPI  168 (528)
T ss_pred             CCHHHHHHHHHHHEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCHHHHHHHHHHHHCCC----EECC
T ss_conf             323678999864104689860358668899999998505984-69975023656688689999999985775----0355


Q ss_pred             EEECCCCEEEE----------------------------EEE--------CCC---------------------------
Q ss_conf             21023311467----------------------------641--------144---------------------------
Q gi|254780263|r  162 DTPIIRGSALC----------------------------ALQ--------GTN---------------------------  178 (392)
Q Consensus       162 ~~pii~~sa~~----------------------------g~~--------~~n---------------------------  178 (392)
                      .+||=..-.+.                            ++.        +.+                           
T Consensus       169 tWPIG~gk~F~Gvy~l~~~~v~~y~~~~~~~~~~~~~~~~~~~p~~~~~l~~~~~~~~~ee~EL~~~a~~~Fd~~~fl~G  248 (528)
T COG4108         169 TWPIGMGKDFKGVYHLYNDEVELYESGHTDQERRADIVKGLDNPELDALLGEDLAEQLREELELVQGAGNEFDLEAFLAG  248 (528)
T ss_pred             CCCCCCCCCCCEEEEECCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCHHHHHCC
T ss_conf             24456885643223503587998426777654434444578886777762447999999999999741332088988569


Q ss_pred             --------CCCCCCCCCCHHHHHHCCCCCCCC-CCC-----------CCCCEECCCCCCCCCCCCCEEEEEEECCCCCCC
Q ss_conf             --------456521233203443102522221-000-----------011000000013554454301487424534896
Q gi|254780263|r  179 --------KELGEDSIHALMKAVDTHIPTPQR-SLD-----------APFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGS  238 (392)
Q Consensus       179 --------~~~~~~~~~~Ll~~i~~~~~~p~~-~~~-----------~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd  238 (392)
                              .-+..++...+|+++..+-|+|.. ..+           ..|.|-||.-...+.+-++++-||.||.+..|+
T Consensus       249 ~~TPVFFGSAl~NFGV~~~L~~~~~~AP~P~~r~~~~~~v~p~e~kfsGFVFKIQANMDp~HRDRIAFmRV~SGkferGM  328 (528)
T COG4108         249 ELTPVFFGSALGNFGVDHFLDALVDWAPSPRARQADTREVEPTEDKFSGFVFKIQANMDPKHRDRIAFMRVCSGKFERGM  328 (528)
T ss_pred             CCCCEEEHHHHHCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCEEEEEECCCCCCCCC
T ss_conf             60115703323115889999999963899865446667316887754348999974899433420367863056435886


Q ss_pred             EEEEEECCCCCCCEEEECCCC-CCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCC
Q ss_conf             799950687432125412100-121144321001366641124543220211773267
Q gi|254780263|r  239 DVEIIGMGGKKLKVKCTDVEM-FRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPG  295 (392)
Q Consensus       239 ~i~i~p~~~~~~~~kv~si~~-~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~  295 (392)
                      ++.....++....+....... .|+.+++|+|||+||+.    +.-.++.||+++...
T Consensus       329 k~~~~rtgK~~~ls~~~~f~A~dRe~ve~A~aGDIIGl~----nhGt~~IGDT~t~Ge  382 (528)
T COG4108         329 KVTHVRTGKDVKLSDALTFMAQDRETVEEAYAGDIIGLH----NHGTIQIGDTFTEGE  382 (528)
T ss_pred             EEEEEECCCCEEECCCHHHHHHHHHHHHHCCCCCEEECC----CCCCEEECCEECCCC
T ss_conf             533024487256161076764216657542687767146----787213266631585


No 57 
>pfam00009 GTP_EFTU Elongation factor Tu GTP binding domain. This domain contains a P-loop motif, also found in several other families such as pfam00071, pfam00025 and pfam00063. Elongation factor Tu consists of three structural domains, this plus two C-terminal beta barrel domains.
Probab=100.00  E-value=2.7e-44  Score=293.78  Aligned_cols=178  Identities=49%  Similarity=0.751  Sum_probs=147.3

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHH-----HCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHH
Q ss_conf             8827999990468988789999998764442-----00131268686986292063789998219908999847873024
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEK-----KEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADY   84 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~-----~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f   84 (392)
                      |++.||+++||+|||||||+++|++..+...     .....+|+.++||+||+||++++..|+|+++.|+|+|||||.+|
T Consensus         1 ~~~rnVaivG~~n~GKSTL~n~Ll~~~~~i~~~~~~~~~~~~d~~~~E~~rgiTi~~~~~~~~~~~~~i~~iDtPGh~~f   80 (185)
T pfam00009         1 KRHRNIGIIGHVDHGKTTLTDALLYVTGAIDKRGEVKQEGELDRLKEERERGITIKIAAVSFETKKRHINIIDTPGHVDF   80 (185)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHCCEEEEEEEEEEEECCCEEEEEECCCCCCH
T ss_conf             99678999938994499999999715487654643100333365588885782698769999608936899989987143


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCC-EEEEEEEEEE-E
Q ss_conf             6779877400233145201234433210677888863187602331002333561222110123210-0111014532-2
Q gi|254780263|r   85 VKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIR-DLLKEHKYSD-D  162 (392)
Q Consensus        85 ~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~-~~l~~~~~~~-~  162 (392)
                      +++|++|++.+|+|+|||||.+|+++||++|+.++..+|+| +|+|+||||+++.+++.+ +..++. .+++...+.. .
T Consensus        81 ~~~~~~~l~~aD~~vlVvda~~G~~~qt~~~~~~~~~~~~p-~iv~vNKiD~v~~~~~~~-~~~e~~~~ll~~~~~~~~~  158 (185)
T pfam00009        81 TKEMIRGAAQADGAILVVDAVEGVMPQTREHLLLAKQLGVP-IIVFINKMDRVDDAELDE-VVEEISRELLEKYGFGGET  158 (185)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCC-EEEEEECCCCCCHHHHHH-HHHHHHHHHHHHHHCCCCC
T ss_conf             99999998646564299986768532309999999982898-799997732777676999-9999999988873248998


Q ss_pred             EECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCC
Q ss_conf             1023311467641144456521233203443102522
Q gi|254780263|r  163 TPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPT  199 (392)
Q Consensus       163 ~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~  199 (392)
                      .|++|+||++|.          +++.|+++|..++|.
T Consensus       159 ~pivpiSA~~G~----------gv~~Ll~~i~~~lP~  185 (185)
T pfam00009       159 IPVIPGSALTGE----------GIDTLLEALDLYLPS  185 (185)
T ss_pred             CEEEEEECCCCC----------CHHHHHHHHHHHCCC
T ss_conf             869996789997----------989999999977859


No 58 
>KOG0465 consensus
Probab=100.00  E-value=1.3e-44  Score=295.89  Aligned_cols=264  Identities=25%  Similarity=0.367  Sum_probs=189.3

Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHH------HHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHH
Q ss_conf             27999990468988789999998764------442001312686869862920637899982199089998478730246
Q gi|254780263|r   12 SLGLSTIGHVDHGKTTLTAAITKYYS------EEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYV   85 (392)
Q Consensus        12 ~~ni~~iGhvd~GKSTL~~~L~~~~~------~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~   85 (392)
                      .-||++++|.|+|||||+.+.+.+.+      ........||+++.||+|||||.++..++.|.+++|||||||||.||+
T Consensus        39 ~RNIgi~AhidsgKTT~tEr~Lyy~G~~~~i~ev~~~~a~md~m~~er~rgITiqSAAt~~~w~~~~iNiIDTPGHvDFT  118 (721)
T KOG0465          39 IRNIGISAHIDAGKTTLTERMLYYTGRIKHIGEVRGGGATMDSMELERQRGITIQSAATYFTWRDYRINIIDTPGHVDFT  118 (721)
T ss_pred             HCCCCEEEEEECCCCEEEHEEEEECCEEEECCCCCCCCEEEEHHHHHHHCCCEEEECEEEEEECCCEEEEECCCCCEEEE
T ss_conf             10031699982698511020013022010023202676046427778653844641215664045206785489721579


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH--HHHHHCCCCCC------------
Q ss_conf             7798774002331452012344332106778888631876023310023335612--22110123210------------
Q gi|254780263|r   86 KNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDD--ELLDISEYEIR------------  151 (392)
Q Consensus        86 ~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~--~~~~~i~~~i~------------  151 (392)
                      -++.|++...|+|++|+||..|++.||...+..++.+++|+ |++|||||+...+  ...+.+...+.            
T Consensus       119 ~EVeRALrVlDGaVlvl~aV~GVqsQt~tV~rQ~~ry~vP~-i~FiNKmDRmGa~~~~~l~~i~~kl~~~~a~vqiPig~  197 (721)
T KOG0465         119 FEVERALRVLDGAVLVLDAVAGVESQTETVWRQMKRYNVPR-ICFINKMDRMGASPFRTLNQIRTKLNHKPAVVQIPIGS  197 (721)
T ss_pred             EEEHHHHHHCCCEEEEEECCCCEEHHHHHHHHHHHHCCCCE-EEEEEHHHHCCCCHHHHHHHHHHHCCCCHHEEECCCCC
T ss_conf             77200252056728999703651113568988887618975-99986166447974889999986227860226764144


Q ss_pred             -------------------------------------------------------------------------EEEEEEE
Q ss_conf             -------------------------------------------------------------------------0111014
Q gi|254780263|r  152 -------------------------------------------------------------------------DLLKEHK  158 (392)
Q Consensus       152 -------------------------------------------------------------------------~~l~~~~  158 (392)
                                                                                               ..++...
T Consensus       198 e~~f~GvvDlv~~kai~~~g~~g~~i~~~eIP~~l~~~~~e~R~~LIE~lad~DE~l~e~fLee~~ps~~~l~~aIRr~T  277 (721)
T KOG0465         198 ESNFKGVVDLVNGKAIYWDGENGEIVRKDEIPEDLEELAEEKRQALIETLADVDETLAEMFLEEEEPSAQQLKAAIRRAT  277 (721)
T ss_pred             CCCCHHHHHHHHCEEEEECCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             54431477463225899718987546855698789999999999999998611689999985258999899999999887


Q ss_pred             EEEE-EECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCC--------------------CC-CCCEECCCCC
Q ss_conf             5322-102331146764114445652123320344310252222100--------------------00-1100000001
Q gi|254780263|r  159 YSDD-TPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSL--------------------DA-PFLMHIEGSC  216 (392)
Q Consensus       159 ~~~~-~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~--------------------~~-p~r~~I~~vf  216 (392)
                      .... .|++..||++          ....++||+++.+++|.|..-.                    |+ ||.-..+.+-
T Consensus       278 i~r~fvPVl~GSAlK----------NkGVQPlLDAVvdYLPsP~Ev~n~a~~ke~~~~ekv~l~~~~d~~Pfv~LAFKle  347 (721)
T KOG0465         278 IKRSFVPVLCGSALK----------NKGVQPLLDAVVDYLPSPSEVENYALNKETNSKEKVTLSPSRDKDPFVALAFKLE  347 (721)
T ss_pred             HHCCEEEEEECHHHC----------CCCCCHHHHHHHHHCCCHHHHCCCCCCCCCCCCCCEEECCCCCCCCEEEEEEEEE
T ss_conf             515524677532223----------5674158999987679936624510256788866467522788996033577764


Q ss_pred             CCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCC-CC---CCCCCCCCCCHHHHHHHCCCCCCEEECHHEEE
Q ss_conf             355445430148742453489679995068743212541210-01---21144321001366641124543220211773
Q gi|254780263|r  217 GIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVE-MF---RKKLDEAIAGDNVGLLLRGVNRADVPRGRVVC  292 (392)
Q Consensus       217 ~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~-~~---~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~  292 (392)
                      .-++ |...+-||+||+|+.|+.++....++   ++|+..+. +|   .++|++++|||++++  -|+   |+..||+++
T Consensus       348 ~g~f-GqLTyvRvYqG~L~kG~~iyN~rtgK---Kvrv~RL~rmHa~~medV~~v~AG~I~al--fGi---dcasGDTft  418 (721)
T KOG0465         348 EGRF-GQLTYVRVYQGTLSKGDTIYNVRTGK---KVRVGRLVRMHANDMEDVNEVLAGDICAL--FGI---DCASGDTFT  418 (721)
T ss_pred             ECCC-CCEEEEEEEEEEECCCCEEEECCCCC---EEEHHHHHHHCCCCCCCCCEEECCCEEEE--ECC---CCCCCCEEC
T ss_conf             1674-52699998621664786787347785---44667787750254452000102766888--523---335687122


Q ss_pred             CCC
Q ss_conf             267
Q gi|254780263|r  293 APG  295 (392)
Q Consensus       293 ~~~  295 (392)
                      ++.
T Consensus       419 d~~  421 (721)
T KOG0465         419 DKQ  421 (721)
T ss_pred             CCC
T ss_conf             676


No 59 
>PRK05306 infB translation initiation factor IF-2; Validated
Probab=100.00  E-value=3.9e-43  Score=286.51  Aligned_cols=251  Identities=29%  Similarity=0.355  Sum_probs=186.1

Q ss_pred             HCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC-CCEEEEEEECCCCHHHH
Q ss_conf             10388279999904689887899999987644420013126868698629206378999821-99089998478730246
Q gi|254780263|r    7 VRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET-DKRFYSHIDCPGHADYV   85 (392)
Q Consensus         7 ~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~-~~~~i~iiD~PGH~~f~   85 (392)
                      ...+|.+ +.++||||||||||++.|-.. .-...+           .-|||..++.-..++ +++.|||||||||+-|+
T Consensus       337 ~~~r~pv-vt~mghvdhgkt~lld~~r~~-~v~~~e-----------~ggitq~iga~~v~~~~~~~itf~dtpgh~af~  403 (839)
T PRK05306        337 LVPRPPV-VTIMGHVDHGKTSLLDAIRKT-KVAAGE-----------AGGITQHIGAYQVETENGKKITFLDTPGHEAFT  403 (839)
T ss_pred             CCCCCCE-EEEECCCCCCHHHHHHHHHCC-CCCCCC-----------CCCCCCEEEEEEEEECCCCEEEEECCCCHHHHH
T ss_conf             5668988-988577467731489998628-753556-----------787552223499995699879985588558899


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEE-EEEEEEEEEEE
Q ss_conf             77987740023314520123443321067788886318760233100233356122211012321001-11014532210
Q gi|254780263|r   86 KNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDL-LKEHKYSDDTP  164 (392)
Q Consensus        86 ~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~-l~~~~~~~~~p  164 (392)
                      .=-.||+...|.++|||+|++|++|||.|.+..+++.|+| |||||||||.-+.+  .+.++.++.++ |-.-.|.++.+
T Consensus       404 ~mr~rga~~tdi~ilvvaaddgv~pqt~eai~~~~~a~vp-~ivaink~d~~~a~--~~~v~~~l~~~~~~~e~~gg~~~  480 (839)
T PRK05306        404 AMRARGAQVTDIVVLVVAADDGVMPQTIEAINHAKAAGVP-IIVAINKIDKPGAN--PDRVKQELTEYGLVPEEWGGDTI  480 (839)
T ss_pred             HHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCC--HHHHHHHHHHCCCCHHHCCCCEE
T ss_conf             9986357654369999977777567789999999974998-89997404678898--89999999984986454289448


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCC--CCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEE
Q ss_conf             23311467641144456521233203443102--5222210000110000000135544543014874245348967999
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTH--IPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEI  242 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~--~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i  242 (392)
                      ++++||.+|.          +++.|||+|.-.  +-.-..+.+.+.+-.|-+..-.+|+|.|++--|.+|+|++||.+..
T Consensus       481 ~v~~sa~~~~----------~~~~l~e~i~l~ae~~~l~a~~~~~a~g~vie~~~~~~~g~v~t~lv~~gtl~~gd~~v~  550 (839)
T PRK05306        481 FVPVSAKTGE----------GIDELLEAILLQAEVLELKANPDRPARGVVIEAKLDKGRGPVATVLVQNGTLKVGDIVVA  550 (839)
T ss_pred             EEEEEECCCC----------CHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEEECCCCCCEEEEEEECCEECCCCEEEE
T ss_conf             9981515788----------789999999987665204479998617999987752787505899984271325998998


Q ss_pred             EECCCCCCCEEEECCCCC-CCCCCCCCCCHHHHHH-HCCCCCCEEECHHEEE
Q ss_conf             506874321254121001-2114432100136664-1124543220211773
Q gi|254780263|r  243 IGMGGKKLKVKCTDVEMF-RKKLDEAIAGDNVGLL-LRGVNRADVPRGRVVC  292 (392)
Q Consensus       243 ~p~~~~~~~~kv~si~~~-~~~v~~a~aGd~v~l~-Lkgi~~~di~rGdvl~  292 (392)
                      ..     ...+|+++..+ ++.+++|.|+.-|-+. |+++.    ..||.+.
T Consensus       551 g~-----~~g~vr~m~~~~g~~~~~a~Ps~pv~i~G~~~~P----~aGd~~~  593 (839)
T PRK05306        551 GT-----TYGRVRAMVDDNGKRVKEAGPSTPVEILGLSGVP----QAGDEFV  593 (839)
T ss_pred             EC-----CCCCCEEEECCCCCCCCCCCCCCCEEEECCCCCC----CCCCEEE
T ss_conf             10-----2055101588999898714898777960567899----8888778


No 60 
>cd04167 Snu114p Snu114p subfamily.  Snu114p is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle.  U5 is a component of the spliceosome, which catalyzes the splicing of pre-mRNA to remove introns.  Snu114p is homologous to EF-2, but typically contains an additional N-terminal domain not found in Ef-2.  This protein is part of the GTP translation factor family and the Ras superfamily, characterized by five G-box motifs.
Probab=100.00  E-value=4e-43  Score=286.46  Aligned_cols=184  Identities=22%  Similarity=0.369  Sum_probs=140.0

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHH---H----HHCCCCCCCCHHHHHCCCEEEEEEEEEEC-----CCEEEEEEECCCC
Q ss_conf             9999904689887899999987644---4----20013126868698629206378999821-----9908999847873
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSE---E----KKEYGDIDSAPEEKLRGITIATAHVSYET-----DKRFYSHIDCPGH   81 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~---~----~~~~~~~D~~~~E~~rGiTi~~~~~~~~~-----~~~~i~iiD~PGH   81 (392)
                      ||+++||||||||||+++|+...+.   .    ......||+.++||+|||||.++...+.|     +.+.+||||||||
T Consensus         2 NvaiigHvdhGKTTL~d~Ll~~t~~~~~~~~~~~~~~~~~D~~~~E~eRgiTI~s~~~sl~~~~~~~k~~~inlIDTPGH   81 (213)
T cd04167           2 NVAIAGHLHHGKTSLLDMLIEQTHDLTPSGKDGWKPLRYTDIRKDEQERGISIKSSPISLVLPDSKGKSYLFNIIDTPGH   81 (213)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHCCCEECCEEEEEEECCCCCEEEEEEEECCCC
T ss_conf             59998278989899999999973445554044421135751646654203558614599998256675057877889872


Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCC------CCCHHHH---HHCCCCCCE
Q ss_conf             0246779877400233145201234433210677888863187602331002333------5612221---101232100
Q gi|254780263|r   82 ADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDA------VDDDELL---DISEYEIRD  152 (392)
Q Consensus        82 ~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~------v~~~~~~---~~i~~~i~~  152 (392)
                      .||..+|.+|++.+|+|+|||||.+|+++||++|+..|...++| +|++|||||+      .++++.|   ..+.+++..
T Consensus        82 ~dF~~ev~~al~~~DgailVVDa~eGv~~qT~~~l~~a~~~~l~-~ilviNKiDRLi~el~l~p~day~~~~~ii~~vn~  160 (213)
T cd04167          82 VNFMDEVAAALRLSDGVVLVVDVVEGVTSNTERLIRHAILEGLP-IVLVINKIDRLILELKLPPNDAYFKLRHIIDEVNN  160 (213)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             41799999888637767999987888757799999999986999-89999882343144069989999989999999999


Q ss_pred             EEEEEE----EE---EEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCC
Q ss_conf             111014----53---2210233114676411444565212332034431025222
Q gi|254780263|r  153 LLKEHK----YS---DDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTP  200 (392)
Q Consensus       153 ~l~~~~----~~---~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p  200 (392)
                      ++.+..    +.   .+..+++.|+..||...-.  .+.++..|++++.+++|.|
T Consensus       161 ~i~~~~~~~~~~~~p~~~nV~f~Sa~~gw~ftl~--~fa~~y~l~d~i~~~ip~P  213 (213)
T cd04167         161 IIASFSTTLSFLFSPENGNVCFASSKFGFCFTLE--SFAKKYGLVDSIVSNIPSP  213 (213)
T ss_pred             HHHHHCCCCCCEECCCCCCEEEEEECCCEEECCC--CHHHHHHHHHHHHHHCCCC
T ss_conf             9997078735165688796999970005212362--3211689999999638898


No 61 
>cd01885 EF2 EF2 (for archaea and eukarya).  Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes.  The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome.  The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins.  Two major mechanisms are known to regulate protein elongation and both involve eEF2.  First, eEF2 can be modulated by reversible phosphorylation.  Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes.  Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2.  In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation.  Seco
Probab=100.00  E-value=2.9e-42  Score=281.13  Aligned_cols=184  Identities=27%  Similarity=0.386  Sum_probs=140.2

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHH----HHHCCCCCCCCHHHHHCCCEEEEEEEEE----------ECCCEEEEEEECC
Q ss_conf             9999904689887899999987644----4200131268686986292063789998----------2199089998478
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSE----EKKEYGDIDSAPEEKLRGITIATAHVSY----------ETDKRFYSHIDCP   79 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~----~~~~~~~~D~~~~E~~rGiTi~~~~~~~----------~~~~~~i~iiD~P   79 (392)
                      ||+++||||||||||+++|+...+.    .+.....||+.++||+|||||.++...+          .++++.+||||||
T Consensus         2 Ni~iigHvdhGKTTL~D~Ll~~~g~i~~~~~g~~~~~D~~~~E~eRgiTIks~~isl~~~~~~~~~~~~~~~~inlIDTP   81 (222)
T cd01885           2 NICIIAHVDHGKTTLSDSLLASAGIISEKLAGKARYMDSREDEQERGITMKSSAISLYFEYEEEDKADGNEYLINLIDSP   81 (222)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCHHCCCCEEECCCHHHHHHCCCEEEEEEEEEEEEECCCCCCCCCCEEEEEEECC
T ss_conf             69998668877999999999985984121066346514243342054158622689998603443456886389997288


Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCC------CCHHHHHHC---CCCC
Q ss_conf             7302467798774002331452012344332106778888631876023310023335------612221101---2321
Q gi|254780263|r   80 GHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAV------DDDELLDIS---EYEI  150 (392)
Q Consensus        80 GH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v------~~~~~~~~i---~~~i  150 (392)
                      ||.||..+|.+|++.+|+|+|||||.+|+++||++++..|...++| +|++|||||+.      ++++.|+..   .+++
T Consensus        82 GH~dF~~ev~~al~~~DgailVVDa~eGv~~qT~~vl~~a~~~~l~-~il~iNKiDRli~el~l~p~day~~l~~iie~v  160 (222)
T cd01885          82 GHVDFSSEVTAALRLCDGALVVVDAVEGVCVQTETVLRQALKERVK-PVLVINKIDRLILELKLSPEEAYQRLARIIEQV  160 (222)
T ss_pred             CHHHHHHHHHHHHHHCCEEEEEECCCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCHHCCCCHHHHHHHHHHHHHHH
T ss_conf             5698999999999856817996104578577899999999985999-799998903650011799899999999999999


Q ss_pred             CEEEE-------------EEEEEE-EEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCC
Q ss_conf             00111-------------014532-210233114676411444565212332034431025222
Q gi|254780263|r  151 RDLLK-------------EHKYSD-DTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTP  200 (392)
Q Consensus       151 ~~~l~-------------~~~~~~-~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p  200 (392)
                      ..++.             +..+.+ +..+++.|+..||..+-  .....+..|++++.+++|.|
T Consensus       161 N~~i~~~~~~~~~~~~~~~~~~~p~~gnV~f~Sa~~Gw~f~l--~~fa~ly~ll~~iv~~iP~P  222 (222)
T cd01885         161 NAIIGTYADEEFKEKDDEKWYFSPQKGNVAFGSALHGWGFTI--IKFARIYAVLEMVVKHLPSP  222 (222)
T ss_pred             HHHHHHHCHHHHCCCCCCCEEECCCCCCEEEEECCCCCCCCC--CCHHHHHHHHHHHHHHCCCC
T ss_conf             999987230433035532102077778389998323771267--54121899999999628998


No 62 
>PRK04004 translation initiation factor IF-2; Validated
Probab=100.00  E-value=7.4e-42  Score=278.59  Aligned_cols=223  Identities=25%  Similarity=0.307  Sum_probs=159.3

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCC-E-----------------E
Q ss_conf             827999990468988789999998764442001312686869862920637899982199-0-----------------8
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK-R-----------------F   72 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~-~-----------------~   72 (392)
                      +.+ +.++||||||||||++.|-+. .-...+           .-|||...+..++.++. .                 -
T Consensus         5 ~PI-vtimGHVDhGKTsLLD~iR~t-~V~~~E-----------aGGITQhIGA~~v~~~~~~~~~~~~~~~~~~~~~ipg   71 (592)
T PRK04004          5 QPI-VVVLGHVDHGKTTLLDKIRGT-AVAAKE-----------AGGITQHIGATEVPIDVIEKIAGPLVKRLPLKLKIPG   71 (592)
T ss_pred             CCE-EEEECCCCCCHHHHHHHHHCC-CCCCCC-----------CCCCCCEECEEEECCCCHHHHCCCCCCCCCCCCCCCC
T ss_conf             988-999787377763689998628-773555-----------7762323065984123101103443344332345677


Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCC-CHH----H-----
Q ss_conf             999847873024677987740023314520123443321067788886318760233100233356-122----2-----
Q gi|254780263|r   73 YSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVD-DDE----L-----  142 (392)
Q Consensus        73 i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~-~~~----~-----  142 (392)
                      ++|||||||+.|..=-.||++.+|.|+|||||++|++|||.|.+.+++..++| ||||+||||++. |+.    -     
T Consensus        72 llfiDTPGHeaFt~mR~RGa~vtDiaILVVa~~dGv~pQT~EaI~~~k~~~vP-~IVAiNKiDr~~gw~~~~~~~~~~~~  150 (592)
T PRK04004         72 LLFIDTPGHEAFSNLRKRGGALADIAILVVDINEGFQPQTIESLNILKSRKTP-FVVAANKIDRIPGWKSVEGAPFLESF  150 (592)
T ss_pred             CEEECCCCHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCCCCCCCCHHHHH
T ss_conf             55765996599999997367457889999977888676279999999975998-89998622356667767674112322


Q ss_pred             ---HHHCCCCC----CE---EEEEE-----------EEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCC----
Q ss_conf             ---11012321----00---11101-----------4532210233114676411444565212332034431025----
Q gi|254780263|r  143 ---LDISEYEI----RD---LLKEH-----------KYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHI----  197 (392)
Q Consensus       143 ---~~~i~~~i----~~---~l~~~-----------~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~----  197 (392)
                         .+.+..++    .+   -|.+.           .|..+++++|+||.+|-          +++.||+.|....    
T Consensus       151 ~~q~~~v~~~l~~~~~~vi~~l~e~G~~~e~~~~~~d~g~~v~~VpvSA~tGe----------Gi~dLL~~i~~Laq~~l  220 (592)
T PRK04004        151 KKQSERVQAELEEKLYELIGELYELGFSADRFDRVSDFTKTVAIVPVSAKTGE----------GIPDLLMVLAGLAQRYL  220 (592)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCCCCEEEEECCCCCCC----------CHHHHHHHHHHHHHHHH
T ss_conf             31738899999888888889998728763221454345881489978205689----------98999999999999999


Q ss_pred             C-CCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCC
Q ss_conf             2-222100001100000001355445430148742453489679995068743212541210
Q gi|254780263|r  198 P-TPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVE  258 (392)
Q Consensus       198 ~-~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~  258 (392)
                      . .-..+.+.|.+-.|-++-..+|.|++++--|.+|+|++||.+.+....+ ...++|+++.
T Consensus       221 ~~~Lka~~~~~a~GtViEsk~dkG~G~vatVIv~~GtLk~GD~IV~g~~~G-pi~tkVRALl  281 (592)
T PRK04004        221 EEELKIEVEGPGKGTVLEVKEERGLGTTLDVILYDGTLRKGDTIVVGGLDG-PIVTKVRALL  281 (592)
T ss_pred             HHHHCCCCCCCCCEEEEEEEECCCCCCEEEEEEECCEECCCCEEEEEECCC-CCCCCHHHHH
T ss_conf             985367999986189999986079886179999768471699999951578-6200047660


No 63 
>cd04171 SelB SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo
Probab=100.00  E-value=4.6e-42  Score=279.87  Aligned_cols=161  Identities=42%  Similarity=0.605  Sum_probs=141.1

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC-CCEEEEEEECCCCHHHHHHHHHHH
Q ss_conf             9999904689887899999987644420013126868698629206378999821-990899984787302467798774
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET-DKRFYSHIDCPGHADYVKNMITGA   92 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~-~~~~i~iiD~PGH~~f~~~mi~g~   92 (392)
                      -||++||+|||||||+++|++.         ++|+.++|++||+|+++++.++++ ++++++|+|||||++|+++|++++
T Consensus         2 vVaivG~~n~GKSTL~n~L~g~---------~~d~~~~e~~~giTi~~~~~~~~~~~~~~i~~iDtPGh~~~~~~~~~~~   72 (164)
T cd04171           2 IIGTAGHIDHGKTTLIKALTGI---------ETDRLPEEKKRGITIDLGFAYLDLPSGKRLGFIDVPGHEKFIKNMLAGA   72 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHCC---------CCCCCHHHHCCCEEEEEEEEEEECCCCCEEEEEECCCHHHHHHHHHHHH
T ss_conf             9999926887299999998496---------4663333334863798546878648998999994878799999999987


Q ss_pred             HCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCEEEE
Q ss_conf             00233145201234433210677888863187602331002333561222110123210011101453221023311467
Q gi|254780263|r   93 TQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALC  172 (392)
Q Consensus        93 ~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~sa~~  172 (392)
                      +.+|+|+|||||++|+++||+||+.+++.+|+|++|+++||||++++++ ++.++.+++++++...+ .+.|++|+||.+
T Consensus        73 ~~aD~~llVvda~~g~~~q~~e~~~~~~~~~i~~~ivvlNK~D~v~~~~-~~~~~~~i~~~l~~~~~-~~~pii~iSA~t  150 (164)
T cd04171          73 GGIDLVLLVVAADEGIMPQTREHLEILELLGIKRGLVVLTKADLVDEDW-LELVEEEIRELLAGTFL-ADAPIFPVSAVT  150 (164)
T ss_pred             HHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHH-HHHHHHHHHHHHHHCCC-CCCEEEEEECCC
T ss_conf             4267258998617788888999999998738872787346342579789-99999999999974399-998299946989


Q ss_pred             EEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             64114445652123320344310
Q gi|254780263|r  173 ALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       173 g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                      |.          +++.|+++|++
T Consensus       151 G~----------Gi~eL~~~I~e  163 (164)
T cd04171         151 GE----------GIEELKEYLDE  163 (164)
T ss_pred             CC----------CHHHHHHHHHH
T ss_conf             82----------99999999984


No 64 
>TIGR00503 prfC peptide chain release factor 3; InterPro: IPR004548   Peptide chain release factor 3 increases the formation of ribosomal termination complexes and stimulates activity of RF-1 and RF-2. It binds to guanine nucleotides and has a strong preference for UGA stop codons. This translation releasing factor, RF-3 (prfC) was originally described as stop codon-independent, in contrast to peptide chain release factor 1 (RF-1, prfA) and RF-2 (prfB). RF-1 and RF-2 are closely related to each other, while RF-3 is similar to elongation factors EF-Tu and EF-G; RF-1 is active at UAA and UAG and RF-2 is active at UAA and UGA. All bacteria and organelles have RF-1. The Mycoplasmas and organelles, which translate UGA as Trp rather than as a stop codon, lack RF-2. RF-3, in contrast, seems to be rare among bacteria and is found so far only in Escherichia coli and some other gamma subdivision Proteobacteria, in Synechocystis sp. (strain PCC 6803), and in Staphylococcus aureus.; GO: 0005525 GTP binding, 0016149 translation release factor activity codon specific, 0006415 translational termination, 0005737 cytoplasm.
Probab=100.00  E-value=4.8e-42  Score=279.76  Aligned_cols=301  Identities=22%  Similarity=0.317  Sum_probs=210.6

Q ss_pred             EEEEEECCCCCHHHHHHHHHH----------HHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHH
Q ss_conf             999990468988789999998----------7644420013126868698629206378999821990899984787302
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITK----------YYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHAD   83 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~----------~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~   83 (392)
                      |+|||.|.|||||||++.++=          ..++.....+..||+.-|++|||+|.++..+|.|.++.+|++|||||+|
T Consensus        13 ~FAIISHPDAGKTT~TEK~LLyG~AIQ~AG~VK~r~S~~~A~SDWM~ME~QRGISIT~~VlQF~Y~~~l~NLLDTPGH~D   92 (530)
T TIGR00503        13 TFAIISHPDAGKTTLTEKVLLYGGAIQTAGAVKGRGSQRHAKSDWMEMEKQRGISITTSVLQFPYRDCLVNLLDTPGHED   92 (530)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEEEEEECCCCCEEECCCCCCCCC
T ss_conf             54366168887424678888742566522441220012212213788750588144412774145774562036858887


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCC--CHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             4677987740023314520123443321067788886318760233100233356--12221101232100111014532
Q gi|254780263|r   84 YVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVD--DDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        84 f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~--~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      |.-.+.|-++.+|.|++||||.+|++.||+.-+.++|+-..| |+-++||+|+-.  |=|+.|+++++++-    ..+.-
T Consensus        93 FSEDTYRTL~A~D~~~M~IDaAKG~E~~T~KL~EV~RLR~~P-I~TF~NKLDR~~~~P~ELlDEvE~~L~~----~~~~~  167 (530)
T TIGR00503        93 FSEDTYRTLTAVDNCLMVIDAAKGVETRTRKLMEVTRLRDLP-ILTFINKLDRDIRDPLELLDEVENELKI----NCAPI  167 (530)
T ss_pred             CCCHHHHHHHHHHHHEEEHHCCCCHHHHHHHHHHHHHHCCCC-HHHHHHHCCCCCCCHHHHHHHHHHHHCC----CEEEE
T ss_conf             640467999985123001111256123424454201000474-4335232065435537888888877064----11343


Q ss_pred             EEECCCCEEEEE-----------------------------EE--------CCC--------------------------
Q ss_conf             210233114676-----------------------------41--------144--------------------------
Q gi|254780263|r  162 DTPIIRGSALCA-----------------------------LQ--------GTN--------------------------  178 (392)
Q Consensus       162 ~~pii~~sa~~g-----------------------------~~--------~~n--------------------------  178 (392)
                      .+||=...-+.|                             ++        |++                          
T Consensus       168 ~~PIG~G~~F~GVY~~~~~~~yLy~r~G~~~~~~~~~~~~~L~~P~L~~~~G~D~~~~l~dELELv~~A~~EFd~~~~~~  247 (530)
T TIGR00503       168 TYPIGCGKLFKGVYHLLKDEIYLYQRSGTGGTIKAVRVVKGLNNPALDSAVGSDLAQQLRDELELVEGASNEFDLAAFLG  247 (530)
T ss_pred             ECCCCCCCCCHHHHHHHCCEEEEEECCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             05657884311355430140667630588841667777632688015677657899999889999986302456899853


Q ss_pred             ---------CCCCCCCCCCHHHHHHCCCCCCCCC-CC-----------CCCCEECCCCCCCCCCCCCEEEEEEECCCCCC
Q ss_conf             ---------4565212332034431025222210-00-----------01100000001355445430148742453489
Q gi|254780263|r  179 ---------KELGEDSIHALMKAVDTHIPTPQRS-LD-----------APFLMHIEGSCGIEGRGTVVTGCIKRGRIKAG  237 (392)
Q Consensus       179 ---------~~~~~~~~~~Ll~~i~~~~~~p~~~-~~-----------~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~G  237 (392)
                               .-+...+.+-+|+++..+-|.|... .|           ..|.|=||.-...+.+-+|++-||.||...+|
T Consensus       248 GE~TPVFFG~Al~NFGV~~~L~~l~~~A~~P~~~~~~~~TvE~~~e~FsGFVFK~QANMDPKHRDRvAFlRV~SGKyEK~  327 (530)
T TIGR00503       248 GELTPVFFGTALGNFGVDHFLDGLLQYAPKPEARQSDTRTVEPTEEKFSGFVFKLQANMDPKHRDRVAFLRVVSGKYEKG  327 (530)
T ss_pred             CCCCCEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEEEEECCEEECC
T ss_conf             86463111000101008999999998607888765677540234335442288863379886335057777641346347


Q ss_pred             CEEEEEECCCCCCCEEEECCCC-CCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECC------CCCCCCEEEEEEEEEE
Q ss_conf             6799950687432125412100-12114432100136664112454322021177326------7776300016899971
Q gi|254780263|r  238 SDVEIIGMGGKKLKVKCTDVEM-FRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAP------GSIQEYSRFRASVYIL  310 (392)
Q Consensus       238 d~i~i~p~~~~~~~~kv~si~~-~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~------~~~~~~~~f~A~i~il  310 (392)
                      +.+...-.++.-..++-..+.. .|..++.|||||++||+=    .--++.||++..-      .-|.-+..+-++|.. 
T Consensus       328 M~~k~~R~gK~V~~S~~~~~~A~~R~~v~~AYaGD~iGL~N----~G~~~IGDT~~~GE~~~f~gIP~F~PELF~~~R~-  402 (530)
T TIGR00503       328 MKLKHVRTGKDVVLSDALTLMAGDREHVEEAYAGDIIGLHN----HGTIQIGDTFTQGEKLKFTGIPNFAPELFRRLRL-  402 (530)
T ss_pred             CEECCCCCCCEEEECCHHHHHHCCHHHHHHCCCCCEEEECC----CCCEEECCCCCCCCEEEECCCCCCCHHHHHHHHC-
T ss_conf             56614213553686323565440212231127776531068----8426747720248656638778866789998621-


Q ss_pred             ECCCCCCCCCCCCCCE
Q ss_conf             0567875555115978
Q gi|254780263|r  311 TASEGGRTTGFMDNYR  326 (392)
Q Consensus       311 ~~~~~~~~~~~~~~~~  326 (392)
                        ..|.....++.|..
T Consensus       403 --~DP~~~K~l~KG~~  416 (530)
T TIGR00503       403 --KDPLKQKQLLKGLV  416 (530)
T ss_pred             --CCCHHHHHHHCCCH
T ss_conf             --38345566550410


No 65 
>cd04165 GTPBP1_like GTPBP1-like.  Mammalian GTP binding protein 1 (GTPBP1), GTPBP2, and nematode homologs AGP-1 and CGP-1 are GTPases whose specific functions remain unknown.  In mouse, GTPBP1 is expressed in macrophages, in smooth muscle cells of various tissues and in some neurons of the cerebral cortex; GTPBP2 tissue distribution appears to overlap that of GTPBP1.  In human leukemia and macrophage cell lines, expression of both GTPBP1 and GTPBP2 is enhanced by interferon-gamma (IFN-gamma).  The chromosomal location of both genes has been identified in humans, with GTPBP1 located in chromosome 22q12-13.1 and GTPBP2 located in chromosome 6p21-12.  Human glioblastoma multiforme (GBM), a highly-malignant astrocytic glioma and the most common cancer in the central nervous system, has been linked to chromosomal deletions and a translocation on chromosome 6.  The GBM translocation results in a fusion of GTPBP2 and PTPRZ1, a protein involved in oligodendrocyte differentiation, recovery, and
Probab=100.00  E-value=4.4e-42  Score=279.98  Aligned_cols=144  Identities=26%  Similarity=0.352  Sum_probs=118.0

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCC--CCCCCCHHHHHCCCEEEEEE------------------------EEEE
Q ss_conf             999990468988789999998764442001--31268686986292063789------------------------9982
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEY--GDIDSAPEEKLRGITIATAH------------------------VSYE   67 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~--~~~D~~~~E~~rGiTi~~~~------------------------~~~~   67 (392)
                      +|+++||||||||||+|+|++...+.++..  ..+++++||.++|+|.++++                        ..++
T Consensus         1 Rv~v~GhVD~GKSTL~G~Lt~g~lDdGrg~ar~~~~rh~hE~~~G~Tssi~~~~lgf~~~g~~~~~~~~~~~~~~~~~~~   80 (224)
T cd04165           1 RVAVVGNVDAGKSTLLGVLTQGELDNGRGKARLNLFRHKHEVESGRTSSVSNEILGFDSDGEVVNYPDNHLSESDIEICE   80 (224)
T ss_pred             CEEEEECCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCEECCCCCCCCCCCEEEEC
T ss_conf             98999485884889999985677422210677787761899972654411565540101453202134765442201213


Q ss_pred             CCCEEEEEEECCCCHHHHHHHHHHH--HCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHH
Q ss_conf             1990899984787302467798774--00233145201234433210677888863187602331002333561222110
Q gi|254780263|r   68 TDKRFYSHIDCPGHADYVKNMITGA--TQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDI  145 (392)
Q Consensus        68 ~~~~~i~iiD~PGH~~f~~~mi~g~--~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~  145 (392)
                      ..++.++|+|+|||++|++||++|+  +.+|+|+|||+|++|+++||+||+.++.++++| ++|+|||||+++++. ++.
T Consensus        81 ~~~k~it~iD~pGH~~y~kt~i~G~~~~~~d~~~LvV~A~~G~~~~T~ehl~l~~~l~ip-~~vvitKiDl~~~~~-l~~  158 (224)
T cd04165          81 KSSKLVTFIDLAGHERYLKTTLFGLTGYAPDYAMLVVAANAGIIGMTKEHLGLALALNIP-VFVVVTKIDLAPANI-LQE  158 (224)
T ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCC-EEEEEECCCCCCHHH-HHH
T ss_conf             678679999788739999999987635568989999317889779999999999983999-899998977689899-999


Q ss_pred             CCCCCCEEEEEEEE
Q ss_conf             12321001110145
Q gi|254780263|r  146 SEYEIRDLLKEHKY  159 (392)
Q Consensus       146 i~~~i~~~l~~~~~  159 (392)
                      ...+++++++..++
T Consensus       159 ~~~~i~~~lk~p~~  172 (224)
T cd04165         159 TLKDLKRILKVPGV  172 (224)
T ss_pred             HHHHHHHHHCCCCC
T ss_conf             99999999704475


No 66 
>cd04168 TetM_like Tet(M)-like subfamily.  Tet(M), Tet(O), Tet(W), and OtrA are tetracycline resistance genes found in Gram-positive and Gram-negative bacteria.  Tetracyclines inhibit protein synthesis by preventing aminoacyl-tRNA from binding to the ribosomal acceptor site.  This subfamily contains tetracycline resistance proteins that function through ribosomal protection and are typically found on mobile genetic elements, such as transposons or plasmids, and are often conjugative.  Ribosomal protection proteins are homologous to the elongation factors EF-Tu and EF-G.  EF-G and Tet(M) compete for binding on the ribosomes.  Tet(M) has a higher affinity than EF-G, suggesting these two proteins may have overlapping binding sites and that Tet(M) must be released before EF-G can bind.  Tet(M) and Tet(O) have been shown to have ribosome-dependent GTPase activity.  These proteins are part of the GTP translation factor family, which includes EF-G, EF-Tu, EF2, LepA, and SelB.
Probab=100.00  E-value=2.5e-40  Score=269.13  Aligned_cols=137  Identities=33%  Similarity=0.506  Sum_probs=118.2

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHH------HHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHH
Q ss_conf             999990468988789999998764------44200131268686986292063789998219908999847873024677
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYS------EEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~------~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~   87 (392)
                      ||+++||+|||||||+++|+...+      +...+...+|..++||+|||||.++..+|+|++++|||||||||.||..+
T Consensus         1 Niai~gH~~~GKTtL~e~lL~~~g~i~r~G~v~~g~t~~D~~~eE~~r~isi~~~~~~~~~~~~~~n~iDtPG~~dF~~e   80 (237)
T cd04168           1 NIGILAHVDAGKTTLTESLLYTSGAIRKLGSVDKGTTRTDTMELERQRGITIFSAVASFQWEDTKVNLIDTPGHMDFIAE   80 (237)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHCCHHHHCCCEECCCCCCCCHHHHHHHCCEEEEEEEEEEECCEEEEEEECCCCHHHHHH
T ss_conf             98999389989999999999965712226633068303785499898487031058999989987999889884656668


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCC--HHHHHHCCCCCCEEEE
Q ss_conf             9877400233145201234433210677888863187602331002333561--2221101232100111
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDD--DELLDISEYEIRDLLK  155 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~--~~~~~~i~~~i~~~l~  155 (392)
                      |.++++.+|.|++||||.+|+++||++++..++.+++|. +++|||||+-+.  ++.++    ++++.|.
T Consensus        81 ~~~al~~~D~av~Vv~a~~Gv~~~t~~~~~~~~~~~~P~-iifiNKmDre~adf~~~l~----~i~~~l~  145 (237)
T cd04168          81 VERSLSVLDGAILVISAVEGVQAQTRILWRLLRKLNIPT-IIFVNKIDRAGADLEKVYQ----EIKEKLS  145 (237)
T ss_pred             HHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCE-EEEEECCCCCCCCHHHHHH----HHHHHHC
T ss_conf             988976348169999658882234499999999859985-9986244578999999999----9999978


No 67 
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=4.3e-39  Score=261.43  Aligned_cols=211  Identities=30%  Similarity=0.356  Sum_probs=161.2

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC---CEEEEEEECCCCHHHHH
Q ss_conf             882799999046898878999999876444200131268686986292063789998219---90899984787302467
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD---KRFYSHIDCPGHADYVK   86 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~---~~~i~iiD~PGH~~f~~   86 (392)
                      ++.+ +.++||||||||||++.|=+. .-...+           .-|||...+..+++++   ...++|||||||+-|+.
T Consensus         4 R~Pv-VtimGHVDHGKTtLLD~IR~t-~Va~~E-----------aGGITQhIGA~~v~~~~~~~~~itFiDTPGHeAFt~   70 (509)
T COG0532           4 RPPV-VTIMGHVDHGKTTLLDKIRKT-NVAAGE-----------AGGITQHIGAYQVPLDVIKIPGITFIDTPGHEAFTA   70 (509)
T ss_pred             CCCE-EEEECCCCCCCCCHHHHHHCC-CCCCCC-----------CCCEEEEEEEEEEEECCCCCCEEEEECCCCHHHHHH
T ss_conf             8988-999674358842016667417-643566-----------785001743499986468865289974895788887


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEE-EEEEEEEEEEEC
Q ss_conf             7987740023314520123443321067788886318760233100233356122211012321001-110145322102
Q gi|254780263|r   87 NMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDL-LKEHKYSDDTPI  165 (392)
Q Consensus        87 ~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~-l~~~~~~~~~pi  165 (392)
                      --.||++.+|.|+|||||++|++|||.|.+.+++.+|+| +||++||||+.+.+  .+.+..++.+. |..-.|..+..+
T Consensus        71 mRaRGa~vtDIaILVVa~dDGv~pQTiEAI~hak~a~vP-~iVAiNKiDk~~~n--p~~v~~el~~~gl~~E~~gg~v~~  147 (509)
T COG0532          71 MRARGASVTDIAILVVAADDGVMPQTIEAINHAKAAGVP-IVVAINKIDKPEAN--PDKVKQELQEYGLVPEEWGGDVIF  147 (509)
T ss_pred             HHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCC--HHHHHHHHHHCCCCHHHCCCCEEE
T ss_conf             875577544579999975678566179999999877999-89998543279988--789999887779887661881499


Q ss_pred             CCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCC--CCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEE
Q ss_conf             331146764114445652123320344310252--222100001100000001355445430148742453489679995
Q gi|254780263|r  166 IRGSALCALQGTNKELGEDSIHALMKAVDTHIP--TPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEII  243 (392)
Q Consensus       166 i~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~--~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~  243 (392)
                      +|+||.+|.          +++.||+.+.-.-.  .-..+.+.+.+-.|-++...+|.|.+++--|.+|+|++||.+.+.
T Consensus       148 VpvSA~tg~----------Gi~eLL~~ill~aev~elka~~~~~a~gtviE~~~dkG~G~vatviv~~GtL~~GD~iv~g  217 (509)
T COG0532         148 VPVSAKTGE----------GIDELLELILLLAEVLELKANPEGPARGTVIEVKLDKGLGPVATVIVQDGTLKKGDIIVAG  217 (509)
T ss_pred             EEEECCCCC----------CHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCCCCCEEEEEEECCEEECCCEEEEC
T ss_conf             974324787----------9799999999888998644288987249999998626887528999964847449999983


Q ss_pred             ECC
Q ss_conf             068
Q gi|254780263|r  244 GMG  246 (392)
Q Consensus       244 p~~  246 (392)
                      ...
T Consensus       218 ~~~  220 (509)
T COG0532         218 GEY  220 (509)
T ss_pred             CCC
T ss_conf             787


No 68 
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G.  On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group
Probab=100.00  E-value=5.3e-39  Score=260.89  Aligned_cols=150  Identities=27%  Similarity=0.357  Sum_probs=123.5

Q ss_pred             EEEEEECCCCCHHHHHHHHHHH------HHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHH
Q ss_conf             9999904689887899999987------6444200131268686986292063789998219908999847873024677
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKY------YSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~------~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~   87 (392)
                      |||++||+|||||||+++|+..      .+....+...+|++++||+|||||.++..+|+|++++|||||||||.||+.+
T Consensus         1 Ni~iigH~~aGKTtL~E~lL~~~g~i~~~G~V~~g~t~~D~~~~E~~RgiSi~s~~~~~~w~~~~inliDTPG~~DF~~e   80 (268)
T cd04170           1 NIALVGHSGSGKTTLAEALLYATGAIDRLGSVEDGTTVSDYDPEEIKRKMSISTSVAPLEWKGHKINLIDTPGYADFVGE   80 (268)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEECCEEEEEECCEEEEEEECCCCHHHHHH
T ss_conf             98999089999899999999966996657654589735778788986796751355788889979999869897579999


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             9877400233145201234433210677888863187602331002333561222110123210011101453221023
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
                      +.++++.+|+|++||||.+|+++||+..+..++.+++|. |++|||||+.+.+  |+.+-.++++.|...-..-.+|+-
T Consensus        81 ~~~aL~v~D~Av~Vida~~GVe~~T~~~w~~~~~~~iP~-i~fINKmDr~~ad--~~~~l~~i~~~lg~~~vp~~~Pig  156 (268)
T cd04170          81 TRAALRAADAALVVVSAQSGVEVGTEKLWEFADEAGIPR-IIFINKMDRERAD--FDKTLAALQEAFGRPVVPLQLPIG  156 (268)
T ss_pred             HHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCE-EEEEECCCCCCCC--HHHHHHHHHHHHCCCEEEEEEEEC
T ss_conf             999840478399994187547687999999999859998-9999787878996--477999999986898499996652


No 69 
>KOG1145 consensus
Probab=100.00  E-value=1.7e-38  Score=257.66  Aligned_cols=236  Identities=30%  Similarity=0.334  Sum_probs=173.3

Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC-CCEEEEEEECCCCHHHHHH
Q ss_conf             388279999904689887899999987644420013126868698629206378999821-9908999847873024677
Q gi|254780263|r    9 NKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET-DKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus         9 ~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~-~~~~i~iiD~PGH~~f~~~   87 (392)
                      ++|.+ +-++||||||||||++.|- ...-.+.+.           -|||..++...... ++++|||+|||||+-|..=
T Consensus       151 ~RpPV-VTiMGHVDHGKTTLLD~lR-ks~VAA~E~-----------GGITQhIGAF~V~~p~G~~iTFLDTPGHaAF~aM  217 (683)
T KOG1145         151 PRPPV-VTIMGHVDHGKTTLLDALR-KSSVAAGEA-----------GGITQHIGAFTVTLPSGKSITFLDTPGHAAFSAM  217 (683)
T ss_pred             CCCCE-EEEEECCCCCHHHHHHHHH-HCCEEHHHC-----------CCCCCEECEEEEECCCCCEEEEECCCCHHHHHHH
T ss_conf             89986-9986013577001998874-072201323-----------7710000229996389977887568747889999


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCE-EEEEEEEEEEEECC
Q ss_conf             98774002331452012344332106778888631876023310023335612221101232100-11101453221023
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRD-LLKEHKYSDDTPII  166 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~-~l~~~~~~~~~pii  166 (392)
                      -.||+..+|.++|||+|++|++|||.|.+..|+..++| +||+|||+|....+  .+.++.++-. -+.--.+.+++++|
T Consensus       218 RaRGA~vtDIvVLVVAadDGVmpQT~EaIkhAk~A~Vp-iVvAinKiDkp~a~--pekv~~eL~~~gi~~E~~GGdVQvi  294 (683)
T KOG1145         218 RARGANVTDIVVLVVAADDGVMPQTLEAIKHAKSANVP-IVVAINKIDKPGAN--PEKVKRELLSQGIVVEDLGGDVQVI  294 (683)
T ss_pred             HHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCC--HHHHHHHHHHCCCCHHHCCCCEEEE
T ss_conf             86268644479999972677567689999988765997-89998436789989--8999999987693277707823699


Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHCCCC--CCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEE
Q ss_conf             31146764114445652123320344310252--2221000011000000013554454301487424534896799950
Q gi|254780263|r  167 RGSALCALQGTNKELGEDSIHALMKAVDTHIP--TPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIG  244 (392)
Q Consensus       167 ~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~--~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p  244 (392)
                      |+||++|   +|       ++.|.+++...-.  .-..+..+|+.-+|-+.+-.+|+|.+.+--|..|+|+.|+-+... 
T Consensus       295 piSAl~g---~n-------l~~L~eaill~Ae~mdLkA~p~g~~eg~VIES~vdkg~G~~aT~iVkrGTLkKG~vlV~G-  363 (683)
T KOG1145         295 PISALTG---EN-------LDLLEEAILLLAEVMDLKADPKGPAEGWVIESSVDKGRGPVATVIVKRGTLKKGSVLVAG-  363 (683)
T ss_pred             EEECCCC---CC-------HHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCCCEEEEEEECCCCCCCCEEEEE-
T ss_conf             8651147---98-------689999999999986411688997128999864137756426999953623156589970-


Q ss_pred             CCCCCCCEEEECCCCC-CCCCCCCCCCHHHHH
Q ss_conf             6874321254121001-211443210013666
Q gi|254780263|r  245 MGGKKLKVKCTDVEMF-RKKLDEAIAGDNVGL  275 (392)
Q Consensus       245 ~~~~~~~~kv~si~~~-~~~v~~a~aGd~v~l  275 (392)
                        .  .-.||+.+..+ ++++++|.|++-+.+
T Consensus       364 --~--~w~KVr~l~D~nGk~i~~A~Ps~pv~V  391 (683)
T KOG1145         364 --K--SWCKVRALFDHNGKPIDEATPSQPVEV  391 (683)
T ss_pred             --C--HHHHHHHHHHCCCCCCCCCCCCCCEEE
T ss_conf             --2--144334455237979221489983476


No 70 
>cd04169 RF3 RF3 subfamily.  Peptide chain release factor 3 (RF3) is a protein involved in the termination step of translation in bacteria.  Termination occurs when class I release factors (RF1 or RF2) recognize the stop codon at the A-site of the ribosome and activate the release of the nascent polypeptide.  The class II release factor RF3 then initiates the release of the class I RF from the ribosome.  RF3 binds to the RF/ribosome complex in the inactive (GDP-bound) state.  GDP/GTP exchange occurs, followed by the release of the class I RF.  Subsequent hydrolysis of GTP to GDP triggers the release of RF3 from the ribosome.  RF3 also enhances the efficiency of class I RFs at less preferred stop codons and at stop codons in weak contexts.
Probab=100.00  E-value=1.3e-37  Score=252.28  Aligned_cols=139  Identities=30%  Similarity=0.418  Sum_probs=118.4

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHH------H----HHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHH
Q ss_conf             9999904689887899999987644------4----20013126868698629206378999821990899984787302
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSE------E----KKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHAD   83 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~------~----~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~   83 (392)
                      |||++||+|||||||+++|+...+.      .    ......+|..++|++|||||.++..+|+|++++|||||||||.|
T Consensus         4 niai~gH~gaGKTtL~EalL~~~G~i~r~G~V~~~~~~g~t~~D~~~eE~~R~iSi~~~~~~~~w~~~kinliDTPG~~D   83 (267)
T cd04169           4 TFAIISHPDAGKTTLTEKLLLFGGAIREAGAVKARKSRKHATSDWMEIEKQRGISVTSSVMQFEYRDCVINLLDTPGHED   83 (267)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCHHHHHHCCCEEECCEEEEEECCEEEEEEECCCCHH
T ss_conf             79998479999899999999866863338546303688860468879998659448636378878998999997969778


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEE
Q ss_conf             467798774002331452012344332106778888631876023310023335612221101232100111
Q gi|254780263|r   84 YVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLK  155 (392)
Q Consensus        84 f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~  155 (392)
                      |+.++.++++.+|.|++||||.+|++.||+..+..++.+++|.+ ++|||||+.+.+  |+.+-+++++.|.
T Consensus        84 F~~e~~~al~v~D~AviVv~a~~GVe~~T~~~w~~a~~~~iP~i-ifINKmDr~~ad--f~~~l~~i~~~lg  152 (267)
T cd04169          84 FSEDTYRTLTAVDSAVMVIDAAKGVEPQTRKLFEVCRLRGIPII-TFINKLDREGRD--PLELLDEIEEELG  152 (267)
T ss_pred             HHHHHHHHHHHHHCEEEEEECCCCCCHHHHHHHHHHHHCCCCEE-EEEECCCCCCCC--HHHHHHHHHHHHC
T ss_conf             99999999988645479952566653558999999997299979-998534567898--7899999999868


No 71 
>cd01886 EF-G Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group conta
Probab=100.00  E-value=1.7e-37  Score=251.60  Aligned_cols=134  Identities=28%  Similarity=0.366  Sum_probs=117.4

Q ss_pred             EEEEEECCCCCHHHHHHHHHHH------HHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHH
Q ss_conf             9999904689887899999987------6444200131268686986292063789998219908999847873024677
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKY------YSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~------~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~   87 (392)
                      ||+++||+|||||||+++|+..      .++...+...+|..++|++||+||.++..+|+|++++|||||||||.||..+
T Consensus         1 Niai~gH~gaGKTtL~EalL~~ag~i~r~G~v~~g~tv~D~~~eE~~R~isi~~~~~~~~w~~~~inliDTPG~~DF~~e   80 (270)
T cd01886           1 NIGIIAHIDAGKTTTTERILYYTGRIHKIGEVHGGGATMDFMEQERERGITIQSAATTCFWKDHRINIIDTPGHVDFTIE   80 (270)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCHHHHHCCCEEECCEEEEEECCEEEEEEECCCCHHHHHH
T ss_conf             98999689999889999999866873558155389755668488987687073366899989989999869696788999


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCC--CHHHHHHCCC
Q ss_conf             987740023314520123443321067788886318760233100233356--1222110123
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVD--DDELLDISEY  148 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~--~~~~~~~i~~  148 (392)
                      +.++++.+|+|++||||.+|+++||+..+..++.+++|. +++|||||+-.  +++.++.+++
T Consensus        81 ~~~aL~~~D~AviVv~a~~GVe~~T~~~w~~~~~~~lP~-i~fINKmDre~ad~~~~l~~i~~  142 (270)
T cd01886          81 VERSLRVLDGAVAVFDAVAGVEPQTETVWRQADRYNVPR-IAFVNKMDRTGADFFRVVEQIRE  142 (270)
T ss_pred             HHHHHHHHCEEEEEEECCCCHHHHHHHHHHHHHHCCCCE-EEEEECCCCCCCCCHHHHHHHHH
T ss_conf             999987755599998467644263699998899849998-99998878778871668999999


No 72 
>TIGR00490 aEF-2 translation elongation factor aEF-2; InterPro: IPR004543   Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution.   Elongation factor EF2 (EF-G) is a G-protein. It brings about the translocation of peptidyl-tRNA and mRNA through a ratchet-like mechanism: the binding of GTP-EF2 to the ribosome causes a counter-clockwise rotation in the small ribosomal subunit; the hydrolysis of GTP to GDP by EF2 and the subsequent release of EF2 causes a clockwise rotation of the small subunit back to the starting position , . This twisting action destabilises tRNA-ribosome interactions, freeing the tRNA to translocate along the ribosome upon GTP-hydrolysis by EF2. EF2 binding also affects the entry and exit channel openings for the mRNA, widening it when bound to enable the mRNA to translocate along the ribosome.   This entry represents archaeal EF2 proteins (also known as aEF2), which are more similar to eukaryotic EF2 than to bacterial EF2 (or EFG), both in sequence similarity and in sharing with eukaryotes the property of having a diphthamide (modified His) residue at a conserved position. The diphthamide can be ADP-ribosylated by diphtheria toxin in the presence of NAD.   More information about these proteins can be found at Protein of the Month: Elongation Factors .; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005737 cytoplasm.
Probab=100.00  E-value=1.7e-37  Score=251.49  Aligned_cols=276  Identities=28%  Similarity=0.418  Sum_probs=202.6

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHH----HHHHCCCCCCCCHHHHHCCCEEEEEEEE----EECCCEEEEEEECCCCHHHH
Q ss_conf             999990468988789999998764----4420013126868698629206378999----82199089998478730246
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYS----EEKKEYGDIDSAPEEKLRGITIATAHVS----YETDKRFYSHIDCPGHADYV   85 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~----~~~~~~~~~D~~~~E~~rGiTi~~~~~~----~~~~~~~i~iiD~PGH~~f~   85 (392)
                      ||++++|+|||||||.+-|+...+    ..+.....+|..++|++|||||+.+...    |+.+.|.+|+||||||.||.
T Consensus        21 niGi~ahidhGkttlsdnllaGaGmis~elaG~q~~ldfde~e~~rGiti~aanvsmvh~yeG~~ylinlidtPGhvdfG  100 (724)
T TIGR00490        21 NIGIVAHIDHGKTTLSDNLLAGAGMISEELAGEQLYLDFDEQEQERGITIDAANVSMVHEYEGNEYLINLIDTPGHVDFG  100 (724)
T ss_pred             HEEEEEEECCCCCHHHHHHHHCCCHHHHHHCCCCEEECCCHHHHHCCCEEEEEEEEEEEEECCCCEEEEEECCCCCCCCC
T ss_conf             00037863177511223444213323454056410002441352377267641156765314750243331488621056


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCC------CC---HHHHHHCCCCCCEEEEE
Q ss_conf             7798774002331452012344332106778888631876023310023335------61---22211012321001110
Q gi|254780263|r   86 KNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAV------DD---DELLDISEYEIRDLLKE  156 (392)
Q Consensus        86 ~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v------~~---~~~~~~i~~~i~~~l~~  156 (392)
                      +.+.|++...|++++||+|.+|++|||...+..+..-.++++ ++|||+|+.      ++   ++|+-.+-.++.++++.
T Consensus       101 Gdvtramra~dG~~vvv~aveG~mPqtetvlrqal~e~v~Pv-lf~nkvdrli~el~l~~~~lq~r~~k~i~~~n~li~~  179 (724)
T TIGR00490       101 GDVTRAMRAVDGAIVVVCAVEGVMPQTETVLRQALKENVKPV-LFINKVDRLINELKLTPEELQERLIKIIAEVNKLIKK  179 (724)
T ss_pred             CHHHHHHHHHCCEEEEEEECCCCCCCHHHHHHHHHHHCCCEE-EEEHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             248888776476389995025657615789999987318706-7723478888862468889999999999999999974


Q ss_pred             E---EEEEEE-------ECCCCEEEEEEECCCCCCCC---------------------CC---CCCHHHHHHCCCCCCC-
Q ss_conf             1---453221-------02331146764114445652---------------------12---3320344310252222-
Q gi|254780263|r  157 H---KYSDDT-------PIIRGSALCALQGTNKELGE---------------------DS---IHALMKAVDTHIPTPQ-  201 (392)
Q Consensus       157 ~---~~~~~~-------pii~~sa~~g~~~~n~~~~~---------------------~~---~~~Ll~~i~~~~~~p~-  201 (392)
                      .   .|.+++       ..-..||...|...-+.+..                     .+   -..+|+.+..++|.|. 
T Consensus       180 m~P~~~~~~W~~~v~~Gs~afGsa~~nWa~~vP~~~~~Gi~f~~~~~~~~e~~~~ela~k~Pl~~v~l~mv~~hlPsP~e  259 (724)
T TIGR00490       180 MAPEEFKDKWKVRVEDGSVAFGSAYYNWAISVPIMKKTGITFKDIYKYIKEDKQKELAKKAPLHQVVLDMVIKHLPSPAE  259 (724)
T ss_pred             CCCCCHHCCCEEEECCCCCHHHHHHHHHEEECCCCCCCCCCHHHHHHHHHCCHHHHHHHHCCHHHHHHHHHHHHCCCCHH
T ss_conf             17610000004765156410112221000204430013775999999863011455764065889999999974489622


Q ss_pred             ------------------------CCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECC
Q ss_conf             ------------------------10000110000000135544543014874245348967999506874321254121
Q gi|254780263|r  202 ------------------------RSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDV  257 (392)
Q Consensus       202 ------------------------~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si  257 (392)
                                              .+.++|+-..|.++.-.+..|.|..||+++|.++.|+++++.....+ ..++-.++
T Consensus       260 ~q~~r~~~~W~Gd~~se~G~am~~~dP~GP~a~~~t~~~~~~~aG~~~~~r~y~G~i~~G~e~y~v~~~~k-~~~q~v~~  338 (724)
T TIGR00490       260 AQKYRIPVIWKGDLNSEAGKAMLNCDPEGPLAVMITKIVVDKHAGEVAVGRLYSGAIKKGSEVYLVDRKAK-ARIQQVGV  338 (724)
T ss_pred             HHHHHHHHHEECCCCCHHCCHHCCCCCCCCEEEEEEEEEEECCCCCEEEEEEECCEECCCCEEEEECCHHH-CCEEEEEE
T ss_conf             44401001010465400054210048998614455655660366816775553150036866898643000-21124667


Q ss_pred             CCC--CCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCC
Q ss_conf             001--21144321001366641124543220211773267
Q gi|254780263|r  258 EMF--RKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPG  295 (392)
Q Consensus       258 ~~~--~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~  295 (392)
                      ++.  |-++|+..||.++++.    ..++-..|.++|+++
T Consensus       339 ymGP~r~~~d~~~aGni~a~~----G~k~a~aG~t~C~~~  374 (724)
T TIGR00490       339 YMGPERVEVDEIPAGNIVAVV----GLKEAVAGETICSTD  374 (724)
T ss_pred             EECCEECCCCCCCCCCEEEEE----ECCCCCCCCCCCCCH
T ss_conf             766702012422677568874----032111453002521


No 73 
>KOG0469 consensus
Probab=100.00  E-value=4.9e-36  Score=242.47  Aligned_cols=282  Identities=26%  Similarity=0.372  Sum_probs=193.7

Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHHHHH----HHHHCCCCCCCCHHHHHCCCEEEEEEEEE--E--------------C
Q ss_conf             38827999990468988789999998764----44200131268686986292063789998--2--------------1
Q gi|254780263|r    9 NKESLGLSTIGHVDHGKTTLTAAITKYYS----EEKKEYGDIDSAPEEKLRGITIATAHVSY--E--------------T   68 (392)
Q Consensus         9 ~k~~~ni~~iGhvd~GKSTL~~~L~~~~~----~~~~~~~~~D~~~~E~~rGiTi~~~~~~~--~--------------~   68 (392)
                      .+.--|+.+|+|||||||||++.|..+.+    ..+.+...||+.++|+||||||.+....+  +              .
T Consensus        16 ~~NiRNmSVIAHVDHGKSTLTDsLV~kAgIis~akaGe~Rf~DtRkDEQeR~iTIKStAISl~~e~~~~dl~~~k~~~d~   95 (842)
T KOG0469          16 KKNIRNMSVIAHVDHGKSTLTDSLVQKAGIISAAKAGETRFTDTRKDEQERGITIKSTAISLFFEMSDDDLKFIKQEGDG   95 (842)
T ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHCEEEECCCCCCCCCCCCCCHHHCCEEEEEEEEEEHHHHHHHHHHHHCCCCCC
T ss_conf             23544204899843785500677877615124122678512434101565565763201320121317679985177877


Q ss_pred             CCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCC------CCHHH
Q ss_conf             990899984787302467798774002331452012344332106778888631876023310023335------61222
Q gi|254780263|r   69 DKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAV------DDDEL  142 (392)
Q Consensus        69 ~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v------~~~~~  142 (392)
                      +++.||+||.|||.||..++.++++..|+||+|||..+|+.-||+..+..|-.-.|++. +++||||++      ..+++
T Consensus        96 ~~FLiNLIDSPGHVDFSSEVTAALRVTDGALVVVDcv~GvCVQTETVLrQA~~ERIkPv-lv~NK~DRAlLELq~~~EeL  174 (842)
T KOG0469          96 NGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPV-LVMNKMDRALLELQLSQEEL  174 (842)
T ss_pred             CCEEEEECCCCCCCCCHHHHHHEEEECCCCEEEEECCCCEEECHHHHHHHHHHHHCCCE-EEEEHHHHHHHHHCCCHHHH
T ss_conf             63368951689854523442310473267089997247448525999999987433524-77414667888613789999


Q ss_pred             HH---HCCCCCCEEEEEEEEE--EE-------EECCCCEEEEEEECC--------------------------C---C-C
Q ss_conf             11---0123210011101453--22-------102331146764114--------------------------4---4-5
Q gi|254780263|r  143 LD---ISEYEIRDLLKEHKYS--DD-------TPIIRGSALCALQGT--------------------------N---K-E  180 (392)
Q Consensus       143 ~~---~i~~~i~~~l~~~~~~--~~-------~pii~~sa~~g~~~~--------------------------n---~-~  180 (392)
                      ++   .+.+-+.-.+..++..  .+       ..+-.+|.+.||.-.                          |   . .
T Consensus       175 yqtf~R~VE~vNviisTy~d~~~g~~~v~P~kg~v~F~SGLhGWaFTlrQFa~~Y~~KF~~~~~kmm~~LWg~~~f~~kt  254 (842)
T KOG0469         175 YQTFQRIVENVNVIISTYGDGPMGDVQVDPEKGTVGFGSGLHGWAFTLRQFAEMYAKKFGIDVRKMMNRLWGDNFFNPKT  254 (842)
T ss_pred             HHHHHHHHHCCCEEEEECCCCCCCCEEECCCCCCEEECCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCC
T ss_conf             99999997323179984146776734753777711003554114545999999999982876999999764013568667


Q ss_pred             CCCC-----------------------------------------------------------------------CCCCH
Q ss_conf             6521-----------------------------------------------------------------------23320
Q gi|254780263|r  181 LGED-----------------------------------------------------------------------SIHAL  189 (392)
Q Consensus       181 ~~~~-----------------------------------------------------------------------~~~~L  189 (392)
                      .+|.                                                                       -...|
T Consensus       255 kk~~~s~t~~~gn~~~r~F~~~iLdPIykvfdaimN~kkeei~~llekl~v~lk~~~kd~eGK~LlK~vMr~wLPAadal  334 (842)
T KOG0469         255 KKWSKSATDAEGNPLRRAFCMFILDPIYKVFDAIMNFKKEEIATLLEKLEVTLKGDEKDLEGKALLKVVMRKWLPAADAL  334 (842)
T ss_pred             CCCCCCCCCCCCCCCCCCEEEEEECHHHHHHHHHHHCCHHHHHHHHHHHCCEECCCCCCCCCHHHHHHHHHHHCCHHHHH
T ss_conf             76433234544685556415776036899999986012888999999741331252036654389999999745628889


Q ss_pred             HHHHHCCCCCC-------------------------CCCCCCCCCEECCCCCCCCCCCC-CEEEEEEECCCCCCCEEEEE
Q ss_conf             34431025222-------------------------21000011000000013554454-30148742453489679995
Q gi|254780263|r  190 MKAVDTHIPTP-------------------------QRSLDAPFLMHIEGSCGIEGRGT-VVTGCIKRGRIKAGSDVEII  243 (392)
Q Consensus       190 l~~i~~~~~~p-------------------------~~~~~~p~r~~I~~vf~i~g~G~-Vv~GrV~sG~l~~Gd~i~i~  243 (392)
                      |+.|.-++|+|                         ..+.++|+.|+|+.-..-+..|+ .++|||.||++..|+++.+.
T Consensus       335 lemIalhLPSPvtaQkyR~e~LYEGP~DDe~a~aik~CD~~aplmmYvSKMvPtsDkgRFyAFGRVFsG~v~~G~KvRiq  414 (842)
T KOG0469         335 LEMIALHLPSPVTAQKYRAEYLYEGPADDEAAVAIKNCDPKAPLMMYVSKMVPTSDKGRFYAFGRVFSGKVFTGLKVRIQ  414 (842)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCEEEEEEECCCCCCCCEEEEEEEEECCEECCCCEEEEE
T ss_conf             99998528990578888898761188735776676526999872775640165578742799733442301368578875


Q ss_pred             ECCCCCC---CEEEECCC-----C--CCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEEC
Q ss_conf             0687432---12541210-----0--1211443210013666411245432202117732
Q gi|254780263|r  244 GMGGKKL---KVKCTDVE-----M--FRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCA  293 (392)
Q Consensus       244 p~~~~~~---~~kv~si~-----~--~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~  293 (392)
                      .++..+-   ..-+++|+     |  +-++++.+.||.++|+  -|+|.--++.|-+-..
T Consensus       415 gPnY~PGkkedl~~K~iqRtvlMMGr~vepied~PaGNIiGl--vGvDqfLvKtGTiTt~  472 (842)
T KOG0469         415 GPNYVPGKKEDLYIKAIQRTVLMMGRFVEPIEDCPAGNIIGL--VGVDQFLVKTGTITTS  472 (842)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEE--EEHHHHHHCCCCEEEH
T ss_conf             899899708888898999999986265554566988757778--5166764304723205


No 74 
>KOG0464 consensus
Probab=100.00  E-value=1.7e-35  Score=239.19  Aligned_cols=266  Identities=24%  Similarity=0.274  Sum_probs=181.5

Q ss_pred             EEEEEECCCCCHHHHHHHHHHH------HHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHH
Q ss_conf             9999904689887899999987------6444200131268686986292063789998219908999847873024677
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKY------YSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~------~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~   87 (392)
                      ||++++|+|+||||.+.+|+..      .++...+...+|.+..||||||||.++...|.|+++++|+||||||.||.-+
T Consensus        39 nigiiahidagktttterily~ag~~~s~g~vddgdtvtdfla~erergitiqsaav~fdwkg~rinlidtpghvdf~le  118 (753)
T KOG0464          39 NIGIIAHIDAGKTTTTERILYLAGAIHSAGDVDDGDTVTDFLAIERERGITIQSAAVNFDWKGHRINLIDTPGHVDFRLE  118 (753)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCEEEEEEEECCCCCCEEEEECCCCCCEEEEE
T ss_conf             13069985178740678899774022104656788537788888886483665404421235616765248884037987


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCC--CHHHHHHCCCCCCE--EEEE------E
Q ss_conf             987740023314520123443321067788886318760233100233356--12221101232100--1110------1
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVD--DDELLDISEYEIRD--LLKE------H  157 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~--~~~~~~~i~~~i~~--~l~~------~  157 (392)
                      +.|-+...|+++.|+||+.|+++||...|..+...++|. ++++||||...  .+...+.+++.+..  ++-+      .
T Consensus       119 verclrvldgavav~dasagve~qtltvwrqadk~~ip~-~~finkmdk~~anfe~avdsi~ekl~ak~l~l~lpi~eak  197 (753)
T KOG0464         119 VERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKFKIPA-HCFINKMDKLAANFENAVDSIEEKLGAKALKLQLPIGEAK  197 (753)
T ss_pred             HHHHHHHHCCEEEEEECCCCCCCCEEEEEHHCCCCCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCC
T ss_conf             898887750738998456776641221000301357845-3302346665554666889999873874178970155324


Q ss_pred             EEEEE---------------------------------------------------------------------------
Q ss_conf             45322---------------------------------------------------------------------------
Q gi|254780263|r  158 KYSDD---------------------------------------------------------------------------  162 (392)
Q Consensus       158 ~~~~~---------------------------------------------------------------------------  162 (392)
                      +|+..                                                                           
T Consensus       198 ~fnkg~ldil~ke~l~~ncnsndgkd~e~~plle~ndpel~e~~ae~knal~~qlad~~~dfad~~ldef~~n~d~i~a~  277 (753)
T KOG0464         198 GFNKGFLDILHKEKLLGNCNSNDGKDFENKPLLEKNDPELAEELAEAKNALCEQLADLDADFADKFLDEFDENFDKIDAE  277 (753)
T ss_pred             CCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCHH
T ss_conf             54402799988743457778875444457864234897899999999999999886112778999998750553346789


Q ss_pred             ---------------EECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECC-------CCCCCCC
Q ss_conf             ---------------102331146764114445652123320344310252222100001100000-------0013554
Q gi|254780263|r  163 ---------------TPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIE-------GSCGIEG  220 (392)
Q Consensus       163 ---------------~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~-------~vf~i~g  220 (392)
                                     +|+...||          ....++..|++++.-++|.|+.-.-.-++.+-+       .+..++.
T Consensus       278 elksai~~lt~aq~a~~i~cgsa----------iknkgiqplldavtmylpspeernyeflqwykddlcalafkvlhdkq  347 (753)
T KOG0464         278 ELKSAIHELTCAQKAAPILCGSA----------IKNKGIQPLLDAVTMYLPSPEERNYEFLQWYKDDLCALAFKVLHDKQ  347 (753)
T ss_pred             HHHHHHHHHHHHHHHCCEEHHHH----------HCCCCCCCHHHHHHHCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999866632012220034----------40367651233443226883540227776520137777666530013


Q ss_pred             CCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCC-CCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECC
Q ss_conf             454301487424534896799950687432125412100-12114432100136664112454322021177326
Q gi|254780263|r  221 RGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEM-FRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAP  294 (392)
Q Consensus       221 ~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~-~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~  294 (392)
                      +|...+-|++||+++.+-.+.......+....+..--+. .+.++++..||.+. +. .|  ...--.||++.+.
T Consensus       348 rg~l~fmriysgsi~~~~ai~nin~~~se~~~kl~~pfade~~~i~qlsagnia-lt-~g--lk~tatgdtivas  418 (753)
T KOG0464         348 RGPLSFMRIYSGSIHNNLAIFNINGMCSEGILKLFLPFADEHREIEQLSAGNIA-LT-AG--LKHTATGDTIVAS  418 (753)
T ss_pred             CCCEEEEEEECCCCCCCEEEEECCCCCCCCHHHHHCCCHHHHHHHHHCCCCCEE-EE-EC--CEEECCCCEEEEC
T ss_conf             486268998615446761366226653311176535541543102120346479-99-50--1431257768833


No 75 
>KOG0467 consensus
Probab=99.98  E-value=1.1e-31  Score=215.50  Aligned_cols=125  Identities=26%  Similarity=0.458  Sum_probs=111.8

Q ss_pred             CEE-EEEEEECCCCCHHHHHHHHHHHHH----HHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHH
Q ss_conf             827-999990468988789999998764----442001312686869862920637899982199089998478730246
Q gi|254780263|r   11 ESL-GLSTIGHVDHGKTTLTAAITKYYS----EEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYV   85 (392)
Q Consensus        11 ~~~-ni~~iGhvd~GKSTL~~~L~~~~~----~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~   85 (392)
                      +++ |+.+++|||||||||.+.|....+    +.+.....||..++|+.||||+.++...+..++|.|||||+|||.||.
T Consensus         7 ~~irn~~~vahvdhgktsladsl~asngvis~rlagkirfld~redeq~rgitmkss~is~~~~~~~~nlidspghvdf~   86 (887)
T KOG0467           7 EGIRNICLVAHVDHGKTSLADSLVASNGVISSRLAGKIRFLDTREDEQTRGITMKSSAISLLHKDYLINLIDSPGHVDFS   86 (887)
T ss_pred             CCEEEEEEEEEECCCCCCHHHHHHHHCCEECHHHCCCEEECCCCCHHHHHCEEEECCCCCCCCCCEEEEEECCCCCCCHH
T ss_conf             75058999999648853257778750667415335606621046256661624431311101376589985589864506


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCC
Q ss_conf             779877400233145201234433210677888863187602331002333
Q gi|254780263|r   86 KNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDA  136 (392)
Q Consensus        86 ~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~  136 (392)
                      .++-++...+|.|+++||+.+|+.+||...+..+..-|.+. |.+|||||+
T Consensus        87 sevssas~l~d~alvlvdvvegv~~qt~~vlrq~~~~~~~~-~lvinkidr  136 (887)
T KOG0467          87 SEVSSASRLSDGALVLVDVVEGVCSQTYAVLRQAWIEGLKP-ILVINKIDR  136 (887)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCE-EEEEEHHHH
T ss_conf             55326665047718999600254553899999999716745-999731666


No 76 
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states.  Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments.  This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=99.97  E-value=3.5e-32  Score=218.63  Aligned_cols=157  Identities=33%  Similarity=0.439  Sum_probs=118.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEE---CCCEEEEEEECCCCHHHHHHHHH
Q ss_conf             999990468988789999998764442001312686869862920637899982---19908999847873024677987
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYE---TDKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~---~~~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      -|+++||+|||||||+.+|++..            ...+..+|+|.++++..++   ++++.|+|+|||||++|...+.+
T Consensus         2 ~VaivG~~n~GKSTL~n~L~~~~------------~~~~~~~g~T~~i~~~~~~~~~~~~~~i~~iDTPGh~~f~~~~~~   69 (168)
T cd01887           2 VVTVMGHVDHGKTTLLDKIRKTN------------VAAGEAGGITQHIGAFEVPAEVLKIPGITFIDTPGHEAFTNMRAR   69 (168)
T ss_pred             EEEEEECCCCCHHHHHHHHHCCC------------CCEEECCCCEEEECEEEEEEEECCCCEEEEEECCCCHHHHHHHHH
T ss_conf             89999489985989999985867------------504516981687153999988258871899989981677999999


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEE--EEEEEEEEEECCCC
Q ss_conf             7400233145201234433210677888863187602331002333561222110123210011--10145322102331
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLL--KEHKYSDDTPIIRG  168 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l--~~~~~~~~~pii~~  168 (392)
                      +++.+|.++|||||.+|+++||+||+.+++.+++| +|+++||||+++++.  +.+..++.++.  ....+....|++|+
T Consensus        70 ~~~~aD~~ilvvda~~g~~~~~~~~~~~l~~~~~p-~ivviNKiD~~~~~~--~~v~~~l~~~~~~~~~~~~~~~~iIpv  146 (168)
T cd01887          70 GASLTDIAILVVAADDGVMPQTIEAIKLAKAANVP-FIVALNKIDKPNANP--ERVKNELSELGLQGEDEWGGDVQIVPT  146 (168)
T ss_pred             HHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCH--HHHHHHHHHHHCCCHHHCCCCCEEEEE
T ss_conf             98626889999864667545899999999876997-899998930898798--999999999754524552898759999


Q ss_pred             EEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             146764114445652123320344310
Q gi|254780263|r  169 SALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       169 sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                      ||.+|.          +++.|+++|..
T Consensus       147 SA~tG~----------gi~~L~~~i~~  163 (168)
T cd01887         147 SAKTGE----------GIDDLLEAILL  163 (168)
T ss_pred             ECCCCC----------CHHHHHHHHHH
T ss_conf             899998----------99999999999


No 77 
>KOG1144 consensus
Probab=99.95  E-value=8.2e-29  Score=197.72  Aligned_cols=231  Identities=24%  Similarity=0.327  Sum_probs=162.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCC------------------EEEEEE
Q ss_conf             99990468988789999998764442001312686869862920637899982199------------------089998
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK------------------RFYSHI   76 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~------------------~~i~ii   76 (392)
                      ++|+||||.|||-|++.|-+.            +-.+.-.-|||..++.++|.-.+                  -.+-+|
T Consensus       478 cCilGHVDTGKTKlld~ir~t------------NVqegeaggitqqIgAt~fp~~ni~e~tk~~~~~~K~~~kvPg~lvI  545 (1064)
T KOG1144         478 CCILGHVDTGKTKLLDKIRGT------------NVQEGEAGGITQQIGATYFPAENIREKTKELKKDAKKRLKVPGLLVI  545 (1064)
T ss_pred             EEEEECCCCCCHHHHHHHHCC------------CCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             789711126605788876205------------53224456600000541152677899999987502331378704896


Q ss_pred             ECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCC-C----------------
Q ss_conf             47873024677987740023314520123443321067788886318760233100233356-1----------------
Q gi|254780263|r   77 DCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVD-D----------------  139 (392)
Q Consensus        77 D~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~-~----------------  139 (392)
                      |||||+.|..---||.+.||.||||||...|++|||.|.+.+++..+.| |||++||+|+.- |                
T Consensus       546 dtpghEsFtnlRsrgsslC~~aIlvvdImhGlepqtiESi~lLR~rktp-FivALNKiDRLYgwk~~p~~~i~~~lkkQ~  624 (1064)
T KOG1144         546 DTPGHESFTNLRSRGSSLCDLAILVVDIMHGLEPQTIESINLLRMRKTP-FIVALNKIDRLYGWKSCPNAPIVEALKKQK  624 (1064)
T ss_pred             CCCCCHHHHHHHHCCCCCCCEEEEEEEHHCCCCCCHHHHHHHHHHCCCC-EEEEEHHHHHHCCCCCCCCCHHHHHHHHHH
T ss_conf             5887255555665043345537778531116774206789988754897-598610134440442489831999998744


Q ss_pred             -------HHHHHHCCCCCCE-------EEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCC---CC
Q ss_conf             -------2221101232100-------111014532210233114676411444565212332034431025222---21
Q gi|254780263|r  140 -------DELLDISEYEIRD-------LLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTP---QR  202 (392)
Q Consensus       140 -------~~~~~~i~~~i~~-------~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p---~~  202 (392)
                             ..|++.+..++.+       |++......-+.++|.||++|          ++++.|+-.|..+-...   .-
T Consensus       625 k~v~~EF~~R~~~ii~efaEQgLN~~LyykNk~~~~~vsiVPTSA~sG----------eGipdLl~llv~ltQk~m~~kl  694 (1064)
T KOG1144         625 KDVQNEFKERLNNIIVEFAEQGLNAELYYKNKEMGETVSIVPTSAISG----------EGIPDLLLLLVQLTQKTMVEKL  694 (1064)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHEEECCCCCCEEEEEECCCCCC----------CCHHHHHHHHHHHHHHHHHHHH
T ss_conf             789999999999999999971104434231467465588621221367----------8807899999999999999877


Q ss_pred             CCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCC-------------CEEEECCCCCCCCCCCCC
Q ss_conf             000011000000013554454301487424534896799950687432-------------125412100121144321
Q gi|254780263|r  203 SLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKL-------------KVKCTDVEMFRKKLDEAI  268 (392)
Q Consensus       203 ~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~-------------~~kv~si~~~~~~v~~a~  268 (392)
                      ..-.-++..|..|-.+.|.|+.+---+..|.|+.||.|.+++++|..+             .-+|++-|+|++++.-|.
T Consensus       695 ~y~~ev~cTVlEVKvieG~GtTIDViLvNG~L~eGD~IvvcG~~GpIvTtIRaLLtP~PlkElRVk~~Y~hhkEvkaA~  773 (1064)
T KOG1144         695 AYVDEVQCTVLEVKVIEGHGTTIDVILVNGELHEGDQIVVCGLQGPIVTTIRALLTPQPLKELRVKGTYVHHKEVKAAQ  773 (1064)
T ss_pred             HHHHHEEEEEEEEEEECCCCCEEEEEEECCEECCCCEEEECCCCCCHHHHHHHHCCCCCHHHHCCCCCEEEHHHHHHHC
T ss_conf             4240100478998752377716899987565526987998279986168889763886447641055332366756530


No 78 
>KOG0468 consensus
Probab=99.95  E-value=1.1e-27  Score=190.83  Aligned_cols=124  Identities=27%  Similarity=0.396  Sum_probs=105.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHH-----HCCCCCCCCHHHHHCCCEEEEEEEEE-----ECCCEEEEEEECCCCH
Q ss_conf             7999990468988789999998764442-----00131268686986292063789998-----2199089998478730
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEK-----KEYGDIDSAPEEKLRGITIATAHVSY-----ETDKRFYSHIDCPGHA   82 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~-----~~~~~~D~~~~E~~rGiTi~~~~~~~-----~~~~~~i~iiD~PGH~   82 (392)
                      .|++++||-.||||+|++.|....+...     .....+|.+..|++||++|.+.-...     +.+.|-+||+|||||.
T Consensus       129 rnV~l~GhLhhGKT~l~D~Lv~~tHp~~~~~~e~~lrytD~l~~E~eRg~sIK~~p~Tl~l~D~~~KS~l~nilDTPGHV  208 (971)
T KOG0468         129 RNVGLVGHLHHGKTALMDLLVEQTHPDFSKNTEADLRYTDTLFYEQERGCSIKSTPVTLVLSDSKGKSYLMNILDTPGHV  208 (971)
T ss_pred             EEEEEEECCCCCHHHHHHHHCEECCCCCCCCCCCCCCCCCCCHHHHHCCCEEEECCEEEEEECCCCCEEEEEEECCCCCC
T ss_conf             99988611456715787763131346555542356313664245675485676132289985676724335552588755


Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             2467798774002331452012344332106778888631876023310023335
Q gi|254780263|r   83 DYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAV  137 (392)
Q Consensus        83 ~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v  137 (392)
                      +|+-+|.++++++|+++|+|||.+|++=+|.+-+..+-.-..+ ++|||||||+.
T Consensus       209 nF~DE~ta~l~~sDgvVlvvDv~EGVmlntEr~ikhaiq~~~~-i~vviNKiDRL  262 (971)
T KOG0468         209 NFSDETTASLRLSDGVVLVVDVAEGVMLNTERIIKHAIQNRLP-IVVVINKVDRL  262 (971)
T ss_pred             CCHHHHHHHHHHCCEEEEEEECCCCCEEEHHHHHHHHHHCCCC-EEEEEEHHHHH
T ss_conf             5068888886523637999982257052099999998742676-79997416789


No 79 
>TIGR00491 aIF-2 translation initiation factor aIF-2; InterPro: IPR004544 Initiation factor 2 (IF-2) is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-2 promotes the GTP-dependent binding of the initiator tRNA to the small subunit of the ribosome. IF-2 is a protein of about 70 to 95 Kd which contains a central GTP-binding domain flanked by a highly variable N-terminal domain and a more conserved C-terminal domain. Some members of this family undergo protein self splicing that involves a post-translational excision of the intein followed by peptide ligation.; GO: 0003743 translation initiation factor activity, 0005525 GTP binding, 0006413 translational initiation, 0005622 intracellular.
Probab=99.95  E-value=2.6e-28  Score=194.63  Aligned_cols=224  Identities=26%  Similarity=0.291  Sum_probs=157.4

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC-----------CEE------
Q ss_conf             882799999046898878999999876444200131268686986292063789998219-----------908------
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD-----------KRF------   72 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~-----------~~~------   72 (392)
                      -++-|+.--|=|=| -|||++++ ++..-..++.|           |||..+|.+...++           ...      
T Consensus       549 tethnfianGivvh-nTTLLDkI-Rks~Vv~kEAG-----------giTQhiGAsevP~dVI~~ic~Dl~K~f~i~~~iP  615 (1145)
T TIGR00491       549 TETHNFIANGIVVH-NTTLLDKI-RKSAVVKKEAG-----------GITQHIGASEVPLDVIKKICGDLLKKFKIKLKIP  615 (1145)
T ss_pred             CCHHHHHHCCEEEE-CCCCCCCC-CCCCEEEECCC-----------CCCEECCCEECCHHHHHHHCHHHHHCEEEEEECC
T ss_conf             00012322664785-14331000-33401324778-----------8401006665466898651321211402578658


Q ss_pred             -EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCC-CH--H-------
Q ss_conf             -999847873024677987740023314520123443321067788886318760233100233356-12--2-------
Q gi|254780263|r   73 -YSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVD-DD--E-------  141 (392)
Q Consensus        73 -i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~-~~--~-------  141 (392)
                       +-|||||||+-|+-==-||=|.||.||||||-.||.+|||.|.+.+++..+.| ||||-||+|+++ |+  +       
T Consensus       616 GLLfIDTPGHeaFt~LRkRGGAlADlAILvVDInEGfkpQT~EA~~ILr~~ktP-FvVAANKIDrI~GW~~~e~~~fl~~  694 (1145)
T TIGR00491       616 GLLFIDTPGHEAFTNLRKRGGALADLAILVVDINEGFKPQTEEALNILRSFKTP-FVVAANKIDRIPGWKSHEGRPFLES  694 (1145)
T ss_pred             EEEEEECCCCHHHHCCCCCCCHHHHHHEEEEEECCCCCHHHHHHHHHHHCCCCC-EEEEECCCCCCCCCCCCCCCHHHHH
T ss_conf             015860786234422010010363011013410269840348999996128987-2895033055889645488516666


Q ss_pred             -----------HHHHCCCCCCE-EEEEEEEEE-----------EEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHC---
Q ss_conf             -----------21101232100-111014532-----------2102331146764114445652123320344310---
Q gi|254780263|r  142 -----------LLDISEYEIRD-LLKEHKYSD-----------DTPIIRGSALCALQGTNKELGEDSIHALMKAVDT---  195 (392)
Q Consensus       142 -----------~~~~i~~~i~~-~l~~~~~~~-----------~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~---  195 (392)
                                 ..+.+.+.+-. -|.+.||+.           .+-+||+||++|          ++++.||-.|.-   
T Consensus       695 ~~kq~~~~~~~l~~~~y~lv~~kPL~e~GF~AerFdRv~Dft~tVaviPvSA~tG----------EGIpelL~~l~GLAQ  764 (1145)
T TIGR00491       695 YEKQEQRVKQNLDKKVYNLVIKKPLAEEGFEAERFDRVRDFTRTVAVIPVSAVTG----------EGIPELLLILAGLAQ  764 (1145)
T ss_pred             HHHCCHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCCEECEEEEEEEEEEECCCC----------CCHHHHHHHHHHHHH
T ss_conf             5411167886688778988730221125887122552000011368988665678----------974899999988888


Q ss_pred             -CCCCCC-CCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCC
Q ss_conf             -252222-100001100000001355445430148742453489679995068743212541210
Q gi|254780263|r  196 -HIPTPQ-RSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVE  258 (392)
Q Consensus       196 -~~~~p~-~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~  258 (392)
                       |+...- -..++|.|=.|-+|=--.|-|..+=--++-|++|+||.+.+...+. ...++|++|-
T Consensus       765 ~YL~~~Lkl~~eG~AkGtiLEVKEe~GLG~T~DaviYdGilk~~D~iv~~~~d~-vivT~vkAlL  828 (1145)
T TIGR00491       765 KYLEEKLKLEVEGPAKGTILEVKEEKGLGVTIDAVIYDGILKKGDIIVLAGKDD-VIVTRVKALL  828 (1145)
T ss_pred             HHHHHHCCEEECCCCCEEEEEEEEECCCCCEEEEEEECCEECCCCEEEEECCCC-CEEEEEEEEC
T ss_conf             998852674222786515898785068971699999557712078899813898-0576678634


No 80 
>TIGR00487 IF-2 translation initiation factor IF-2; InterPro: IPR000178 Initiation factor 2 (IF-2) (gene infB)  is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-2 promotes the GTP-dependent binding of the initiator tRNA to the small subunit of the ribosome. IF-2 is a protein of about 70 to 95 Kd which contains a central GTP-binding domain flanked by a highly variable N-terminal domain and a more conserved C-terminal domain. Bacterial IF-2 is structurally and functionally related to eukaryotic mitochondrial IF-2 (IF-2(mt))  as well as to algal and plants chloroplast IF-2 (IF-2(chl)). Both IF-2(mt) and IF-2(chl) are encoded by nuclear genes and are produced as precursor proteins with a transit peptide. An exception are red algae where IF-2(chl) is encoded by the plastid genome .; GO: 0003743 translation initiation factor activity, 0005525 GTP binding, 0006413 translational initiation, 0005622 intracellular.
Probab=99.90  E-value=2.1e-23  Score=164.22  Aligned_cols=235  Identities=27%  Similarity=0.340  Sum_probs=164.7

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCE--EEEEEECCCCHHHH
Q ss_conf             0388279999904689887899999987644420013126868698629206378999821990--89998478730246
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKR--FYSHIDCPGHADYV   85 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~--~i~iiD~PGH~~f~   85 (392)
                      ..+|.+ +.+.||+|||||+|++.+-...-.            +-..-|+|..++..+.+.++.  .++|+|+|||+.|.
T Consensus        87 ~~~pp~-~~~~gh~dhg~~~ll~~~~~~~~~------------~~~~gg~~~~~g~y~~~~~~~~~~~~f~d~pgh~~f~  153 (594)
T TIGR00487        87 VPRPPV-VTIMGHVDHGKTSLLDSIRKTKVA------------AGEAGGITQHIGAYHVEKEDGKKWITFLDTPGHEAFT  153 (594)
T ss_pred             HCCCCE-EEEEECCCCCCHHHHHHHHHCCCC------------CCCCCCCHHHCCEEEEEECCCCEEEEEECCCCHHHHH
T ss_conf             024763-688512355403456555410000------------1113652010130456642884379984077536778


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEE-EEEEEEEEEEE
Q ss_conf             77987740023314520123443321067788886318760233100233356122211012321001-11014532210
Q gi|254780263|r   86 KNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDL-LKEHKYSDDTP  164 (392)
Q Consensus        86 ~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~-l~~~~~~~~~p  164 (392)
                      .--.+|+...|.++++++|.+|++|||.|.+..++..++| +++++||+|..+.+  .+.++.++.++ +....|..+..
T Consensus       154 ~~~~~g~~~~d~~~~~~~~~dg~~~~~~~~~~h~~~~~~p-~~~~~n~~d~p~~~--pd~~~~~~~~~g~~~~~wgg~~~  230 (594)
T TIGR00487       154 LMRARGAKVTDIVVLVVAADDGVKPQTIEAISHAKAANVP-LIVAVNKIDKPEAN--PDRVKQELSEYGLVPEDWGGDTI  230 (594)
T ss_pred             HHHHCCCCEEEEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCC--HHHHHHHHHHCCCCCHHCCCCEE
T ss_conf             7763376100157999841556423568876533330773-69986124676678--77899998751775011278346


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCC--CCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEE
Q ss_conf             233114676411444565212332034431025--222210000110000000135544543014874245348967999
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTHI--PTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEI  242 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~--~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i  242 (392)
                      +++.|++.|.          .+..|++.+.-.-  .......++...-.+.+.+...|+|.+.+-.+.+|++++||.+..
T Consensus       231 ~~~~~~~~g~----------g~~~l~~~~l~~~~~~~~~~~~~~~~~g~~~~~~~~~g~g~~~~~~~~~g~l~~gd~~~~  300 (594)
T TIGR00487       231 FVPVSALTGD----------GIDELLDAILLQSEVEELKANPNGQASGTVLEAELDKGRGPVATVLVQSGTLRVGDSVVL  300 (594)
T ss_pred             EEEEECCCCC----------CHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCEEEEEEECCCEECCCEEEE
T ss_conf             8862001367----------657888888876434443203232222025641001365632456661472011641352


Q ss_pred             EECCCCCCCEEEECCCCC-CCCCCCCCCCHHH
Q ss_conf             506874321254121001-2114432100136
Q gi|254780263|r  243 IGMGGKKLKVKCTDVEMF-RKKLDEAIAGDNV  273 (392)
Q Consensus       243 ~p~~~~~~~~kv~si~~~-~~~v~~a~aGd~v  273 (392)
                      .+.     ..+++.+... ...++.+.|.-.+
T Consensus       301 g~~-----~g~~~~~~~~~g~~~~~~~p~~~~  327 (594)
T TIGR00487       301 GAA-----YGKVRALIDENGKSVKEAGPSKPV  327 (594)
T ss_pred             ECC-----CCHHHHHHHHCCCHHHHCCCCCEE
T ss_conf             032-----110000120024211212765215


No 81 
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=99.88  E-value=3e-22  Score=156.97  Aligned_cols=159  Identities=28%  Similarity=0.344  Sum_probs=118.1

Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC---------H
Q ss_conf             2799999046898878999999876444200131268686986292063789998219908999847873---------0
Q gi|254780263|r   12 SLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH---------A   82 (392)
Q Consensus        12 ~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH---------~   82 (392)
                      .++|+++|+.++|||||+.+|++....      ..     ....|.|.+.-...+++++..+.|+||||-         .
T Consensus         2 ~~~V~ivG~pN~GKSTL~N~l~g~~~~------~v-----s~~pgtTr~~~~~~~~~~~~~~~~vDtpGi~~~~~~~~~~   70 (174)
T cd01895           2 PIRIAIIGRPNVGKSSLVNALLGEERV------IV-----SDIAGTTRDSIDVPFEYDGKKYTLIDTAGIRRKGKVEEGI   70 (174)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCE------EE-----CCCCCCEEECCEEEEEECCEEEEEEECCCCCCCCCCCCHH
T ss_conf             989999989999899999998389844------43-----4999915733289999999889998578842134421068


Q ss_pred             HH--HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHH-HHHHCCCCCCEEEEEEEE
Q ss_conf             24--677987740023314520123443321067788886318760233100233356122-211012321001110145
Q gi|254780263|r   83 DY--VKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDE-LLDISEYEIRDLLKEHKY  159 (392)
Q Consensus        83 ~f--~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~-~~~~i~~~i~~~l~~~~~  159 (392)
                      ++  +..+...+..+|.+++|+||++++..|..+.+..+...+.| +++++||+|+++.++ ..+..+.++.+.+...  
T Consensus        71 e~~~~~~~~~~i~~~dvil~viDa~~~~~~~d~~i~~~l~~~~~p-~iiv~NK~Dli~~~~~~~~~~~~~~~~~~~~~--  147 (174)
T cd01895          71 EKYSVLRTLKAIERADVVLLVIDATEGITEQDLRIAGLILEEGKA-LVIVVNKWDLVEKDSKTMKEFKKEIRRKLPFL--  147 (174)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECEECCCCCHHHHHHHHHHHHHHHCCC--
T ss_conf             899999999999842865899758989988999999999985998-69998567526764778999999999873416--


Q ss_pred             EEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             322102331146764114445652123320344310
Q gi|254780263|r  160 SDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       160 ~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                       ...|++++||.+|.          +++.|+++|.+
T Consensus       148 -~~~~ii~iSA~~g~----------Gi~~L~~~I~e  172 (174)
T cd01895         148 -DYAPIVFISALTGQ----------GVDKLFDAIDE  172 (174)
T ss_pred             -CCCCEEEEECCCCC----------CHHHHHHHHHH
T ss_conf             -89928999744798----------99999999998


No 82 
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages. EF-1A is very abundant in the cytosol, where it is involved in the GTP-dependent binding of aminoacyl-tRNAs to the A site of the ribosomes in the second step of translation from mRNAs to proteins. Both domain II of EF1A and domain IV of IF2/eIF5B have been implicated in recognition of the 3'-ends of tRNA. More than 61% of eukaryotic elongation factor 1A (eEF-1A) in cells is estimated to be associated with actin cytoskeleton. The binding of eEF1A to actin is a noncanonical function that may link two distinct cellular processes, cytoskeleton organization and gene expression.
Probab=99.87  E-value=3.1e-23  Score=163.16  Aligned_cols=90  Identities=33%  Similarity=0.544  Sum_probs=84.6

Q ss_pred             CCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCC
Q ss_conf             00011000000013554454301487424534896799950687432125412100121144321001366641124543
Q gi|254780263|r  204 LDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRA  283 (392)
Q Consensus       204 ~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~  283 (392)
                      .|+||||||+++|+++|.|+|++|+|++|++++||++.++|.+   ..++|++||+|++++++|.|||+|+++|+|++..
T Consensus         1 ~dkPlRmpId~vf~i~G~GtVvtG~v~~G~i~~gd~v~i~P~~---~~~~VksI~~~~~~~~~a~aGd~v~l~L~gi~~~   77 (91)
T cd03693           1 TDKPLRLPIQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPAG---VTGEVKSVEMHHEPLEEALPGDNVGFNVKNVSKK   77 (91)
T ss_pred             CCCCEEEEEEEEEECCCCEEEEEEEEEECEEECCCEEEECCCC---CEEEEEEEEECCCCCCEECCCCEEEEEECCCCHH
T ss_conf             9987588998899729956999999811778579997727864---3379999999884958888998999998799899


Q ss_pred             EEECHHEEECCCC
Q ss_conf             2202117732677
Q gi|254780263|r  284 DVPRGRVVCAPGS  296 (392)
Q Consensus       284 di~rGdvl~~~~~  296 (392)
                      +++||||||++.+
T Consensus        78 ~i~rG~Vl~~~~n   90 (91)
T cd03693          78 DIKRGDVAGDSKN   90 (91)
T ss_pred             HCCCCCEEECCCC
T ss_conf             9267689955689


No 83 
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II. Elongation factors Tu (EF-Tu) are three-domain GTPases with an essential function in the elongation phase of mRNA translation. The GTPase center of EF-Tu is in the N-terminal domain (domain I), also known as the catalytic or G-domain. The G-domain is composed of about 200 amino acid residues, arranged into a predominantly parallel six-stranded beta-sheet core surrounded by seven a-helices. Non-catalytic domains II and III are beta-barrels of seven and six, respectively, antiparallel beta-strands that share an extended interface. Either non-catalytic domain is composed of about 100 amino acid residues.  EF-Tu proteins exist in two principal conformations: in a compact one, EF-Tu*GTP, with tight interfaces between all three domains and a high affinity for aminoacyl-tRNA, and in an open one, EF-Tu*GDP, with essentially no G-domain-domain II interactions and a low affinity for aminoacyl-tRNA. EF-Tu has approximately a 100-fold higher
Probab=99.85  E-value=3.4e-22  Score=156.69  Aligned_cols=87  Identities=64%  Similarity=1.010  Sum_probs=82.2

Q ss_pred             CCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEC
Q ss_conf             10000000135544543014874245348967999506874321254121001211443210013666411245432202
Q gi|254780263|r  208 FLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPR  287 (392)
Q Consensus       208 ~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~r  287 (392)
                      |||||+++|+++|.|+|++|+|++|++++||++.++|.. +..+++|+|||+|++++++|.|||+|+++|+|++.++++|
T Consensus         1 F~m~Id~~f~v~G~GtVvtGtv~~G~i~~gd~v~i~~~~-~~~~~~V~sIq~~~~~v~~a~aG~rv~l~l~gi~~~~i~r   79 (87)
T cd03697           1 FLMPIEDVFSIPGRGTVVTGRIERGTIKVGDEVEIVGFG-ETLKTTVTGIEMFRKTLDEAEAGDNVGVLLRGVKREDVER   79 (87)
T ss_pred             CEEEEEEEEECCCEEEEEEEEECCCCEECCCEEEEECCC-CCCEEEEEEEHHCCCCCCCCCCCCEEEEEECCCCHHHCCC
T ss_conf             973681699669868999999552608479999997289-9718999990871943353798679999985888898377


Q ss_pred             HHEEECCC
Q ss_conf             11773267
Q gi|254780263|r  288 GRVVCAPG  295 (392)
Q Consensus       288 Gdvl~~~~  295 (392)
                      ||+||+|+
T Consensus        80 G~vl~~pG   87 (87)
T cd03697          80 GMVLAKPG   87 (87)
T ss_pred             CCEEECCC
T ss_conf             03994799


No 84 
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=99.84  E-value=1.5e-20  Score=146.51  Aligned_cols=166  Identities=22%  Similarity=0.266  Sum_probs=119.5

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCH----HHHH----
Q ss_conf             99990468988789999998764442001312686869862920637899982199089998478730----2467----
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHA----DYVK----   86 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~----~f~~----   86 (392)
                      |+++|-...|||||..+|++....      -+..     .-|.|.|.-+..++++++.+.++||||-.    ++.+    
T Consensus         2 VaIvGrpNVGKStLfN~L~~~~~a------Iv~~-----~~G~TRD~~~~~~~~~~~~~~liDT~G~~~~~~~~~~~~~~   70 (429)
T TIGR03594         2 VAIVGRPNVGKSTLFNRLTGKRDA------IVAD-----TPGVTRDRKYGDAEWGGREFILIDTGGIEEDDDGLDKQIRE   70 (429)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCEE------ECCC-----CCCCCCCCEEEEEEECCEEEEEEECCCCCCCCHHHHHHHHH
T ss_conf             899999998789999998788617------6159-----89988773379999999079999898989874378999999


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             79877400233145201234433210677888863187602331002333561222110123210011101453221023
Q gi|254780263|r   87 NMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        87 ~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
                      ....++..+|.+++||||.+|+.++-.+.+..++..+-| +|+++||+|....++       ...+ +-.+|+.+   .+
T Consensus        71 q~~~ai~~aDlIlfVvD~~~git~~D~~i~~~Lrk~~k~-vilviNK~D~~~~~~-------~~~e-f~~LG~~~---~i  138 (429)
T TIGR03594        71 QAEIAIEEADVILFVVDGREGLTPEDEEIAKWLRKSGKP-VILVANKIDGKKEDA-------VAAE-FYSLGFGE---PI  138 (429)
T ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCHHH-------HHHH-HHHHCCCC---EE
T ss_conf             999999867999999857768986799999999871997-899998346753145-------6999-99836898---68


Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCC---CCCCCCCCEECC
Q ss_conf             31146764114445652123320344310252222---100001100000
Q gi|254780263|r  167 RGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQ---RSLDAPFLMHIE  213 (392)
Q Consensus       167 ~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~---~~~~~p~r~~I~  213 (392)
                      ++||..+.          ++..|++.+...+|...   ...+.++++.|-
T Consensus       139 ~iSA~h~~----------Gi~~L~~~i~~~l~~~~~~~~~~~~~iriaiv  178 (429)
T TIGR03594       139 PISAEHGR----------GIGDLLDAILELLPEEEEEEEEEDGPIKIAII  178 (429)
T ss_pred             EEEECCCC----------CHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEE
T ss_conf             87420467----------99999999996588665554345565269997


No 85 
>pfam03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain. Elongation factor Tu consists of three structural domains, this is the third domain. This domain adopts a beta barrel structure. This the third domain is involved in binding to both charged tRNA and binding to EF-Ts pfam00889.
Probab=99.83  E-value=7.1e-20  Score=142.30  Aligned_cols=96  Identities=50%  Similarity=0.889  Sum_probs=90.9

Q ss_pred             CCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEE-ECCCHHHHCCCCEEEEEEEECCCEEECCCCEEE
Q ss_conf             7763000168999710567875555115978999954147779999-618955707897699999977817754698499
Q gi|254780263|r  296 SIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRII-LSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFS  374 (392)
Q Consensus       296 ~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~-~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfi  374 (392)
                      ++.++++|+|++++|+.+++++.+++.++|+++++|.++++++++. ..++++.+++||.+.++++|.+|+|+|+++||+
T Consensus         1 p~k~~~~F~AqvyiL~~~eggr~tpi~~~y~~~~~~~t~~~~~~i~~~~~~~~~v~pGd~a~v~i~l~~p~~ie~~~rF~   80 (97)
T pfam03143         1 PIKPHTKFKAQVYILNHPEGGGYTPFFDGYTPQFYCRTTDVTGKIKVLEEGPEFVMPGDNAIVTVELIKPIAVEPGGRFA   80 (97)
T ss_pred             CCCCCCEEEEEEEEEECCCCCCCCCEEECCEEEEEEEEEEEEEEEEECCCCCEEECCCCCEEEEEEECCCEEEECCCEEE
T ss_conf             98231199999999988978997647046277999998888888877388970870799569999979749996176299


Q ss_pred             EEECCEEEEEEEEEEEE
Q ss_conf             99899699989995531
Q gi|254780263|r  375 MREGGKTVGAGLILEII  391 (392)
Q Consensus       375 lRd~~~tig~G~I~~v~  391 (392)
                      |||+|+|||+|.|++|+
T Consensus        81 iRe~g~Tv~~G~V~~vl   97 (97)
T pfam03143        81 IREGGRTVAVGVVTEVL   97 (97)
T ss_pred             EEECCEEEEEEEEEEEC
T ss_conf             99899399999999809


No 86 
>PRK00093 engA GTP-binding protein EngA; Reviewed
Probab=99.83  E-value=4e-20  Score=143.84  Aligned_cols=168  Identities=20%  Similarity=0.242  Sum_probs=125.2

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCH-----HHHHH-
Q ss_conf             999990468988789999998764442001312686869862920637899982199089998478730-----24677-
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHA-----DYVKN-   87 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~-----~f~~~-   87 (392)
                      .|+++|-...|||||..+|++...      +-++..     -|.|.|.-+..+++.++.++|+||||-.     .|.+. 
T Consensus         3 ~VaIvGrpNvGKStLfN~l~~~~~------aIv~~~-----~G~TRD~~~~~~~~~~~~~~lvDT~G~~~~~~~~~~~~i   71 (438)
T PRK00093          3 VVAIVGRPNVGKSTLFNRLTGKRD------AIVADT-----PGVTRDRIYGEAEWLGREFIVIDTGGIDPGDEDGFEKQM   71 (438)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCE------EEECCC-----CCCCCCCEEEEEEECCEEEEEEECCCCCCCCCHHHHHHH
T ss_conf             899989999878999999868861------871598-----999847158999999928999989798988820799999


Q ss_pred             ---HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             ---98774002331452012344332106778888631876023310023335612221101232100111014532210
Q gi|254780263|r   88 ---MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        88 ---mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                         ...++..+|.+++||||.+|+.++-.+.+..++..+-| +|+++||+|....+.       ...++ -.+|+.+   
T Consensus        72 ~~q~~~ai~~aDlIlfVvD~~~git~~D~~i~~~Lrk~~k~-vilviNK~D~~~~~~-------~~~ef-~~LGf~~---  139 (438)
T PRK00093         72 REQALLAIEEADVILFVVDGRAGLTPADEEIAKILRKSNKP-VILVVNKVDGKKMEA-------DAYEF-YSLGLGE---  139 (438)
T ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCHHH-------HHHHH-HHHCCCC---
T ss_conf             99999999858999999837768987899999999973997-899997556632034-------59999-9836898---


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCC
Q ss_conf             23311467641144456521233203443102522221000011000000
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEG  214 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~  214 (392)
                      .+++||..+.          ++..|++.+...++..+...+.++|+.|-.
T Consensus       140 ~i~iSA~h~~----------Gi~~L~~~i~~~l~~~~~~~~~~iriaiiG  179 (438)
T PRK00093        140 PYPISAEHGR----------GIGDLLDAILELLPEEEEEEEDPIKIAIIG  179 (438)
T ss_pred             EEEEEECCCC----------CHHHHHHHHHHHCCCCCCCCCCCEEEEEEC
T ss_conf             1888530566----------989999999854885543445560599955


No 87 
>PRK09518 bifunctional cytidylate kinase/GTP-binding protein; Reviewed
Probab=99.82  E-value=3.8e-20  Score=143.97  Aligned_cols=168  Identities=17%  Similarity=0.210  Sum_probs=120.2

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC----HHHHHH--
Q ss_conf             99999046898878999999876444200131268686986292063789998219908999847873----024677--
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH----ADYVKN--   87 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH----~~f~~~--   87 (392)
                      .|||+|..+-|||||..+|++....      -.+.     .-|+|.|--+...+|.++.|.++||+|-    ..|...  
T Consensus       281 ~VAIVGRPNVGKSTLFNRL~g~r~A------IV~d-----~pGvTRDR~~~~~~~~~~~F~lvDTGG~~~~~~~~~~~I~  349 (714)
T PRK09518        281 TVAIVGRPNVGKSTLVNRILGRREA------VVED-----TPGVTRDRVSYDAEWAGRDFKLVDTGGWEADAEGIEAAIA  349 (714)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCEE------EECC-----CCCCCCCCCEEEEEECCEEEEEEECCCCCCCCHHHHHHHH
T ss_conf             7999899987689999886288416------8469-----8998837555799999916999979999988326999999


Q ss_pred             --HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEEC
Q ss_conf             --987740023314520123443321067788886318760233100233356122211012321001110145322102
Q gi|254780263|r   88 --MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPI  165 (392)
Q Consensus        88 --mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pi  165 (392)
                        ...++..||..++|||+..|+.+.-.+.+.+++..+.| +++++||+|..+.+.       ...+| -.+|+.+   .
T Consensus       350 ~Q~~~Ai~eADlIlFVVD~~~Glt~~D~~ia~~LRk~~Kp-vilvvNK~D~~~~e~-------~~~ef-~~LG~~e---~  417 (714)
T PRK09518        350 SQAEIAMTLADAIVFVVDGQVGMTSTDEVIARMLQRAGKP-VVLVANKIDDQASEY-------DVAEF-WKLGLGE---P  417 (714)
T ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCHH-------HHHHH-HHCCCCC---C
T ss_conf             9999999968999999968979897899999999856998-899998978876401-------29999-9659999---6


Q ss_pred             CCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCC---CCCCCCCEECCC
Q ss_conf             3311467641144456521233203443102522221---000011000000
Q gi|254780263|r  166 IRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQR---SLDAPFLMHIEG  214 (392)
Q Consensus       166 i~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~---~~~~p~r~~I~~  214 (392)
                      +|+||..|.          ++..|++.+...+|..+.   ..+.|.|+.|-.
T Consensus       418 ~~ISA~Hg~----------G~~dLld~i~~~l~~~~~~~~~~~~~~rIAIIG  459 (714)
T PRK09518        418 YSISAMHGR----------GVADLLDVVLDSLKQHERTSGYLSGLRRVALVG  459 (714)
T ss_pred             EEEECCCCC----------CHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEC
T ss_conf             898473578----------989999999965888875434346773588866


No 88 
>PRK03003 engA GTP-binding protein EngA; Reviewed
Probab=99.81  E-value=6.7e-20  Score=142.46  Aligned_cols=168  Identities=20%  Similarity=0.241  Sum_probs=120.7

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC----HHHHH---
Q ss_conf             99999046898878999999876444200131268686986292063789998219908999847873----02467---
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH----ADYVK---   86 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH----~~f~~---   86 (392)
                      -||++|-..-|||||..+|++....      -.+.     .-|.|.|.-+..++|.++.+.++||||-    .++.+   
T Consensus        40 iVaIvGRPNVGKStLFNrL~~~~~A------IV~d-----~pGvTRDr~~~~~~~~~~~f~lvDTgG~~~~~~~~~~~i~  108 (474)
T PRK03003         40 VVAVVGRPNVGKSTLVNRILGRREA------VVED-----IPGVTRDRVSYDAEWNGRRFVVQDTGGWEPDAKGLQALVA  108 (474)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCEE------EECC-----CCCCCCCCEEEEEEECCCEEEEEECCCCCCCHHHHHHHHH
T ss_conf             8999899998889999998688638------8059-----8998808636899999928999979999997478999999


Q ss_pred             -HHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEEC
Q ss_conf             -7987740023314520123443321067788886318760233100233356122211012321001110145322102
Q gi|254780263|r   87 -NMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPI  165 (392)
Q Consensus        87 -~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pi  165 (392)
                       ....++..||..++||||.+|+.+.-.+.+.+++..+-| +++++||+|....+.       ...++ -.+|+.+   .
T Consensus       109 ~q~~~ai~eaD~IlfVvD~~~glt~~D~eia~~LRk~~kp-viLVvNK~D~~~~~~-------~~~ef-y~LGf~~---~  176 (474)
T PRK03003        109 EQAEVAMRTADAVLFVVDATVGATATDEAVARLLRRSGKP-VFLAANKVDSERGEA-------DAAAL-WSLGLGE---P  176 (474)
T ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCHHH-------HHHHH-HHHCCCC---E
T ss_conf             9999999869999999968989887899999998753997-799867556621023-------48999-9757998---6


Q ss_pred             CCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCC---CCCCCCCCCEECCC
Q ss_conf             33114676411444565212332034431025222---21000011000000
Q gi|254780263|r  166 IRGSALCALQGTNKELGEDSIHALMKAVDTHIPTP---QRSLDAPFLMHIEG  214 (392)
Q Consensus       166 i~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p---~~~~~~p~r~~I~~  214 (392)
                      +++||..|.          ++..|++.+.+.+|..   ....+.|.|+.|-.
T Consensus       177 i~ISA~Hg~----------Gi~dLld~i~~~l~~~~~~~~~~~~~~rIAIvG  218 (474)
T PRK03003        177 HPVSALHGR----------GVADLLDAVLAALPEVPEVGSAVGGPRRVALVG  218 (474)
T ss_pred             EEEEHHCCC----------CHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEC
T ss_conf             996020378----------979999999974877664433457762799980


No 89 
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=99.81  E-value=9.5e-20  Score=141.50  Aligned_cols=155  Identities=23%  Similarity=0.363  Sum_probs=105.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC-------------
Q ss_conf             9999046898878999999876444200131268686986292063789998219908999847873-------------
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH-------------   81 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH-------------   81 (392)
                      ||++|+.++|||||+.+|++...     ...+.     ..-|.|.+..+  |.+ +..+.|+||||-             
T Consensus         2 IaivG~pN~GKSTL~N~L~~~~~-----~~~vs-----~~~gtTr~i~~--~~~-~~~~~~vDtPG~g~~~~~~~~~~~~   68 (170)
T cd01876           2 IAFAGRSNVGKSSLINALTNRKK-----LARTS-----KTPGKTQLINF--FNV-NDKFRLVDLPGYGYAKVSKEVKEKW   68 (170)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCC-----EEEEE-----CCCCEEEEEEE--EEE-CCEEEEEECCCCHHCCCCHHHHHHH
T ss_conf             89998999999999999968996-----27860-----78977852058--853-8779999657840101687799999


Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             02467798774002331452012344332106778888631876023310023335612221101232100111014532
Q gi|254780263|r   82 ADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        82 ~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      ...+.+.+.....+|.+++|+||..|+.+|.++.+..+...+.| +++++||+|+++.+++.+..+ ++...+...  ..
T Consensus        69 ~~~~~~~l~~~~~~~~vi~viD~~~~~~~~d~~i~~~l~~~~kp-~iiVlNKiDlv~~~~~~~~~~-~~~~~l~~~--~~  144 (170)
T cd01876          69 GKLIEEYLENRENLKGVVLLIDSRHGPTEIDLEMLDWLEELGIP-FLVVLTKADKLKKSELAKALK-EIKKELKLF--EI  144 (170)
T ss_pred             HHHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEEEEECCCHHHHHHHHH-HHHHHHHCC--CC
T ss_conf             99999999840633499999963223748689999999876998-799998675378778999999-999987421--79


Q ss_pred             EEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCC
Q ss_conf             21023311467641144456521233203443102
Q gi|254780263|r  162 DTPIIRGSALCALQGTNKELGEDSIHALMKAVDTH  196 (392)
Q Consensus       162 ~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~  196 (392)
                      ..|++++||.+|          .+++.|++.|.++
T Consensus       145 ~~~ii~iSA~~g----------~gi~~L~~~I~~~  169 (170)
T cd01876         145 DPPIILFSSLKG----------QGIDELRALIEKW  169 (170)
T ss_pred             CCEEEEEECCCC----------CCHHHHHHHHHHH
T ss_conf             983999988999----------7799999999985


No 90 
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination.  Sup35NM  is a non-pathogenic prion-li
Probab=99.81  E-value=8.6e-21  Score=147.99  Aligned_cols=82  Identities=28%  Similarity=0.450  Sum_probs=77.7

Q ss_pred             CCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEE
Q ss_conf             11000000013554454301487424534896799950687432125412100121144321001366641124543220
Q gi|254780263|r  207 PFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVP  286 (392)
Q Consensus       207 p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~  286 (392)
                      ||||||+++|+  |.|++++|||+||++++||++.++|.+   ..++|++|+++++++++|.|||+|+++|+|++..|++
T Consensus         1 PlR~pi~dv~k--g~G~vV~G~vesG~v~~Gd~v~i~P~~---~~~~Vk~I~~~~~~v~~A~aGd~V~l~L~gvd~~~i~   75 (82)
T cd04089           1 PLRLPIIDKYK--DMGTVVLGKVESGTIKKGDKLLVMPNK---TQVEVLSIYNEDVEVRYARPGENVRLRLKGIEEEDIS   75 (82)
T ss_pred             CEEEEEEEEEE--CCCEEEEEEEEEEEECCCCEEEEECCC---CEEEEEEEEECCEEECEECCCCCEEEEECCCCHHHCC
T ss_conf             97826878992--898899999936778299999995899---8899999999997958886997326888488888447


Q ss_pred             CHHEEEC
Q ss_conf             2117732
Q gi|254780263|r  287 RGRVVCA  293 (392)
Q Consensus       287 rGdvl~~  293 (392)
                      |||+||+
T Consensus        76 rG~vlcs   82 (82)
T cd04089          76 PGFVLCS   82 (82)
T ss_pred             CCCEECC
T ss_conf             8879959


No 91 
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu. SelB may function by replacing EF-Tu. In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3' or 5' non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation.
Probab=99.81  E-value=7.9e-21  Score=148.22  Aligned_cols=83  Identities=37%  Similarity=0.663  Sum_probs=79.2

Q ss_pred             CCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEC
Q ss_conf             10000000135544543014874245348967999506874321254121001211443210013666411245432202
Q gi|254780263|r  208 FLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPR  287 (392)
Q Consensus       208 ~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~r  287 (392)
                      |||||+++|+++|+|+|++|+|+||++++||++.++|.+   ..++|++||+|++++++|.|||+|+++|+|++..|++|
T Consensus         1 fr~~Id~~F~i~G~GtVvtGtv~sG~i~~gd~l~i~P~~---~~~~VksI~~~~~~~~~a~aG~~v~i~L~~i~~~di~r   77 (83)
T cd03696           1 FRLPIDRVFTVKGQGTVVTGTVLSGSVKVGDKVEILPLG---EETRVRSIQVHGKDVEEAKAGDRVALNLTGVDAKDLER   77 (83)
T ss_pred             CEEEEEEEEECCCCEEEEEEEECCCCCCCCCEEEECCCC---CEEEEEEEEECCCEECEECCCCEEEEEEECCCHHHCCC
T ss_conf             984886899818957999999967985699999997877---33899999989959688979987999975897673586


Q ss_pred             HHEEEC
Q ss_conf             117732
Q gi|254780263|r  288 GRVVCA  293 (392)
Q Consensus       288 Gdvl~~  293 (392)
                      ||+||+
T Consensus        78 G~vl~s   83 (83)
T cd03696          78 GDVLSS   83 (83)
T ss_pred             CCEEEC
T ss_conf             789919


No 92 
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination.  Sup35NM  
Probab=99.81  E-value=1.2e-20  Score=147.13  Aligned_cols=83  Identities=31%  Similarity=0.593  Sum_probs=79.1

Q ss_pred             CCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEE
Q ss_conf             11000000013554454301487424534896799950687432125412100121144321001366641124543220
Q gi|254780263|r  207 PFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVP  286 (392)
Q Consensus       207 p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~  286 (392)
                      ||||||+++|+.+| |++++|||+||++++||++.++|.+   ..++|++|+.+++++++|.|||+|+++|+|++..|++
T Consensus         1 P~R~pI~~v~~~~g-G~vv~G~v~sG~i~~Gd~v~i~P~~---~~~~VksI~~~~~~~~~A~aG~~V~l~L~gid~~~i~   76 (83)
T cd03698           1 PFRLPISDKYKDQG-GTVVSGKVESGSIQKGDTLLVMPSK---ESVEVKSIYVDDEEVDYAVAGENVRLKLKGIDEEDIS   76 (83)
T ss_pred             CEEEEEEEEEECCC-CCEEEEEEEECEECCCCEEEEECCC---CEEEEEEEEECCEEECEECCCCEEEEEECCCCHHHCC
T ss_conf             97989974798699-7399999902587289999997899---8899999999991729888999799998489899947


Q ss_pred             CHHEEEC
Q ss_conf             2117732
Q gi|254780263|r  287 RGRVVCA  293 (392)
Q Consensus       287 rGdvl~~  293 (392)
                      |||+||+
T Consensus        77 rG~vlcs   83 (83)
T cd03698          77 PGDVLCS   83 (83)
T ss_pred             CCCEEEC
T ss_conf             9889949


No 93 
>PRK00089 era GTP-binding protein Era; Reviewed
Probab=99.81  E-value=1.2e-19  Score=140.90  Aligned_cols=172  Identities=21%  Similarity=0.292  Sum_probs=119.2

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC--------HHHH
Q ss_conf             99999046898878999999876444200131268686986292063789998219908999847873--------0246
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH--------ADYV   85 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH--------~~f~   85 (392)
                      -||++|-..+|||||+.+|++..-..      +.     ..-|-|.+.-...+.+++..+.|+||||-        +.+.
T Consensus        10 ~VaivG~PNvGKSTL~N~l~~~k~si------VS-----~k~~TTR~~i~gi~~~~~~q~i~iDTpGi~~~~~~l~~~~~   78 (296)
T PRK00089         10 FVAIVGRPNVGKSTLLNALVGQKISI------VS-----PKPQTTRHRIRGIVTEDDAQIIFVDTPGIHKPKRALNRAMN   78 (296)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCEEE------EC-----CCCCCCCCCEEEEEEECCEEEEEEECCCCCCCHHHHHHHHH
T ss_conf             99999899988899999996896176------14-----95998728389999979979999989986674677878999


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEEC
Q ss_conf             77987740023314520123443321067788886318760233100233356122211012321001110145322102
Q gi|254780263|r   86 KNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPI  165 (392)
Q Consensus        86 ~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pi  165 (392)
                      +....++..+|.+++|+||.+++..|.++.+..++..+.| +++++||+|+++.++..+.+. ++.+.+   .|.   .+
T Consensus        79 ~~~~~ai~~aDlil~viD~~~~~~~~d~~i~~~l~~~~kp-~ilviNKiDlv~k~~l~~~~~-~l~~~~---~f~---~i  150 (296)
T PRK00089         79 KAAWSSLKDVDLVLFVVDADEKIGPGDEFILEKLKKVKTP-VILVLNKIDLVDKEELLPLLE-ELSELM---DFA---EI  150 (296)
T ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEEHHHHCCHHHHHHHHH-HHHHHC---CCC---EE
T ss_conf             9999999759999999857889898899999988874998-899954788428988999999-998537---976---59


Q ss_pred             CCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCC------CCCCCCCCCCEECCC
Q ss_conf             3311467641144456521233203443102522------221000011000000
Q gi|254780263|r  166 IRGSALCALQGTNKELGEDSIHALMKAVDTHIPT------PQRSLDAPFLMHIEG  214 (392)
Q Consensus       166 i~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~------p~~~~~~p~r~~I~~  214 (392)
                      +++||.++          ++++.|++.|.++.|.      +....|.+.++.+.+
T Consensus       151 f~iSA~~~----------~gi~~L~~~l~~~lp~~~~~y~~d~~Td~~~~~~v~E  195 (296)
T PRK00089        151 VPISALKG----------DNVDELLDLIAKYLPEGPPLYPEDQITDRPERFLAAE  195 (296)
T ss_pred             EEEECCCC----------CCHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             99967788----------8989999999986798865687301457848899999


No 94 
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=99.79  E-value=3.9e-19  Score=137.68  Aligned_cols=156  Identities=20%  Similarity=0.174  Sum_probs=107.9

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC----HHH----
Q ss_conf             799999046898878999999876444200131268686986292063789998219908999847873----024----
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH----ADY----   84 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH----~~f----   84 (392)
                      .+|+++|+.++|||||+.+|++..  .+    .+.     ..-|-|.+.....+.++++.+.|+||||-    ...    
T Consensus         4 ~~V~ivG~pN~GKSsL~N~L~~~~--~a----~vs-----~~~gtTr~~~~~~~~~~~~~~~l~DtpG~~~~~~~~~~~~   72 (168)
T cd04163           4 GFVAIVGRPNVGKSTLLNALVGQK--IS----IVS-----PKPQTTRNRIRGIYTDDDAQIIFVDTPGIHKPKKKLGERM   72 (168)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCC--EE----EEC-----CCCCEEECCCEEEEEECCEEEEEEECCCCCCCHHHHHHHH
T ss_conf             689999999999999999995897--03----323-----8898263442368984997899995898665145677899


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             67798774002331452012344332106778888631876023310023335612221101232100111014532210
Q gi|254780263|r   85 VKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        85 ~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                      .+...+.+..+|.+++|+||++|...+..+.+..++..+.| +++++||+|+++.++.......+..+..      ...+
T Consensus        73 ~~~~~~~l~~~D~il~vvD~~~~~~~~d~~i~~~l~~~~~~-~iivlNK~Dl~~~~~~~~~~~~~~~~~~------~~~~  145 (168)
T cd04163          73 VKAAWSALKDVDLVLFVVDASEPIGEGDEFILELLKKSKTP-VILVLNKIDLVKDKEDLLPLLEKLKELG------PFAE  145 (168)
T ss_pred             HHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECEEECCCHHHHHHHHHHHHHHC------CCCC
T ss_conf             99999865136558999978989866779999999980998-5999978870478778999999999618------9996


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCC
Q ss_conf             23311467641144456521233203443102
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTH  196 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~  196 (392)
                      ++++||.+|.          ++..|++.|.++
T Consensus       146 vi~iSA~~g~----------Gid~L~~~i~~~  167 (168)
T cd04163         146 IFPISALKGE----------NVDELLEEIVKY  167 (168)
T ss_pred             EEEEECCCCC----------CHHHHHHHHHHH
T ss_conf             8999777896----------999999999953


No 95 
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase. This group includes proteins similar to GTPBP1 and GTPBP2. GTPB1 is structurally, related to elongation factor 1 alpha, a key component of protein biosynthesis machinery. Immunohistochemical analyses on mouse tissues revealed that GTPBP1 is expressed in some neurons and smooth muscle cells of various organs as well as macrophages. Immunofluorescence analyses revealed that GTPBP1 is localized exclusively in cytoplasm and shows a diffuse granular network forming a gradient from the nucleus to the periphery of the cells in smooth muscle cell lines and macrophages. No significant difference was observed in the immune response to protein antigen between mutant mice and wild-type mice, suggesting normal function of antigen-presenting cells of the mutant mice. The absence of an eminent phenotype in GTPBP1-deficient mice may be due to functional compensation by GTPBP2, which is similar to GTPBP1 in structure and tissue distribution.
Probab=99.79  E-value=3.7e-20  Score=144.04  Aligned_cols=86  Identities=23%  Similarity=0.359  Sum_probs=81.8

Q ss_pred             CCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEEC-CCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEE
Q ss_conf             10000000135544543014874245348967999506-87432125412100121144321001366641124543220
Q gi|254780263|r  208 FLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGM-GGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVP  286 (392)
Q Consensus       208 ~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~-~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~  286 (392)
                      +||+|+++|.++|+|+|++|++.+|++++||++.++|. ++++.+++|+|||+|++++++|.|||+++++|++++.++++
T Consensus         1 ~~~~ID~vf~v~G~GtVVtGtv~~G~i~~gd~v~i~P~~~G~f~~v~VrsIq~~~~~v~~a~aG~~~~~~l~~i~~~~i~   80 (87)
T cd03694           1 AEFQIDEIYSVPGVGTVVGGTVSKGVIRLGDTLLLGPDQDGSFRPVTVKSIHRNRSPVRVVRAGQSASLALKKIDRSLLR   80 (87)
T ss_pred             CCCCCEEEEECCCEEEEEEEEECCCCCCCCCEEEEECCCCCCEEEEEEEEEEECCCCCCEECCCCEEEEEECCCCHHHCC
T ss_conf             95653137986985689899984571538999999216789667789988998882978976998988998699999906


Q ss_pred             CHHEEEC
Q ss_conf             2117732
Q gi|254780263|r  287 RGRVVCA  293 (392)
Q Consensus       287 rGdvl~~  293 (392)
                      ||++|.+
T Consensus        81 rG~VL~s   87 (87)
T cd03694          81 KGMVLVS   87 (87)
T ss_pred             CCCEEEC
T ss_conf             7669969


No 96 
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=99.79  E-value=1.5e-19  Score=140.27  Aligned_cols=153  Identities=22%  Similarity=0.221  Sum_probs=108.5

Q ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCC-EEEEEEECCCC-------HHHHHHH
Q ss_conf             990468988789999998764442001312686869862920637899982199-08999847873-------0246779
Q gi|254780263|r   17 TIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK-RFYSHIDCPGH-------ADYVKNM   88 (392)
Q Consensus        17 ~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~-~~i~iiD~PGH-------~~f~~~m   88 (392)
                      ++|+.++|||||+.+|++.....      .     ....|.|.+.....+.+.+ +.+.|+||||.       ..+....
T Consensus         1 ivG~~N~GKStL~N~L~~~~~~~------v-----s~~~gtT~~~~~~~~~~~~~~~i~lvDtpG~~~~~~~~~~~~~~~   69 (163)
T cd00880           1 LFGRTNAGKSSLLNALLGQEVAI------V-----SPVPGTTTDPVEYVWELGPLGPVVLIDTPGIDEAGGLGREREELA   69 (163)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCCE------E-----CCCCCEECCCEEEEEEECCCCEEEEEECCCCCCCCCHHHHHHHHH
T ss_conf             91979989999999995899610------1-----698998656458999954786599972798522231016899999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCC
Q ss_conf             87740023314520123443321067788886318760233100233356122211012321001110145322102331
Q gi|254780263|r   89 ITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRG  168 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~  168 (392)
                      ...+..+|.+++||||+++...+..+++..+...+.| +++++||+|+++.++..+..+ ........   ....|++++
T Consensus        70 ~~~~~~~D~il~viD~~~~~~~~~~~~l~~l~~~~~p-~i~v~NK~D~~~~~~~~~~~~-~~~~~~~~---~~~~~i~~i  144 (163)
T cd00880          70 RRVLERADLILFVVDADLRADEEEEKLLELLRERGKP-VLLVLNKIDLLPEEEEEELLE-LRLLILLL---LLGLPVIAV  144 (163)
T ss_pred             HHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCC-EEEEEECEECCCHHHHHHHHH-HHHHHHHH---CCCCEEEEE
T ss_conf             9999868989999878999755669999999971974-278853420678789999999-99999876---799859999


Q ss_pred             EEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             146764114445652123320344310
Q gi|254780263|r  169 SALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       169 sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                      ||.+|.          ++..|++.+.+
T Consensus       145 SA~~g~----------gi~~L~~~i~e  161 (163)
T cd00880         145 SALTGE----------GIDELREALIE  161 (163)
T ss_pred             ECCCCC----------CHHHHHHHHHH
T ss_conf             789897----------99999999995


No 97 
>COG1160 Predicted GTPases [General function prediction only]
Probab=99.78  E-value=6.2e-19  Score=136.47  Aligned_cols=168  Identities=21%  Similarity=0.250  Sum_probs=119.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHH-----HHHH-
Q ss_conf             9999904689887899999987644420013126868698629206378999821990899984787302-----4677-
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHAD-----YVKN-   87 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~-----f~~~-   87 (392)
                      .||++|..+=|||||..+|++.....      .+-     .-|.|.|--|...+|.++.+.+|||+|-.+     |.+. 
T Consensus         5 ~VAIVGRPNVGKSTLFNRL~g~r~AI------V~D-----~pGvTRDr~y~~~~~~~~~f~lIDTgGl~~~~~~~l~~~i   73 (444)
T COG1160           5 VVAIVGRPNVGKSTLFNRLTGRRIAI------VSD-----TPGVTRDRIYGDAEWLGREFILIDTGGLDDGDEDELQELI   73 (444)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCEEEE------EEC-----CCCCCCCCCCCEEEECCCEEEEEECCCCCCCCCHHHHHHH
T ss_conf             89998999875899998875770267------606-----9997557754506983860799978997768812899999


Q ss_pred             ---HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             ---98774002331452012344332106778888631876023310023335612221101232100111014532210
Q gi|254780263|r   88 ---MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        88 ---mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                         +..++..||+.|+|||+.+|+.++-.+.+.+++..+.| +|+++||+|..+.++       ...++ -.+|+.+   
T Consensus        74 ~~Qa~~Ai~eADvilfvVD~~~Git~~D~~ia~~Lr~~~kp-viLvvNK~D~~~~e~-------~~~ef-yslG~g~---  141 (444)
T COG1160          74 REQALIAIEEADVILFVVDGREGITPADEEIAKILRRSKKP-VILVVNKIDNLKAEE-------LAYEF-YSLGFGE---  141 (444)
T ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCHHHH-------HHHHH-HHCCCCC---
T ss_conf             99999999767999999848878997899999999853998-899997666730456-------48999-8647898---


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCC-CC---CCCCCEECCC
Q ss_conf             23311467641144456521233203443102522221-00---0011000000
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQR-SL---DAPFLMHIEG  214 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~-~~---~~p~r~~I~~  214 (392)
                      .+|+||..|.          ++..|++.+...+|.++. ..   +.|.++.|-.
T Consensus       142 ~~~ISA~Hg~----------Gi~dLld~v~~~l~~~e~~~~~~~~~~ikiaiiG  185 (444)
T COG1160         142 PVPISAEHGR----------GIGDLLDAVLELLPPDEEEEEEEETDPIKIAIIG  185 (444)
T ss_pred             CEEEEHHHCC----------CHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEEE
T ss_conf             2684255356----------9899999999756774334443567750899992


No 98 
>cd03706 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF-TU). mtEF-TU is highly conserved and is 55-60% identical to bacterial EF-TU. The overall structure is similar to that observed in the Escherichia coli and Thermus aquaticus EF-TU. However, compared with that observed in prokaryotic EF-TU the nucleotide-binding domain (domain I) of EF-TUmt is in a different orientation relative to the rest of the structure. Furthermore, domain III is followed by a short 11-amino acid extension that forms one helical turn. This extension seems to be specific to the mitochondrial factors and has not been observed in any of the prokaryotic factors.
Probab=99.76  E-value=4.9e-18  Score=130.86  Aligned_cols=93  Identities=39%  Similarity=0.747  Sum_probs=88.9

Q ss_pred             CCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEEEE
Q ss_conf             63000168999710567875555115978999954147779999618955707897699999977817754698499998
Q gi|254780263|r  298 QEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMRE  377 (392)
Q Consensus       298 ~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilRd  377 (392)
                      ++.++|+|++++|+.+++++.+++..+|+|++|+.+++++|++.+.++.+.+.|||.+.+.++|.+|+++++++||.||+
T Consensus         1 k~h~~f~A~vYvLtkeEGGR~~pf~~~y~pq~f~rT~Dvtg~i~l~~~~~mvmPGd~~~~~~~L~~p~~le~g~rFtiRE   80 (93)
T cd03706           1 KPHDKVEAQVYILSKAEGGRHKPFVSNFQPQMFSLTWDCAARIDLPPGKEMVMPGEDTKVTLILRRPMVLEKGQRFTLRD   80 (93)
T ss_pred             CCCCEEEEEEEEECHHHCCCCCCCCCCCCEEEEEEECCCCEEEECCCCCEEECCCCCEEEEEEECCCEECCCCCEEEEEE
T ss_conf             99778999999971888888788646982179998167246888479965865788289999977606115998188935


Q ss_pred             CCEEEEEEEEEEE
Q ss_conf             9969998999553
Q gi|254780263|r  378 GGKTVGAGLILEI  390 (392)
Q Consensus       378 ~~~tig~G~I~~v  390 (392)
                      +|+|||.|+|++.
T Consensus        81 gg~TVg~GvVte~   93 (93)
T cd03706          81 GNRTIGTGLVTDT   93 (93)
T ss_pred             CCEEEEEEEEECC
T ss_conf             9998998999569


No 99 
>cd01894 EngA1 EngA1 subfamily.  This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability.  A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=99.76  E-value=3.6e-18  Score=131.69  Aligned_cols=148  Identities=22%  Similarity=0.243  Sum_probs=106.3

Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCH----HHHHHHH--
Q ss_conf             9990468988789999998764442001312686869862920637899982199089998478730----2467798--
Q gi|254780263|r   16 STIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHA----DYVKNMI--   89 (392)
Q Consensus        16 ~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~----~f~~~mi--   89 (392)
                      |++|..++|||||+.+|++....      ....     .-|.|.+.-+..++++++.+.|+||||..    .+.+.|.  
T Consensus         1 aivG~pN~GKSsL~N~l~~~~~~------ivs~-----~~gtTr~~~~~~~~~~~~~~~lvDTpG~~~~~~~~~~~~~~~   69 (157)
T cd01894           1 AIVGRPNVGKSTLFNRLTGRRDA------IVED-----TPGVTRDRIYGEAEWGGREFILIDTGGIEPDDEGISKEIREQ   69 (157)
T ss_pred             CCCCCCCCCHHHHHHHHHCCCCE------EEEC-----CCCCEEEEEEEEEEECCEEEEEEECCCCCCCCCHHHHHHHHH
T ss_conf             90489998899999999588753------5407-----999356678999999998899985787555660678999999


Q ss_pred             --HHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCC
Q ss_conf             --774002331452012344332106778888631876023310023335612221101232100111014532210233
Q gi|254780263|r   90 --TGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIR  167 (392)
Q Consensus        90 --~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~  167 (392)
                        ..+..+|.+++|+||.+|+..+..+.+..++..+.| +++++||+|+++.++...    ++.+    .++.   ++++
T Consensus        70 ~~~~i~~ad~il~viDa~~~~~~~d~~i~~~l~~~~kp-~i~v~NK~D~~~~~~~~~----~~~~----l~~~---~~i~  137 (157)
T cd01894          70 AELAIEEADVILFVVDGREGLTPADEEIAKYLRKSKKP-VILVVNKVDNIKEEDEAA----EFYS----LGFG---EPIP  137 (157)
T ss_pred             HHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCC-EEEEEECCCCCCCHHHHH----HHHH----CCCC---CEEE
T ss_conf             99999865907999989999998999999999984798-099997871658645699----9996----5999---7599


Q ss_pred             CEEEEEEECCCCCCCCCCCCCHHHHHHCC
Q ss_conf             11467641144456521233203443102
Q gi|254780263|r  168 GSALCALQGTNKELGEDSIHALMKAVDTH  196 (392)
Q Consensus       168 ~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~  196 (392)
                      +||.+|.          +++.|++.|.+.
T Consensus       138 iSA~~g~----------Gid~L~~~I~~~  156 (157)
T cd01894         138 ISAEHGR----------GIGDLLDAILEL  156 (157)
T ss_pred             EEEECCC----------CHHHHHHHHHHH
T ss_conf             9965894----------999999999965


No 100
>PRK00093 engA GTP-binding protein EngA; Reviewed
Probab=99.75  E-value=8e-18  Score=129.56  Aligned_cols=153  Identities=27%  Similarity=0.333  Sum_probs=117.3

Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCH------
Q ss_conf             38827999990468988789999998764442001312686869862920637899982199089998478730------
Q gi|254780263|r    9 NKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHA------   82 (392)
Q Consensus         9 ~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~------   82 (392)
                      ..+.++||++|-..+|||||+.+|++.-..      -++..     -|.|.|.-...|+|+++.|.|+||+|-+      
T Consensus       169 ~~~~iriaiiGrpNvGKStl~N~ll~~~r~------ivs~~-----~GtTrD~i~~~~~~~~~~~~~iDTaGirkk~k~~  237 (438)
T PRK00093        169 EEDPIKIAIIGRPNVGKSTLINALLGEERV------IVSDI-----AGTTRDSIDTPFERDGQKYTLIDTAGIRRRGKVT  237 (438)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHH------HCCCC-----CCCCCCCEEEEEEECCCEEEEEECCCCCCCCCCC
T ss_conf             455605999558886556788876543332------04799-----9851123267999899679999898987656421


Q ss_pred             ----HH-HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH-HHHHHCCCCCCEEEEE
Q ss_conf             ----24-67798774002331452012344332106778888631876023310023335612-2211012321001110
Q gi|254780263|r   83 ----DY-VKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDD-ELLDISEYEIRDLLKE  156 (392)
Q Consensus        83 ----~f-~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~-~~~~~i~~~i~~~l~~  156 (392)
                          .| +..+++.+..+|+++||+||.+|+..|-..-+.++...|-+ +|+++||+|+++.+ +..+....++...|..
T Consensus       238 ~~iE~~s~~~t~~~i~~~dvvilviDa~~~~~~qD~~i~~~i~~~gk~-~ii~vNKwDLv~~~~~~~~~~~~~i~~~l~~  316 (438)
T PRK00093        238 EGIEKYSVIRTLKAIERADVVLLVIDATEGITEQDLRIAGLALEAGRA-LVIVVNKWDLVEKDSKTMEEVKEELRRRLPF  316 (438)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECHHCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             378899999999998644669999976658848889999999981996-6999970222566389999999999975612


Q ss_pred             EEEEEEEECCCCEEEEEEEC
Q ss_conf             14532210233114676411
Q gi|254780263|r  157 HKYSDDTPIIRGSALCALQG  176 (392)
Q Consensus       157 ~~~~~~~pii~~sa~~g~~~  176 (392)
                         ...+|++++||..+...
T Consensus       317 ---~~~~pIvfiSA~~g~gi  333 (438)
T PRK00093        317 ---LDFAPIVFISALTGQGV  333 (438)
T ss_pred             ---CCCCCEEEEECCCCCCH
T ss_conf             ---58987799851477799


No 101
>pfam10662 PduV-EutP Ethanolamine utilisation - propanediol utilisation. Members of this family function in ethanolamine and propanediol degradation pathways, however the exact roles of these proteins is poorly understood.
Probab=99.75  E-value=1.5e-18  Score=134.07  Aligned_cols=135  Identities=24%  Similarity=0.228  Sum_probs=93.3

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC----CHHHHHHHH
Q ss_conf             9999904689887899999987644420013126868698629206378999821990899984787----302467798
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG----HADYVKNMI   89 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG----H~~f~~~mi   89 (392)
                      +|+++|..++|||||+.+|.+..-.                ...|..        -.++..||||||    |+.|.+.|+
T Consensus         3 kVaivGrpNvGKSTLlN~L~g~~i~----------------~~K~qt--------t~~~~~~IDTPG~~~~~~~~~~~~~   58 (143)
T pfam10662         3 KIMLIGRSGCGKTTLTQALNGEELK----------------YKKTQA--------IEFSDNMIDTPGEYLENRRFYSALI   58 (143)
T ss_pred             EEEEECCCCCCHHHHHHHHCCCCEE----------------ECCCEE--------EEECCCEEECCCCCCCCHHHHHHHH
T ss_conf             5999899999999999997599445----------------178707--------9855748999876656289999999


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCE
Q ss_conf             77400233145201234433210677888863187602331002333561222110123210011101453221023311
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGS  169 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~s  169 (392)
                      .++..||..++|+||++......   ..+++.++.| +|+++||+|+++.++..+.+    ++++++.++.   .++|+|
T Consensus        59 ~~~~daDvil~vvDa~~~~~~~~---~~~~~~~~kp-vIlViNKiD~~~~~~~l~~~----~~~~~~~~~~---~i~~iS  127 (143)
T pfam10662        59 VTAADADVIALVQDATEPWSVFP---PGFASMFNKP-VIGIITKIDLAKDEANIEMV----EEWLNNAGAE---KIFEVS  127 (143)
T ss_pred             HHHHHCCEEEEEEECCCCCCCCC---HHHHHHCCCC-EEEEEECCCCCCCHHHHHHH----HHHHHHCCCC---EEEEEE
T ss_conf             99964999999987788667568---7789754798-89999802245756678999----9999758998---799988


Q ss_pred             EEEEEECCCCCCCCCCCCCHHHHH
Q ss_conf             467641144456521233203443
Q gi|254780263|r  170 ALCALQGTNKELGEDSIHALMKAV  193 (392)
Q Consensus       170 a~~g~~~~n~~~~~~~~~~Ll~~i  193 (392)
                      |.+|.          ++..|++.|
T Consensus       128 A~~g~----------Gid~L~~~l  141 (143)
T pfam10662       128 AVTNE----------GIDELFAYL  141 (143)
T ss_pred             CCCCC----------CHHHHHHHH
T ss_conf             98998----------999999997


No 102
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=99.74  E-value=5.5e-18  Score=130.57  Aligned_cols=147  Identities=21%  Similarity=0.293  Sum_probs=99.3

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC----------
Q ss_conf             8279999904689887899999987644420013126868698629206378999821990899984787----------
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG----------   80 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG----------   80 (392)
                      +...||++|...+|||||+.+|++.-. .    +.+.     ...|.|.+..+  |.. +..+.|+||||          
T Consensus        17 ~~p~IaivGrpNvGKSTL~N~L~g~k~-~----a~vs-----~~pGtTr~i~~--~~~-~~~~~lvDtpGyG~~~~~~~~   83 (179)
T TIGR03598        17 DGPEIAFAGRSNVGKSSLINALTNRKK-L----ARTS-----KTPGRTQLINF--FEV-NDGFRLVDLPGYGYAKVSKEE   83 (179)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCC-E----EEEC-----CCCCEEEECCE--EEE-CCCEEEEECCCHHHCCCCHHH
T ss_conf             897899986999888999999868985-5----8970-----89973660232--010-473699977760211278888


Q ss_pred             CHHHHHHH---HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEE
Q ss_conf             30246779---877400233145201234433210677888863187602331002333561222110123210011101
Q gi|254780263|r   81 HADYVKNM---ITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEH  157 (392)
Q Consensus        81 H~~f~~~m---i~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~  157 (392)
                      +..+...+   +.....++.+++|+||..|+..|-.+.+.+++..+.| +++++||+|+++.+++.+.. .++.+.|...
T Consensus        84 ~~~~~~~~~~~~~~~~~l~~villiDa~~gl~~~D~~i~~~l~~~~kp-~iivlNK~Dll~~~~~~~~~-~~i~~~l~~~  161 (179)
T TIGR03598        84 KEKWQKLIEEYLRGRENLKGVVLLMDIRHPLKELDLEMLEWLDERGIP-VLIVLTKADKLKKSERNKQL-KKIKKALKKD  161 (179)
T ss_pred             HHHHHHHHHHHHHHHHHHHCEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCHHHHHHHH-HHHHHHHHCC
T ss_conf             999999999999998864302898743779989999999999975998-89999781306989999999-9999997336


Q ss_pred             EEEEEEECCCCEEEEEE
Q ss_conf             45322102331146764
Q gi|254780263|r  158 KYSDDTPIIRGSALCAL  174 (392)
Q Consensus       158 ~~~~~~pii~~sa~~g~  174 (392)
                        ....|++++||+++.
T Consensus       162 --~~~~~v~~ISA~~g~  176 (179)
T TIGR03598       162 --ADDPSVQLFSSLKKT  176 (179)
T ss_pred             --CCCCCEEEEECCCCC
T ss_conf             --688948999799983


No 103
>PRK00454 engB GTPase EngB; Reviewed
Probab=99.74  E-value=7.7e-18  Score=129.66  Aligned_cols=159  Identities=18%  Similarity=0.250  Sum_probs=105.3

Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC----------
Q ss_conf             2799999046898878999999876444200131268686986292063789998219908999847873----------
Q gi|254780263|r   12 SLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH----------   81 (392)
Q Consensus        12 ~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH----------   81 (392)
                      ...||++|...+|||||+.+|++.-.     .+.+..     .-|-|.+..+   ...+..+.|+||||.          
T Consensus        24 ~p~VaivGrpNvGKSTL~N~L~g~k~-----~a~vs~-----~pgtTr~i~~---~~~~~~~~lvDtpGyG~a~~~~~~~   90 (196)
T PRK00454         24 GPEIAFAGRSNVGKSSLINALTNRKN-----LARTSK-----TPGRTQLINF---FEVNDGLRLVDLPGYGYAKVSKEEK   90 (196)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCC-----EEEEEC-----CCCCEEEEEE---EECCCCEEEEECCCCCCCCCCHHHH
T ss_conf             96899984898889999999868973-----699747-----8886079888---7618833899379974132778788


Q ss_pred             HHHHHHH---HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEE
Q ss_conf             0246779---8774002331452012344332106778888631876023310023335612221101232100111014
Q gi|254780263|r   82 ADYVKNM---ITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHK  158 (392)
Q Consensus        82 ~~f~~~m---i~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~  158 (392)
                      .++...+   +......+.++++|||+.|+..|.++-+.++...+.| +++++||+|+++..++..... ++.+.+... 
T Consensus        91 ~~~~~~i~~yl~~~~~l~~villIDa~~g~~~~D~~i~~~l~~~~~p-~iivlNKiD~l~~~~~~~~~~-~i~~~l~~~-  167 (196)
T PRK00454         91 EKWQKLIEEYLQKRENLKGVVLLIDSRHPLKELDLEMIEWLKEAGIP-VLIVLTKADKLKKGERKKLLK-KVKKALARF-  167 (196)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-CEEEEECCHHCCHHHHHHHHH-HHHHHHHHC-
T ss_conf             89999999999962333638999971658988899999999862778-599998725169789999999-999997612-


Q ss_pred             EEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCC
Q ss_conf             532210233114676411444565212332034431025
Q gi|254780263|r  159 YSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHI  197 (392)
Q Consensus       159 ~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~  197 (392)
                       ....+++++||.+|.          +++.|++.|..++
T Consensus       168 -~~~~~ii~ISA~~g~----------GI~eL~~~I~k~L  195 (196)
T PRK00454        168 -AADPEVLLFSSLKKT----------GIDELRAAIAKWL  195 (196)
T ss_pred             -CCCCCEEEEECCCCC----------CHHHHHHHHHHHH
T ss_conf             -589828999699997----------9899999999985


No 104
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=99.73  E-value=2.2e-17  Score=126.83  Aligned_cols=154  Identities=26%  Similarity=0.315  Sum_probs=119.0

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCH-----
Q ss_conf             038827999990468988789999998764442001312686869862920637899982199089998478730-----
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHA-----   82 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~-----   82 (392)
                      ...+.+++|++|-..+|||||+.+|++.-..      -++.     .-|.|.|.-...++++++.|.|+||||-+     
T Consensus       168 ~~~~~iriaivGrPNvGKSTl~N~ll~~~r~------ivs~-----~~GtTrD~i~~~~~~~~~~~~~iDTaGirkk~k~  236 (429)
T TIGR03594       168 EEDGPIKIAIIGRPNVGKSTLVNALLGEERV------IVSD-----IAGTTRDSIDIPFERNGKKYLLIDTAGIRRKGKV  236 (429)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHH------HCCC-----CCCCCCCCEEEEEEECCEEEEEEECCCCCCCCCC
T ss_conf             4556526999748876546777776543332------1479-----9986310268799999908999989887636642


Q ss_pred             -----HH-HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEE
Q ss_conf             -----24-677987740023314520123443321067788886318760233100233356122211012321001110
Q gi|254780263|r   83 -----DY-VKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKE  156 (392)
Q Consensus        83 -----~f-~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~  156 (392)
                           .| +..+++.+..+|+++||+||.+|+..|-..-+.++...|.+ +|+++||+|+++..+.++..+.++...+..
T Consensus       237 ~~~~e~~s~~~t~~~i~~~dvvil~iD~~~~~~~qD~~i~~~i~~~~k~-~ii~~NK~Dli~~~~~~~~~~~~i~~~l~~  315 (429)
T TIGR03594       237 TEGIEKYSVLRTLKAIERADVVLLVLDATEGITEQDLRIAGLALEAGKA-LIIVVNKWDLVKDEKTREEFKKELRRKLPF  315 (429)
T ss_pred             CHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEEHHHCCCCHHHHHHHHHHHHHHCCC
T ss_conf             3047799999999998744779999976658848889999989873997-699997223037999999999999985623


Q ss_pred             EEEEEEEECCCCEEEEEEEC
Q ss_conf             14532210233114676411
Q gi|254780263|r  157 HKYSDDTPIIRGSALCALQG  176 (392)
Q Consensus       157 ~~~~~~~pii~~sa~~g~~~  176 (392)
                      .   ..+|++++||.++...
T Consensus       316 ~---~~~pI~fiSA~~g~gi  332 (429)
T TIGR03594       316 L---DFAPIVFISALTGQGV  332 (429)
T ss_pred             C---CCCCEEEEECCCCCCH
T ss_conf             6---8986899734577899


No 105
>PRK03003 engA GTP-binding protein EngA; Reviewed
Probab=99.72  E-value=3.7e-17  Score=125.48  Aligned_cols=150  Identities=19%  Similarity=0.218  Sum_probs=113.9

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCH--------
Q ss_conf             827999990468988789999998764442001312686869862920637899982199089998478730--------
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHA--------   82 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~--------   82 (392)
                      ..++||++|...+|||||+.+|++.-.      ..++.     .-|-|.|+-...|+++++.|.||||+|-+        
T Consensus       210 ~~~rIAIvGrPNvGKStL~N~llg~~r------~ivs~-----~~GTTRDsI~~~~~~~~~~~~liDTAGiRrk~kv~~~  278 (474)
T PRK03003        210 GPRRVALVGKPNVGKSSLLNKLAGEER------SVVHD-----VAGTTVDPVDSLIELGGKVWRFVDTAGLRRKVGQASG  278 (474)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCC------EEECC-----CCCCCCCCEEEEEEECCEEEEEEECCCCCCCCCCCCC
T ss_conf             762799980899878899999858975------67458-----9985154405899999989999989876635533431


Q ss_pred             --HH-HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE
Q ss_conf             --24-677987740023314520123443321067788886318760233100233356122211012321001110145
Q gi|254780263|r   83 --DY-VKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY  159 (392)
Q Consensus        83 --~f-~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~  159 (392)
                        .| +..++.++..+|+++||+||.+|+..|-..-+.++...|-+ +|+++||+|+++.++... .+.++...|..   
T Consensus       279 iE~~s~~rtl~aI~~advvilviDa~egit~QD~~Ia~~v~~~gk~-~IivvNKwDLv~~~~~~~-~~~~i~~~l~~---  353 (474)
T PRK03003        279 HEFYASLRTHAAIDAAEVAVVLIDASEPLTEQDQRVLSMVIEAGRA-LVLAFNKWDLVDEDRRYY-LEREIDRELAQ---  353 (474)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCC-EEEEEECHHCCCHHHHHH-HHHHHHHHHHH---
T ss_conf             4589999999998733557999854658749999999999980995-799997144168678999-99999864554---


Q ss_pred             EEEEECCCCEEEEEEEC
Q ss_conf             32210233114676411
Q gi|254780263|r  160 SDDTPIIRGSALCALQG  176 (392)
Q Consensus       160 ~~~~pii~~sa~~g~~~  176 (392)
                      ...+|++++||++|.+.
T Consensus       354 ~~~~piv~ISA~~g~~i  370 (474)
T PRK03003        354 VRWAPRVNISAKTGRAV  370 (474)
T ss_pred             CCCCCEEEEEEECCCCH
T ss_conf             48985699981048798


No 106
>cd04093 HBS1_C HBS1_C: this family represents the C-terminal domain of Hsp70 subfamily B suppressor 1 (HBS1) which is homologous to the domain III of EF-1alpha. This group contains proteins similar to yeast Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation and, to associate with Dom34.  It has been speculated that yeast Hbs1 and Dom34 proteins may function as part of a complex with a role in gene expression.
Probab=99.72  E-value=8.1e-17  Score=123.35  Aligned_cols=87  Identities=23%  Similarity=0.370  Sum_probs=77.4

Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEE-------------CCCHHHHCCCCEEEEEEEECCCE
Q ss_conf             30001689997105678755551159789999541477799996-------------18955707897699999977817
Q gi|254780263|r  299 EYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIIL-------------SPGSQAVMPGDRVDLEVELIYPI  365 (392)
Q Consensus       299 ~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~-------------~~~~~~i~~g~~~~v~l~l~~pi  365 (392)
                      .+++|+|++.||+.     +.++..||++.+|+|+.++.|++..             +++|++++.|+.|.|+|++++|+
T Consensus         2 vs~~F~A~i~v~~~-----~~pi~~G~~~~~h~~t~~~~~~i~~l~~~id~~tg~~~k~~P~~l~~~~~a~v~i~~~~pi   76 (107)
T cd04093           2 SSTRFEARILTFNV-----DKPILPGTPFELFRHSLKEPATITKLVSILDKSTGEVSKKKPRCLTKGQTAIVEIELERPI   76 (107)
T ss_pred             CCCEEEEEEEEECC-----CCCCCCCCCEEEEECCCEEEEEEEEEEEEECCCCCCEECCCCCCCCCCCEEEEEEECCCCE
T ss_conf             36789999999979-----9765899886999668779199988854404789978678984668899999998849988


Q ss_pred             EECCC------CEEEEEECCEEEEEEEEEEE
Q ss_conf             75469------84999989969998999553
Q gi|254780263|r  366 AMEPN------QTFSMREGGKTVGAGLILEI  390 (392)
Q Consensus       366 ~~e~~------~rfilRd~~~tig~G~I~~v  390 (392)
                      |+|+|      +||+|||+|+|||+|+|++|
T Consensus        77 ~vE~f~~~~~LGRf~LR~~g~Tva~G~I~~v  107 (107)
T cd04093          77 PLELFKDNKELGRVVLRRDGETIAAGLVTEI  107 (107)
T ss_pred             EEEECCCCCCCCEEEEEECCCEEEEEEEEEC
T ss_conf             9968333988534999989988999999989


No 107
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=99.72  E-value=4.6e-17  Score=124.84  Aligned_cols=145  Identities=23%  Similarity=0.280  Sum_probs=99.3

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHH--------
Q ss_conf             799999046898878999999876444200131268686986292063789998219908999847873024--------
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADY--------   84 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f--------   84 (392)
                      ++|+++|..++|||||+.+|++...      +....     .-|.|.+.-...+.++++.+.|+||||-.+.        
T Consensus         2 ~~ValvG~pN~GKStL~N~l~g~~~------~ivs~-----~pgtTrd~~~~~~~~~~~~i~l~DTpG~~~~~~~~e~~~   70 (157)
T cd04164           2 IKVVIVGKPNVGKSSLLNALAGRDR------AIVSD-----IAGTTRDVIEESIDIGGIPVRLIDTAGIRETEDEIEKIG   70 (157)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC------EEECC-----CCCEEEECCEEEEEECCEEEEEEECCCCCCCCCHHHHHH
T ss_conf             7999988999989999999968973------34328-----898478632678953998899972677544457899999


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             67798774002331452012344332106778888631876023310023335612221101232100111014532210
Q gi|254780263|r   85 VKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        85 ~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                      ++.....+..+|.+++|+|++.+...+-.+  .+.+..+.| +++++||+|+++.++.++..              ...+
T Consensus        71 ~~~~~~~i~~aDlil~vvD~~~~~~~~~~~--~~~~~~~~p-~i~v~NKiDl~~~~~~~~~~--------------~~~~  133 (157)
T cd04164          71 IERAREAIEEADLVLFVIDASRGLDEEDLE--ILELPADKP-IIVVLNKSDLLPDSELLSLL--------------AGKP  133 (157)
T ss_pred             HHHHHHHCCCCCEEEEEEECCCCCCHHHHH--HHHHHCCCC-EEEEEECCCCCCCHHHHHHC--------------CCCC
T ss_conf             999986301576799998898778888999--998514799-89999676014866679852--------------8997


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             2331146764114445652123320344310
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                      ++|+||.+|.          +++.|++.|.+
T Consensus       134 vi~ISA~~g~----------Gi~~L~~~I~e  154 (157)
T cd04164         134 IIAISAKTGE----------GLDELKEALLE  154 (157)
T ss_pred             EEEEECCCCC----------CHHHHHHHHHH
T ss_conf             7999852795----------99999999999


No 108
>cd03707 EFTU_III Domain III of elongation factor (EF) Tu. Ef-Tu consists of three structural domains, designated I, II and III. Domain III adopts a beta barrel structure. Domain III is involved in binding to both charged tRNA and binding to elongation factor Ts (EF-Ts). EF-Ts is the guanine-nucleotide-exchange factor for EF-Tu.  EF-Tu and EF-G participate in the elongation phase during protein biosynthesis on the ribosome. Their functional cycles depend on GTP binding and its hydrolysis. The EF-Tu complexed with GTP and aminoacyl-tRNA delivers tRNA to the ribosome, whereas EF-G stimulates translocation, a process in which tRNA and mRNA movements occur in the ribosome. Crystallographic studies revealed structural similarities ("molecular mimicry") between tertiary structures of EF-G and the EF-Tu-aminoacyl-tRNA ternary complex. Domains III, IV, and V of EF-G mimic the tRNA structure in the EF-Tu ternary complex; domains III, IV and V can be related to the acceptor stem, anticodon helix 
Probab=99.72  E-value=3.3e-17  Score=125.74  Aligned_cols=90  Identities=56%  Similarity=0.983  Sum_probs=86.4

Q ss_pred             CCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEEEE
Q ss_conf             63000168999710567875555115978999954147779999618955707897699999977817754698499998
Q gi|254780263|r  298 QEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMRE  377 (392)
Q Consensus       298 ~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilRd  377 (392)
                      ++.++|+|++++|+.+++++.+++..+|+|++++.+++++|++.+.++.+.+.|||.+.+.++|.+|+++++++||.||+
T Consensus         1 k~h~kf~A~vYvLtkeEGGR~~pf~~~YrpQ~f~rT~Dvtg~i~~~~~~~mvmPGd~~~~~v~L~~p~~le~g~rFtiRE   80 (90)
T cd03707           1 KPHTKFEAEVYVLTKEEGGRHTPFFSGYRPQFYIRTTDVTGSITLPEGTEMVMPGDNVKMTVELIHPIALEKGLRFAIRE   80 (90)
T ss_pred             CCCCEEEEEEEEECHHHCCCCCCCCCCCCCEEEEEECCCCEEEEECCCCEEECCCCEEEEEEEECCCCCCCCCCEEEEEE
T ss_conf             99778999999974778888788867771169998358577999018855973577289999987873147899699978


Q ss_pred             CCEEEEEEEE
Q ss_conf             9969998999
Q gi|254780263|r  378 GGKTVGAGLI  387 (392)
Q Consensus       378 ~~~tig~G~I  387 (392)
                      +|+|||.|+|
T Consensus        81 Gg~TVg~GiI   90 (90)
T cd03707          81 GGRTVGAGVI   90 (90)
T ss_pred             CCEEEEEEEC
T ss_conf             9998987789


No 109
>COG1159 Era GTPase [General function prediction only]
Probab=99.70  E-value=5.8e-17  Score=124.26  Aligned_cols=174  Identities=20%  Similarity=0.234  Sum_probs=106.8

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC-CH---HHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378999821990899984787-30---246779
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG-HA---DYVKNM   88 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG-H~---~f~~~m   88 (392)
                      --++++|-..+|||||+.+|.+.--.-.....++-+   -+-+||        +..+++.|.|+|||| |+   .+-+-|
T Consensus         7 GfVaIiGrPNvGKSTLlN~l~G~KisIvS~k~QTTR---~~I~GI--------~t~~~~QiIfvDTPGih~pk~~l~~~m   75 (298)
T COG1159           7 GFVAIIGRPNVGKSTLLNALVGQKISIVSPKPQTTR---NRIRGI--------VTTDNAQIIFVDTPGIHKPKHALGELM   75 (298)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCEEEECCCCCHHH---HHEEEE--------EECCCCEEEEEECCCCCCCCHHHHHHH
T ss_conf             999998699876899998985682575159853114---421479--------986984499984898887651788999


Q ss_pred             HH----HHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             87----74002331452012344332106778888631876023310023335612221101232100111014532210
Q gi|254780263|r   89 IT----GATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        89 i~----g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                      .+    ++..+|..++||||.+++.+-.+..+..++....| .|+++||+|.+.++.......+....   ...|.   .
T Consensus        76 ~~~a~~sl~dvDlilfvvd~~~~~~~~d~~il~~lk~~~~p-vil~iNKID~~~~~~~l~~~~~~~~~---~~~f~---~  148 (298)
T COG1159          76 NKAARSALKDVDLILFVVDADEGWGPGDEFILEQLKKTKTP-VILVVNKIDKVKPKTVLLKLIAFLKK---LLPFK---E  148 (298)
T ss_pred             HHHHHHHHCCCCEEEEEEECCCCCCCCHHHHHHHHHHCCCC-EEEEEECCCCCCCHHHHHHHHHHHHH---HCCCC---E
T ss_conf             99999872457599999866656891079999977643898-69999840257847789999999985---08830---1


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCC------CCCCCCCCCEECCC
Q ss_conf             233114676411444565212332034431025222------21000011000000
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTP------QRSLDAPFLMHIEG  214 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p------~~~~~~p~r~~I~~  214 (392)
                      ++|+||+.|.          +...|++.+..++|.-      ..-.|.|-||.+.+
T Consensus       149 ivpiSA~~g~----------n~~~L~~~i~~~Lpeg~~~yp~d~itD~~~rf~~aE  194 (298)
T COG1159         149 IVPISALKGD----------NVDTLLEIIKEYLPEGPWYYPEDQITDRPERFLAAE  194 (298)
T ss_pred             EEEEECCCCC----------CHHHHHHHHHHHCCCCCCCCCHHHCCCCHHHHHHHH
T ss_conf             7995101567----------889999999985888888488565158708889999


No 110
>pfam02421 FeoB_N Ferrous iron transport protein B. Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=99.69  E-value=1.5e-16  Score=121.59  Aligned_cols=153  Identities=21%  Similarity=0.265  Sum_probs=97.7

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHH---H-HHHH
Q ss_conf             99999046898878999999876444200131268686986292063789998219908999847873024---6-7798
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADY---V-KNMI   89 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f---~-~~mi   89 (392)
                      .|+++|..++|||||+.+|++...       ....     .-|.|.+.....+.++++.+.|+||||..++   . .+++
T Consensus         1 tVaIvG~PNvGKSTLlN~L~g~~~-------~Vs~-----~pGtTrd~~~~~~~~~~~~~~lvDTpGi~~~~~~~~~e~v   68 (188)
T pfam02421         1 TIALVGNPNVGKTTLFNALTGARQ-------HVGN-----WPGVTVEKKEGTFKYKGYEIEIVDLPGTYSLSPYSEEEKV   68 (188)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCC-------EEEC-----CCCCCCCEEEEEEEECCEEEEEEECCCCCCCCCCCHHHHH
T ss_conf             989988999899999999959996-------5638-----9997233357687525167999968885014653278999


Q ss_pred             H-H---HHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEEC
Q ss_conf             7-7---40023314520123443321067788886318760233100233356122211012321001110145322102
Q gi|254780263|r   90 T-G---ATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPI  165 (392)
Q Consensus        90 ~-g---~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pi  165 (392)
                      . .   ...+|.+++|+||+.- . ++..-+..+..++.| +|+++||+|+++.++..... .++.+.+       +.|+
T Consensus        69 ~~~~~~~~~aDlvl~vvDa~~~-e-r~l~l~~~l~~~~~p-~IvVlNK~Dl~~~~~~~~~~-~~l~~~l-------g~~v  137 (188)
T pfam02421        69 ARDYLLEEKPDVIINVVDATNL-E-RNLYLTLQLLELGIP-VVVALNMMDEAEKKGIKIDI-KKLSELL-------GVPV  137 (188)
T ss_pred             HHHHHHHCCCCCEEEEEECCCH-H-HHHHHHHHHHHCCCC-EEEEECCCHHCCCCCCHHHH-HHHHHHC-------CCCE
T ss_conf             9999862368736999767624-5-448999999976998-89996170201003652039-9999873-------9968


Q ss_pred             CCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCC
Q ss_conf             3311467641144456521233203443102522
Q gi|254780263|r  166 IRGSALCALQGTNKELGEDSIHALMKAVDTHIPT  199 (392)
Q Consensus       166 i~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~  199 (392)
                      +++||.+|.          +++.|++.|.+..+.
T Consensus       138 i~ISA~~g~----------Gi~eL~~~I~~~~~~  161 (188)
T pfam02421       138 VPTSARKGE----------GIDELKDAIIEVAEG  161 (188)
T ss_pred             EEEEEECCC----------CHHHHHHHHHHHHHC
T ss_conf             999931699----------999999999999726


No 111
>PRK09518 bifunctional cytidylate kinase/GTP-binding protein; Reviewed
Probab=99.68  E-value=2e-16  Score=120.87  Aligned_cols=150  Identities=18%  Similarity=0.166  Sum_probs=113.9

Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC----------
Q ss_conf             2799999046898878999999876444200131268686986292063789998219908999847873----------
Q gi|254780263|r   12 SLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH----------   81 (392)
Q Consensus        12 ~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH----------   81 (392)
                      .++||++|-.+.|||||+.+|++.-.-      ..+.     .-|-|.|+-...|+++++.|.||||+|-          
T Consensus       452 ~~rIAIIGRPNVGKSTLiN~LlgeeR~------IVs~-----iaGTTRDsId~~~~~~g~~~~lIDTAGiRkk~k~~~~i  520 (714)
T PRK09518        452 LRRVALVGRPNVGKSSLLNQLTREERA------VVND-----LAGTTRDPVDEIVNIDGKDWLFVDTAGIRRKQKKLTGA  520 (714)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCEE------EECC-----CCCCEECEEEEEEEECCEEEEEEECHHCCCCCCCCCCC
T ss_conf             735888669988789999999689758------8568-----89850230556799999789999860015244325432


Q ss_pred             HHHH-HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEE
Q ss_conf             0246-779877400233145201234433210677888863187602331002333561222110123210011101453
Q gi|254780263|r   82 ADYV-KNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYS  160 (392)
Q Consensus        82 ~~f~-~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~  160 (392)
                      +.|. ...++++..+|+|+||+||.+|+..|-..-+.++...|-+ +|+++||+|+++.++. +..+.+++..|...   
T Consensus       521 E~~S~~rt~~aI~~adVvllviDA~~git~QD~~Ia~~i~~~gk~-~IivvNKWDLv~~~~~-~~~~~~i~~~l~~~---  595 (714)
T PRK09518        521 EYYASLRTQAAIERCELALILFDASQPISEQDLRVMSMAVDAGRA-LVLAFNKWDLMDEFRR-QRLEREIDTEFDRV---  595 (714)
T ss_pred             CHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCC-EEEEEECHHCCCHHHH-HHHHHHHHHHCCCC---
T ss_conf             279999999988658899999867767528999999999985993-7999961430686689-99999999756368---


Q ss_pred             EEEECCCCEEEEEEECC
Q ss_conf             22102331146764114
Q gi|254780263|r  161 DDTPIIRGSALCALQGT  177 (392)
Q Consensus       161 ~~~pii~~sa~~g~~~~  177 (392)
                      ..+|++++||.+|+...
T Consensus       596 ~~apiv~iSA~~g~~v~  612 (714)
T PRK09518        596 MWAERVNISAKTGRHTN  612 (714)
T ss_pred             CCCCEEEEECCCCCCHH
T ss_conf             99988999667897889


No 112
>cd03704 eRF3c_III This family represents eEF1alpha-like C-terminal region of eRF3 homologous to the domain III of EF-Tu. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. The C-terminal region is responsible for translation termination activity and is essential for viability. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination.  Sup35NM  is a non-pathogenic prion-like protein with the property of aggregating into polymer-like fibrils.
Probab=99.68  E-value=4.2e-16  Score=118.88  Aligned_cols=87  Identities=25%  Similarity=0.354  Sum_probs=77.0

Q ss_pred             CCEEEEEEEEEEECCCCCCCCCC-CCCCEEEEEECCEEEEEEEE-------------ECCCHHHHCCCCEEEEEEEECCC
Q ss_conf             30001689997105678755551-15978999954147779999-------------61895570789769999997781
Q gi|254780263|r  299 EYSRFRASVYILTASEGGRTTGF-MDNYRPQFFMDTADVTGRII-------------LSPGSQAVMPGDRVDLEVELIYP  364 (392)
Q Consensus       299 ~~~~f~A~i~il~~~~~~~~~~~-~~~~~~~~~~~~~~v~~~i~-------------~~~~~~~i~~g~~~~v~l~l~~p  364 (392)
                      .+.+|+|+|.+|+.     +.++ ..||++.+|+++++..|++.             ..++|+++++|+.|.|+|++.+|
T Consensus         2 v~~~F~AqI~v~~~-----~~~Ii~~Gy~~v~h~ht~~~~~~i~~l~~~~d~~tg~~~k~~P~~l~~g~~a~v~i~~~~p   76 (108)
T cd03704           2 VVTEFEAQIAILEL-----KRSIITAGYSAVLHIHTAVEEVTIKKLIALIDKKTGKKSKKRPRFVKSGMKVIARLETTGP   76 (108)
T ss_pred             CCCEEEEEEEEECC-----CCCCCCCCCCEEEEECCCCCCEEHHHHHHHHCCCCCCEECCCCCCCCCCCEEEEEEEECCC
T ss_conf             53289999999919-----9851459976599955771068987868877467897765597335899989999996993


Q ss_pred             EEECCC------CEEEEEECCEEEEEEEEEEE
Q ss_conf             775469------84999989969998999553
Q gi|254780263|r  365 IAMEPN------QTFSMREGGKTVGAGLILEI  390 (392)
Q Consensus       365 i~~e~~------~rfilRd~~~tig~G~I~~v  390 (392)
                      +|+|+|      +||+|||+|+|||+|+|++|
T Consensus        77 i~iE~f~~~~~LGRf~lRd~g~TIa~G~V~~v  108 (108)
T cd03704          77 ICLEKFEDFPQLGRFTLRDEGKTIAIGKVLKL  108 (108)
T ss_pred             EEEEEHHHCCCCCCEEEEECCCEEEEEEEEEC
T ss_conf             48988301988477899829978999999989


No 113
>cd03705 EF1_alpha_III Domain III of EF-1. Eukaryotic elongation factor 1 (EF-1) is responsible for the GTP-dependent binding of aminoacyl-tRNAs to ribosomes. EF-1 is composed of four subunits: the alpha chain, which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains. This family is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF-1 alpha) and eukaryotes (eEF-1 alpha).
Probab=99.67  E-value=7.8e-16  Score=117.22  Aligned_cols=84  Identities=24%  Similarity=0.363  Sum_probs=75.6

Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEE-------------CCCHHHHCCCCEEEEEEEECCCE
Q ss_conf             30001689997105678755551159789999541477799996-------------18955707897699999977817
Q gi|254780263|r  299 EYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIIL-------------SPGSQAVMPGDRVDLEVELIYPI  365 (392)
Q Consensus       299 ~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~-------------~~~~~~i~~g~~~~v~l~l~~pi  365 (392)
                      .+.+|+|+|.+|+     |+.++..||++.+|++++++.|++..             +++|+++++|+.|.|+|++++|+
T Consensus         2 ~~~~F~AqI~vl~-----~p~~I~~Gy~~v~h~ht~~~~~~i~~l~~~~d~~tg~~~~~~P~~l~~g~~a~v~i~~~~pi   76 (104)
T cd03705           2 VAESFTAQVIVLN-----HPGQIKPGYTPVLDCHTAHVACRFAEILSKIDPRTGKKLEENPKFLKSGDAAIVKIVPQKPL   76 (104)
T ss_pred             CCCEEEEEEEEEC-----CCCCCCCCCEEEEEEEECEEEEEEEEEEEEECCCCCCEECCCCCCCCCCCEEEEEEEECCCE
T ss_conf             4437999999997-----99850299546899740512279446776405788879654983027765799999979946


Q ss_pred             EECCC------CEEEEEECCEEEEEEEE
Q ss_conf             75469------84999989969998999
Q gi|254780263|r  366 AMEPN------QTFSMREGGKTVGAGLI  387 (392)
Q Consensus       366 ~~e~~------~rfilRd~~~tig~G~I  387 (392)
                      |+|+|      +||+|||+|+|||+|+|
T Consensus        77 ~vE~f~~~~~LGRf~lRd~g~Tia~G~V  104 (104)
T cd03705          77 VVETFSEYPPLGRFAVRDMGQTVAVGIV  104 (104)
T ss_pred             EEEECCCCCCCCCEEEEECCCEEEEEEC
T ss_conf             8850003986555999989958998969


No 114
>cd01513 Translation_factor_III Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G.  Elongation factors (EF) EF-Tu and EF-G participate in the elongation phase during protein biosynthesis on the ribosome. Their functional cycles depend on GTP binding and its hydrolysis. The EF-Tu complexed with GTP and aminoacyl-tRNA delivers tRNA to the ribosome, whereas EF-G stimulates translocation, a process in which tRNA and mRNA movements occur in the ribosome. Experimental data showed that: (1) intrinsic GTPase activity of EF-G is influenced by excision of its domain III; (2) that EF-G lacking domain III has a 1,000-fold decreased GTPase activity on the ribosome and, a slightly decreased affinity for GTP; and (3) EF-G lacking domain III does not stimulate translocation, despite the physical presence of domain IV which is also very important for translocation. These findings indicate an essential contribution of domain III to activation of GTP hydrolysis. Domains III and V of EF-G have the s
Probab=99.67  E-value=6.3e-16  Score=117.80  Aligned_cols=85  Identities=39%  Similarity=0.633  Sum_probs=75.5

Q ss_pred             CCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEEC-----------CCHHHHCCCCEEEEEEEECCCEE
Q ss_conf             6300016899971056787555511597899995414777999961-----------89557078976999999778177
Q gi|254780263|r  298 QEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILS-----------PGSQAVMPGDRVDLEVELIYPIA  366 (392)
Q Consensus       298 ~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~-----------~~~~~i~~g~~~~v~l~l~~pi~  366 (392)
                      +.+++|+|+|.||+.     +.++..||++++|+++++++|++...           .+++++++||.+.|++++.+|+|
T Consensus         1 k~~~~F~A~i~i~~~-----~~~i~~G~~~~l~~~t~~v~~~i~~l~~~id~~t~~~~~p~~l~~g~~a~v~i~~~~pi~   75 (102)
T cd01513           1 QAVDKFVAEIYVLDH-----PEPLSPGYKPVLNVGTAHVPGRIAKLLSKVDGKTEEKKPPEFLKSGERGIVEVELQKPVA   75 (102)
T ss_pred             CCCCEEEEEEEEECC-----CCCCCCCCCEEEEEECCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEECCCCE
T ss_conf             965689999999989-----877689982599973561877986645422556444669748248983889999798636


Q ss_pred             ECCC------CEEEEEECCEEEEEEEE
Q ss_conf             5469------84999989969998999
Q gi|254780263|r  367 MEPN------QTFSMREGGKTVGAGLI  387 (392)
Q Consensus       367 ~e~~------~rfilRd~~~tig~G~I  387 (392)
                      +|+|      +||+|||+|+|||+|+|
T Consensus        76 ve~~~~~~~lGRFilrd~g~TVa~G~V  102 (102)
T cd01513          76 LETFSENQEGGRFALRDGGRTVGAGLI  102 (102)
T ss_pred             ECHHCCCCCCCCEEEEECCCEEEEEEC
T ss_conf             510101888760999989988998879


No 115
>PRK04213 GTP-binding protein; Provisional
Probab=99.65  E-value=8e-16  Score=117.17  Aligned_cols=159  Identities=25%  Similarity=0.342  Sum_probs=100.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC-------HH---
Q ss_conf             99999046898878999999876444200131268686986292063789998219908999847873-------02---
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH-------AD---   83 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH-------~~---   83 (392)
                      -||++|....|||||+.+|++....       +.     ..-|.|.+..+  +.++  .+.|+||||.       ..   
T Consensus         3 ~VaivGRpNVGKSTL~N~L~g~k~~-------vs-----~~pg~Tr~~~~--~~~~--~~~~vDtPG~g~~~~~~~~~~~   66 (195)
T PRK04213          3 EIIFVGRSNVGKSTLIRALTGKKVR-------VG-----KRPGVTLKPNE--YDWG--DFILVDLPGFGFMSGVPKKVQE   66 (195)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCC-------CC-----CCCCEEEEEEE--EECC--CEEEEECCCCCCCCCCCHHHHH
T ss_conf             7999769998899999999689851-------34-----89964873458--8508--8999999996222458888999


Q ss_pred             HHH-HHH----HHHHCCCCEEEEECCCCCC-----------CCCHHHHHHHHHHCCCCCEEEEECCCCCCCC-HHHHHHC
Q ss_conf             467-798----7740023314520123443-----------3210677888863187602331002333561-2221101
Q gi|254780263|r   84 YVK-NMI----TGATQADGAILVCAAEDGP-----------KPQTREHILLARQIGISSIVVYMNKVDAVDD-DELLDIS  146 (392)
Q Consensus        84 f~~-~mi----~g~~~~D~ailvVda~~G~-----------~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~-~~~~~~i  146 (392)
                      -+. .|.    ..+..+|.+++||||..++           .++..+-+..++.+++| +|+++||+|++.. ++..+.+
T Consensus        67 ~~~~~~~~~~~~~~~~~~~~~~vvD~~~~~~~~dr~~~~~~~~~D~~i~~~l~~~~~p-~ilv~NKiD~i~~~~~~l~~i  145 (195)
T PRK04213         67 RIKDEIVHYIEDNADRIAAAVLVVDGKSFPEIIERWESRGEIPIDVEMFDFLRELGIN-PIVAVNKMDKIKNSEEVLDEI  145 (195)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCC-EEEEEECHHHCCCHHHHHHHH
T ss_conf             9999999999998851789999995786544211234456777789999999874998-799998733058778889999


Q ss_pred             CCCCCEEEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCC
Q ss_conf             23210011101453221023311467641144456521233203443102522221
Q gi|254780263|r  147 EYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQR  202 (392)
Q Consensus       147 ~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~  202 (392)
                      .+.+........+.  ..++++||..+           +++.|++.|..++|.-.+
T Consensus       146 ~e~~~~~~~~~~~~--~~iv~iSakk~-----------Gid~L~~~I~~~L~E~~~  188 (195)
T PRK04213        146 AERLGLYPPWRQWL--DIIAPISAKKG-----------GIEALKGLINKRLREFKR  188 (195)
T ss_pred             HHHHHCCCCHHHCC--CEEEEEECCCC-----------CHHHHHHHHHHHCHHHCC
T ss_conf             99982576156569--87999845779-----------999999999996755374


No 116
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu. Escherichia coli ATPS consists of CysN and a smaller subunit CysD and CysN. ATPS produces adenosine-5'-phosphosulfate (APS) from ATP and sulfate, coupled with GTP hydrolysis. In the subsequent reaction APS is phosphorylated by an APS kinase (CysC), to produce 3'-phosphoadenosine-5'-phosphosulfate (PAPS) for use in amino acid (aa) biosynthesis. The Rhizobiaceae group (alpha-proteobacteria) appears to carry out the same chemistry for the sufation of a nodulation factor. In Rhizobium meliloti, a the hererodimeric complex comprised of NodP and NodQ appears to possess both ATPS and APS kinase activities. The N and C termini of NodQ correspond to CysN and CysC, respectively.   Other eubacteria, Archaea, and eukaryotes use a different ATP sulfurylase, which sho
Probab=99.64  E-value=1e-16  Score=122.77  Aligned_cols=81  Identities=31%  Similarity=0.459  Sum_probs=74.8

Q ss_pred             CCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEC
Q ss_conf             10000000135544543014874245348967999506874321254121001211443210013666411245432202
Q gi|254780263|r  208 FLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPR  287 (392)
Q Consensus       208 ~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~r  287 (392)
                      ||||||++++..+.++.++|+|++|++++||++.++|++   ..++|++|+.+++++++|.+||+|+++|+  +..|++|
T Consensus         1 fr~PVQ~V~r~~~~~R~~~G~v~sG~v~~GD~v~i~Psg---~~a~Vk~I~~~~~~~~~A~aG~~v~l~L~--~eidisR   75 (81)
T cd03695           1 FRFPVQYVIRPNADFRGYAGTIASGSIRVGDEVVVLPSG---KTSRVKSIETFDGELDEAGAGESVTLTLE--DEIDVSR   75 (81)
T ss_pred             CCCCEEEEEECCCCCCEEEEEEEECCEECCCEEEECCCC---CCEEEEEEEECCCCCCEECCCCEEEEEEC--CCCCCCC
T ss_conf             932518998269984689999933558389999968999---81899899958998248879982899978--7311579


Q ss_pred             HHEEEC
Q ss_conf             117732
Q gi|254780263|r  288 GRVVCA  293 (392)
Q Consensus       288 Gdvl~~  293 (392)
                      ||+|++
T Consensus        76 Gdvi~s   81 (81)
T cd03695          76 GDVIVA   81 (81)
T ss_pred             CCEEEC
T ss_conf             879859


No 117
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=99.63  E-value=1.6e-15  Score=115.25  Aligned_cols=154  Identities=21%  Similarity=0.255  Sum_probs=93.5

Q ss_pred             CCCCEE-EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC-CCEEEEEEECCC-CHHH
Q ss_conf             038827-9999904689887899999987644420013126868698629206378999821-990899984787-3024
Q gi|254780263|r    8 RNKESL-GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET-DKRFYSHIDCPG-HADY   84 (392)
Q Consensus         8 ~~k~~~-ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~-~~~~i~iiD~PG-H~~f   84 (392)
                      +.|..+ .|+++|..++|||||+.+|++.-...      -|      .-|-|.+.......+ +++.+.|+|||| ..+.
T Consensus        36 r~~~g~p~VaivG~PNvGKSTLlN~L~g~~~~v------~~------~~~tT~d~~~~~i~~~~~~~i~l~DT~G~i~~~  103 (204)
T cd01878          36 RKRSGIPTVALVGYTNAGKSTLFNALTGADVYA------ED------QLFATLDPTTRRLRLPDGREVLLTDTVGFIRDL  103 (204)
T ss_pred             HHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEE------EC------CCCCCCCCEEEEEEECCCCEEEEEECCCCCCCC
T ss_conf             774599879998899998999999994899634------15------677645763668995699779998368644678


Q ss_pred             H-------HHHHHHHHCCCCEEEEECCCCCC-CCCHHHHHHHHHHCCC--CCEEEEECCCCCCCCHHHHHHCCCCCCEEE
Q ss_conf             6-------77987740023314520123443-3210677888863187--602331002333561222110123210011
Q gi|254780263|r   85 V-------KNMITGATQADGAILVCAAEDGP-KPQTREHILLARQIGI--SSIVVYMNKVDAVDDDELLDISEYEIRDLL  154 (392)
Q Consensus        85 ~-------~~mi~g~~~~D~ailvVda~~G~-~~QT~eh~~l~~~lgi--~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l  154 (392)
                      -       +.++..+..||..++||||+... ..|......+++.++.  +++|+++||+|+++.++..+..        
T Consensus       104 p~~lie~~~~tle~i~~AD~il~vvD~s~~~~~~~~~~~~~~l~~l~~~~k~~i~V~NKiDl~~~~~~~~~~--------  175 (204)
T cd01878         104 PHQLVEAFRSTLEEVAEADLLLHVVDASDPDYEEQIETVEKVLKELGAEDIPMILVLNKIDLLDDEELEERL--------  175 (204)
T ss_pred             CHHHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHHH--------
T ss_conf             378999999999999739899999979985366779999999998065557607888670479957589999--------


Q ss_pred             EEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             10145322102331146764114445652123320344310
Q gi|254780263|r  155 KEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       155 ~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                      ..    ...+++++||.+|.          +++.|.+.|.+
T Consensus       176 ~~----~~~~~i~ISA~~g~----------Gid~L~~~I~e  202 (204)
T cd01878         176 EA----GRPDAVFISAKTGE----------GLDELLEAIEE  202 (204)
T ss_pred             HH----CCCCEEEEECCCCC----------CHHHHHHHHHH
T ss_conf             70----89987999886894----------99999999995


No 118
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily.  E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions.  FeoB has been identified as part of this transport system.  FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=99.63  E-value=6.1e-16  Score=117.90  Aligned_cols=146  Identities=21%  Similarity=0.316  Sum_probs=92.8

Q ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHH---------HHH
Q ss_conf             99046898878999999876444200131268686986292063789998219908999847873024---------677
Q gi|254780263|r   17 TIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADY---------VKN   87 (392)
Q Consensus        17 ~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f---------~~~   87 (392)
                      ++|...+|||||+.+|++....       ...     .-|.|.+.....+.+++..+.|+||||..++         .++
T Consensus         1 ivG~pNvGKSTL~N~L~g~~~~-------vs~-----~pgtTrd~~~~~~~~~~~~~~lvDtpGi~~~~~~~~~e~i~~~   68 (158)
T cd01879           1 LVGNPNVGKTTLFNALTGARQK-------VGN-----WPGVTVEKKEGRFKLGGKEIEIVDLPGTYSLSPYSEDEKVARD   68 (158)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCE-------ECC-----CCCCEEEEEEEEEEECCEEEEEEECCCCCCCCCCCHHHHHHHH
T ss_conf             9798988899999999599864-------617-----8982763478899629937999979874125641356789999


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCC
Q ss_conf             98774002331452012344332106778888631876023310023335612221101232100111014532210233
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIR  167 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~  167 (392)
                      .+.. ..+|.+++|+||+. +. +..+.+.....++.| +|+++||+|+++.++..... +++.+.+       +.|+++
T Consensus        69 ~~~~-~~~d~vl~vvD~~~-~~-~~l~~~~~l~~~~~p-~ivV~NK~D~~~~~~~~~~~-~~l~~~~-------~~~ii~  136 (158)
T cd01879          69 FLLG-EKPDLIVNVVDATN-LE-RNLYLTLQLLELGLP-VVVALNMIDEAEKRGIKIDL-DKLSELL-------GVPVVP  136 (158)
T ss_pred             HHHH-CCCCCEEEEEECCH-HH-HHHHHHHHHHHCCCC-EEEEEEHHHHHHHCCCHHHH-HHHHHHC-------CCCEEE
T ss_conf             9985-17871799977740-67-768999999865998-89994027765522546679-9999871-------994899


Q ss_pred             CEEEEEEECCCCCCCCCCCCCHHHHHHCC
Q ss_conf             11467641144456521233203443102
Q gi|254780263|r  168 GSALCALQGTNKELGEDSIHALMKAVDTH  196 (392)
Q Consensus       168 ~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~  196 (392)
                      +||.+|.          ++..|++.+.+.
T Consensus       137 iSA~~g~----------Gi~~L~~~i~el  155 (158)
T cd01879         137 TSARKGE----------GIDELKDAIAEL  155 (158)
T ss_pred             EECCCCC----------CHHHHHHHHHHH
T ss_conf             9877897----------999999999998


No 119
>COG1160 Predicted GTPases [General function prediction only]
Probab=99.62  E-value=1e-15  Score=116.50  Aligned_cols=150  Identities=26%  Similarity=0.332  Sum_probs=119.2

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC---------
Q ss_conf             82799999046898878999999876444200131268686986292063789998219908999847873---------
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH---------   81 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH---------   81 (392)
                      +.+.||++|....|||||+.+|++...      .-.+-     .-|.|+|+-...|++++++|.||||.|-         
T Consensus       177 ~~ikiaiiGrPNvGKSsLiN~ilgeeR------~Iv~~-----~aGTTRD~I~~~~e~~~~~~~liDTAGiRrk~ki~e~  245 (444)
T COG1160         177 DPIKIAIIGRPNVGKSSLINAILGEER------VIVSD-----IAGTTRDSIDIEFERDGRKYVLIDTAGIRRKGKITES  245 (444)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHCCCCE------EEECC-----CCCCCCCCEEEEEEECCEEEEEEECCCCCCCCCCCCC
T ss_conf             750899992787870588877506825------98459-----9986220331258998818999987787746641242


Q ss_pred             -HHHH-HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCC-HHHHHHCCCCCCEEEEEEE
Q ss_conf             -0246-779877400233145201234433210677888863187602331002333561-2221101232100111014
Q gi|254780263|r   82 -ADYV-KNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDD-DELLDISEYEIRDLLKEHK  158 (392)
Q Consensus        82 -~~f~-~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~-~~~~~~i~~~i~~~l~~~~  158 (392)
                       +.|. --++.+...+|.++||+||.+|+..|-.+-+.++...|-. +|+++||+|+++. +...+..+.++...|...+
T Consensus       246 ~E~~Sv~rt~~aI~~a~vvllviDa~~~~~~qD~~ia~~i~~~g~~-~vIvvNKWDl~~~~~~~~~~~k~~i~~~l~~l~  324 (444)
T COG1160         246 VEKYSVARTLKAIERADVVLLVIDATEGISEQDLRIAGLIEEAGRG-IVIVVNKWDLVEEDEATMEEFKKKLRRKLPFLD  324 (444)
T ss_pred             EEEEEEHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHCCCC-EEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCC
T ss_conf             6887505467678656889999988878368899999999975897-499997532578516679999999998722136


Q ss_pred             EEEEEECCCCEEEEEEE
Q ss_conf             53221023311467641
Q gi|254780263|r  159 YSDDTPIIRGSALCALQ  175 (392)
Q Consensus       159 ~~~~~pii~~sa~~g~~  175 (392)
                         -+|++++||.++..
T Consensus       325 ---~a~i~~iSA~~~~~  338 (444)
T COG1160         325 ---FAPIVFISALTGQG  338 (444)
T ss_pred             ---CCEEEEEEECCCCC
T ss_conf             ---77279997047877


No 120
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=99.60  E-value=2.7e-15  Score=113.89  Aligned_cols=152  Identities=21%  Similarity=0.279  Sum_probs=91.9

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC-CCEEEEEEECCC-----CHHH--H
Q ss_conf             9999904689887899999987644420013126868698629206378999821-990899984787-----3024--6
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET-DKRFYSHIDCPG-----HADY--V   85 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~-~~~~i~iiD~PG-----H~~f--~   85 (392)
                      +||++|-..+|||||+.+|++......      |      .-|-|.+.....+.+ +++.+.|+||||     |++.  .
T Consensus         2 ~VAiiG~pNvGKSTLlN~l~~~~~~V~------~------~pgTT~~~~~g~i~~~~~~~i~~~DtpGi~~~~~~~~~l~   69 (170)
T cd01898           2 DVGLVGLPNAGKSTLLSAISNAKPKIA------D------YPFTTLVPNLGVVRVDDGRSFVVADIPGLIEGASEGKGLG   69 (170)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCCEEE------C------CCCCCCCCEEEEEEECCCCEEEEECCCCCCCCCCCCCCHH
T ss_conf             589989999989999999967876032------5------6665237447799936985699964886444554662248


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCC--CHHHHHHHHHH-----CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEE
Q ss_conf             7798774002331452012344332--10677888863-----1876023310023335612221101232100111014
Q gi|254780263|r   86 KNMITGATQADGAILVCAAEDGPKP--QTREHILLARQ-----IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHK  158 (392)
Q Consensus        86 ~~mi~g~~~~D~ailvVda~~G~~~--QT~eh~~l~~~-----lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~  158 (392)
                      ...++-+..+|..++|||++....+  |.+.-...+..     .+ +++|+++||+|+++.++..+..+    +++... 
T Consensus        70 ~~~l~~i~~advil~vvD~~~~~~~~~~~~~i~~~l~~~~~~~~~-kp~ilv~NK~Dl~~~~~~~~~~~----~~~~~~-  143 (170)
T cd01898          70 HRFLRHIERTRLLLHVIDLSGDDDPVEDYKTIRNELELYNPELLE-KPRIVVLNKIDLLDEEELFELLK----ELLKEL-  143 (170)
T ss_pred             HHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCHHHHC-CCCEEEEEHHHCCCHHHHHHHHH----HHHHHC-
T ss_conf             999861334561799998998789899999999999982744403-86506776202428356389999----999856-


Q ss_pred             EEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             5322102331146764114445652123320344310
Q gi|254780263|r  159 YSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       159 ~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                        ...|++++||.+|.          +++.|++.|.+
T Consensus       144 --~~~~vi~iSA~~g~----------gi~~L~~~I~~  168 (170)
T cd01898         144 --WGKPVFPISALTGE----------GLDELLRKLAE  168 (170)
T ss_pred             --CCCCEEEEECCCCC----------CHHHHHHHHHH
T ss_conf             --99958999754797----------99999999996


No 121
>cd03708 GTPBP_III Domain III of the GP-1 family of GTPase. This group includes proteins similar to GTPBP1 and GTPBP2. GTPB1 is structurally, related to elongation factor 1 alpha, a key component of protein biosynthesis machinery. Immunohistochemical analyses on mouse tissues revealed that GTPBP1 is expressed in some neurons and smooth muscle cells of various organs as well as macrophages. Immunofluorescence analyses revealed that GTPBP1 is localized exclusively in cytoplasm and shows a diffuse granular network forming a gradient from the nucleus to the periphery of the cells in smooth muscle cell lines and macrophages. No significant difference was observed in the immune response to protein antigen between mutant mice and wild-type mice, suggesting normal function of antigen-presenting cells of the mutant mice. The absence of an eminent phenotype in GTPBP1-deficient mice may be due to functional compensation by GTPBP2, which is similar to GTPBP1 in structure and tissue distribution.
Probab=99.58  E-value=3.4e-14  Score=107.08  Aligned_cols=86  Identities=22%  Similarity=0.409  Sum_probs=78.7

Q ss_pred             CCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEEEEEEC-CCEEECCCCEEEEE
Q ss_conf             63000168999710567875555115978999954147779999618955707897699999977-81775469849999
Q gi|254780263|r  298 QEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELI-YPIAMEPNQTFSMR  376 (392)
Q Consensus       298 ~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~l~l~-~pi~~e~~~rfilR  376 (392)
                      .+++.|+|+|.+|.     |++.++.||+|.+|+++.++++++... ..+.+++||.+.|+|++. +|.++++++||++|
T Consensus         1 ~a~~eF~A~I~vL~-----HpTtI~~gyq~viH~g~irQta~I~~i-~~~~lrtgd~a~V~frF~~~PEyi~~G~~~ifR   74 (87)
T cd03708           1 KACWEFEAEILVLH-----HPTTISPGYQATVHIGSIRQTARIVSI-DKDVLRTGDRALVRFRFLYHPEYLREGQRLIFR   74 (87)
T ss_pred             CCEEEEEEEEEEEE-----CCCEEECCCEEEEEEEEEEEEEEEEEC-CCCCCCCCCEEEEEEEEECCCEEECCCCEEEEE
T ss_conf             92799999999995-----788960796999999547899999984-702010698289999996474697589999997


Q ss_pred             ECCEEEEEEEEEEE
Q ss_conf             89969998999553
Q gi|254780263|r  377 EGGKTVGAGLILEI  390 (392)
Q Consensus       377 d~~~tig~G~I~~v  390 (392)
                      + |+|.|+|.|++|
T Consensus        75 e-G~tkgiG~V~~v   87 (87)
T cd03708          75 E-GRTKGVGEVTKV   87 (87)
T ss_pred             C-CCCEEEEEEEEC
T ss_conf             3-873198999969


No 122
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=99.58  E-value=1.4e-14  Score=109.40  Aligned_cols=150  Identities=17%  Similarity=0.180  Sum_probs=93.0

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHH----HH----
Q ss_conf             9999904689887899999987644420013126868698629206378999821990899984787302----46----
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHAD----YV----   85 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~----f~----   85 (392)
                      .|+++|-..+|||||+.+|++.....      .+      .-|-|.+.-...+++++..+.|+||||--+    ..    
T Consensus         2 ~VaivG~pNvGKStL~N~L~g~~~~v------~~------~p~TTr~~~~~~~~~~~~~~~liDTpGi~~~~~~~~~~ie   69 (168)
T cd01897           2 TLVIAGYPNVGKSSLVNKLTRAKPEV------AP------YPFTTKSLFVGHFDYKYLRWQVIDTPGLLDRPLEERNTIE   69 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEE------CC------CCCCCCCCEEEEEEECCCEEEEECCCCCCCCCHHHHHHHH
T ss_conf             79998899988999999995898602------37------5872357436899983727687248865567478888999


Q ss_pred             HHHHHHHH-CCCCEEEEECCCCCCCCCHHHHHHHHH---H--CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE
Q ss_conf             77987740-023314520123443321067788886---3--18760233100233356122211012321001110145
Q gi|254780263|r   86 KNMITGAT-QADGAILVCAAEDGPKPQTREHILLAR---Q--IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY  159 (392)
Q Consensus        86 ~~mi~g~~-~~D~ailvVda~~G~~~QT~eh~~l~~---~--lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~  159 (392)
                      +..+.++. .+|..++|+|+++.....-.+...+.+   .  .+. ++|+++||+|+++.++..+.     .++.+.   
T Consensus        70 ~~~~~~l~~~~d~il~viD~~~~~~~~~~~~~~l~~~i~~~~~~~-p~i~v~NK~Dl~~~~~~~~~-----~~~~~~---  140 (168)
T cd01897          70 MQAITALAHLRAAVLFLFDPSETCGYSLEEQLSLFEEIKPLFKNK-PVIVVLNKIDLLTFEDLSEI-----EEEEEL---  140 (168)
T ss_pred             HHHHHHHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCCHHHH-----HHHHHC---
T ss_conf             999999983577689999688767848999999999877652588-87999947534581007999-----999970---


Q ss_pred             EEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             322102331146764114445652123320344310
Q gi|254780263|r  160 SDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       160 ~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                       ...+++++||..|.          ++..|++.+.+
T Consensus       141 -~~~~vi~ISA~~g~----------Gi~~L~~~i~e  165 (168)
T cd01897         141 -EGEEVLKISTLTEE----------GVDEVKNKACE  165 (168)
T ss_pred             -CCCCEEEEECCCCC----------CHHHHHHHHHH
T ss_conf             -89988999815896----------99999999999


No 123
>cd04094 selB_III This family represents the domain of elongation factor SelB, homologous to domain III of EF-Tu. SelB may function by replacing EF-Tu. In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3' or 5' non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation.
Probab=99.56  E-value=9.6e-14  Score=104.28  Aligned_cols=95  Identities=22%  Similarity=0.415  Sum_probs=87.0

Q ss_pred             HHEEECCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEEEEEECCCEEE
Q ss_conf             11773267776300016899971056787555511597899995414777999961895570789769999997781775
Q gi|254780263|r  288 GRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAM  367 (392)
Q Consensus       288 Gdvl~~~~~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~  367 (392)
                      |++|+.++...++..++|++.++...    +.+++++.++++|+|++++++|+.+.+.. .+.+|+.+++++.|++|+++
T Consensus         1 G~~L~~~~~~~~t~~~d~~l~~l~~~----~~~lk~~~~v~lh~Gt~~v~~ri~ll~~~-~l~pG~~~~~ql~l~~pv~~   75 (97)
T cd04094           1 GDVLADPGSLLPTRRLDVRLTVLLSA----PRPLKHRQRVHLHHGTSEVLARVVLLDRD-ELAPGEEALAQLRLEEPLVA   75 (97)
T ss_pred             CCEEECCCCCCCEEEEEEEEEEECCC----CCCCCCCCEEEEEECCCCEEEEEEECCCC-CCCCCCEEEEEEEECCCEEC
T ss_conf             99996799637474999999996899----94554896299997527256999967886-21899849999998986831


Q ss_pred             CCCCEEEEEECC--EEEEEEEE
Q ss_conf             469849999899--69998999
Q gi|254780263|r  368 EPNQTFSMREGG--KTVGAGLI  387 (392)
Q Consensus       368 e~~~rfilRd~~--~tig~G~I  387 (392)
                      ..+|||+|||.+  +|+|+|.|
T Consensus        76 ~~gDrfIlR~~s~~~TigGG~V   97 (97)
T cd04094          76 LRGDRFILRSYSPLRTLGGGRV   97 (97)
T ss_pred             CCCCEEEEECCCCCEEEEEEEC
T ss_conf             6898699941998977711899


No 124
>PRK09554 feoB ferrous iron transport protein B; Reviewed
Probab=99.51  E-value=3.8e-14  Score=106.75  Aligned_cols=136  Identities=23%  Similarity=0.302  Sum_probs=94.7

Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHH-----
Q ss_conf             279999904689887899999987644420013126868698629206378999821990899984787302467-----
Q gi|254780263|r   12 SLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVK-----   86 (392)
Q Consensus        12 ~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~-----   86 (392)
                      .++||.+|+.+.|||||-.+||+...+.+       +++     |.|++.+...+.++++.+.++|.||--+...     
T Consensus         3 ~i~IALvGNPN~GKSTLFN~LTG~~q~Vg-------NwP-----GvTVEkk~G~~~~~~~~~~ivDLPG~YSL~~~S~e~   70 (772)
T PRK09554          3 KLTIGLIGNPNSGKTTLFNQLTGARQRVG-------NWA-----GVTVERKEGQFSTTDHQVTLVDLPGTYSLTTISSQT   70 (772)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEE-------CCC-----CCEEEEEEEEEEECCCEEEEEECCCCCCCCCCCCCC
T ss_conf             35699888998789999999868998357-------899-----764742389999689469999799778699999777


Q ss_pred             ---HHHHH---H-HCCCCEEEEECCCCCCCCCHHHHHHHH---HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEE
Q ss_conf             ---79877---4-002331452012344332106778888---6318760233100233356122211012321001110
Q gi|254780263|r   87 ---NMITG---A-TQADGAILVCAAEDGPKPQTREHILLA---RQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKE  156 (392)
Q Consensus        87 ---~mi~g---~-~~~D~ailvVda~~G~~~QT~eh~~l~---~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~  156 (392)
                         +.++-   + ..+|..+.||||+     +-++++.+.   ..+|+| +|+++|+||.+...-    ++-+++.+=+.
T Consensus        71 s~dE~Var~~ll~~~pDvvvnVvDAt-----nLeRnLyLt~QllElg~P-vVvaLNM~D~A~~~G----i~ID~~~Ls~~  140 (772)
T PRK09554         71 SLDEQIACHYILSGDADLLINVVDAS-----NLERNLYLTLQLLELGIP-CIVALNMLDIAEKQN----IRIDIDALSAR  140 (772)
T ss_pred             CCHHHHHHHHHHCCCCCEEEEEEECC-----CHHHHHHHHHHHHHCCCC-EEEEEECHHHHHHCC----CEECHHHHHHH
T ss_conf             73089999986139998999980168-----754428999999974999-899987799898877----93289999998


Q ss_pred             EEEEEEEECCCCEEEEE
Q ss_conf             14532210233114676
Q gi|254780263|r  157 HKYSDDTPIIRGSALCA  173 (392)
Q Consensus       157 ~~~~~~~pii~~sa~~g  173 (392)
                          ..+|++|+||.++
T Consensus       141 ----LGvPVV~~~A~~g  153 (772)
T PRK09554        141 ----LGCPVIPLVSTRG  153 (772)
T ss_pred             ----HCCCEEEEEECCC
T ss_conf             ----5899899982788


No 125
>pfam00025 Arf ADP-ribosylation factor family. Pfam combines a number of different Prosite families together
Probab=99.51  E-value=1.1e-13  Score=103.81  Aligned_cols=145  Identities=19%  Similarity=0.157  Sum_probs=90.3

Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHH
Q ss_conf             38827999990468988789999998764442001312686869862920637899982199089998478730246779
Q gi|254780263|r    9 NKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNM   88 (392)
Q Consensus         9 ~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~m   88 (392)
                      .+..+++.++|..++|||||+.++...         ..+..      --|+......++.++..+.+.|||||+.|-.-.
T Consensus        11 ~~k~~Ki~llG~~~vGKTsll~~~~~~---------~~~~~------~pTig~~~~~v~~~~~~~~iwDt~Gqe~~~~~~   75 (174)
T pfam00025        11 LNKEMRILILGLDNAGKTTILYKLKLG---------EIVTT------IPTIGFNVETVTYKNVKFTVWDVGGQESLRPLW   75 (174)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHCC---------CCCCC------CCCCCCEEEEEEECCEEEEEEECCCCCCCCHHH
T ss_conf             896669999999999889999999549---------98874------474682389999899999998279870232679


Q ss_pred             HHHHHCCCCEEEEECCCCC-CCCCHHHHHHH-HH---HCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE-EEE
Q ss_conf             8774002331452012344-33210677888-86---318760233100233356122211012321001110145-322
Q gi|254780263|r   89 ITGATQADGAILVCAAEDG-PKPQTREHILL-AR---QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY-SDD  162 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G-~~~QT~eh~~l-~~---~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~-~~~  162 (392)
                      -.-...+|++++|+|+++- -+.+.++.+.- .+   ..++| ++++.||+|+.+.... +    ++.+.+..... ...
T Consensus        76 ~~y~~~a~~ii~V~D~t~~~s~~~~~~~l~~~l~~~~~~~~p-iliv~NK~DL~~~~~~-~----ei~~~~~~~~~~~~~  149 (174)
T pfam00025        76 RNYFPNTDAVIFVVDSADRDRIEEAKEELHALLNEEELADAP-LLILANKQDLPGAMSE-A----EIRELLGLHELKSRP  149 (174)
T ss_pred             HHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCCCCCCCH-H----HHHHHHHHHHCCCCC
T ss_conf             988417826899986786787999999999987542358970-8998725667678999-9----999999786441799


Q ss_pred             EECCCCEEEEEE
Q ss_conf             102331146764
Q gi|254780263|r  163 TPIIRGSALCAL  174 (392)
Q Consensus       163 ~pii~~sa~~g~  174 (392)
                      ++++++||.+|.
T Consensus       150 ~~~~~~SAktG~  161 (174)
T pfam00025       150 WEIQGCSAVTGE  161 (174)
T ss_pred             CEEEEEECCCCC
T ss_conf             689999886795


No 126
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1.  Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box).  Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown.  Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT.  Nog1 is a nucleolar protein that might function in ribosome assembly.  The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to 
Probab=99.49  E-value=1.1e-13  Score=104.01  Aligned_cols=149  Identities=19%  Similarity=0.185  Sum_probs=89.6

Q ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC-CEEEEEEECCC-----CHH--HHHHH
Q ss_conf             99046898878999999876444200131268686986292063789998219-90899984787-----302--46779
Q gi|254780263|r   17 TIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD-KRFYSHIDCPG-----HAD--YVKNM   88 (392)
Q Consensus        17 ~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~-~~~i~iiD~PG-----H~~--f~~~m   88 (392)
                      ++|-..+|||||+.+|++.....       ..     .-|-|.+.-...+.++ +..+.|+||||     |++  .+...
T Consensus         1 ivG~PNvGKSTL~N~Lt~~~~~v-------~~-----~pgTTr~~~~g~~~~~~~~~i~~~DtpGi~~~~~~~~~~~~~~   68 (176)
T cd01881           1 LVGLPNVGKSTLLNALTNAKPKV-------AN-----YPFTTLEPNLGVVEVPDGARIQVADIPGLIEGASEGRGLGNQF   68 (176)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCEE-------EC-----CCCCEEEEEEEEEEECCCCEEEEEECCCCCCCCHHHHHHHHHH
T ss_conf             96999888999999996899603-------07-----8996761246799947996699995787545733787899999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHH----------HHH-------HHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCC
Q ss_conf             877400233145201234433210677----------888-------863187602331002333561222110123210
Q gi|254780263|r   89 ITGATQADGAILVCAAEDGPKPQTREH----------ILL-------ARQIGISSIVVYMNKVDAVDDDELLDISEYEIR  151 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G~~~QT~eh----------~~l-------~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~  151 (392)
                      ++.+..+|..++|+|+.+....+.+.-          +..       ....+.| +++++||+|+++.++..+....   
T Consensus        69 l~~~~~~d~il~vvD~~~~~~~~~~~~~~~~~~i~~el~~~~~~~~~~~~~~kp-~i~v~NK~Dl~~~~~~~~~~~~---  144 (176)
T cd01881          69 LAHIRRADAILHVVDASEDDDIGGVDPLEDYEILNAELKLYDLETILGLLTAKP-VIYVLNKIDLDDAEELEEELVR---  144 (176)
T ss_pred             HHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHCCCC-EEEEEECEECCCHHHHHHHHHH---
T ss_conf             987410889999998987655454458999999999999711566555432697-1999968603470031599999---


Q ss_pred             EEEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             01110145322102331146764114445652123320344310
Q gi|254780263|r  152 DLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       152 ~~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                       .+..   ....|++++||..+.          ++..|++.+.+
T Consensus       145 -~~~~---~~~~~ii~iSA~~~~----------gi~~L~~~i~~  174 (176)
T cd01881         145 -ELAL---EEGAEVVPISAKTEE----------GLDELIRAIYE  174 (176)
T ss_pred             -HHHH---CCCCCEEEEECCCCC----------CHHHHHHHHHH
T ss_conf             -9974---689958999777887----------99999999996


No 127
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=99.45  E-value=3.1e-13  Score=101.14  Aligned_cols=143  Identities=19%  Similarity=0.154  Sum_probs=90.2

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             88279999904689887899999987644420013126868698629206378999821990899984787302467798
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      +.-..|+++|.-++|||||+.+|....         ..      .-.-|+......+..++..+++-|+|||+.|-.-.-
T Consensus        12 ~~~~Ki~ilG~~~sGKTsll~~l~~~~---------~~------~~~pT~g~~~~~v~~~~~~~~lwD~~G~~~~~~~~~   76 (173)
T cd04155          12 SEEPRILILGLDNAGKTTILKQLASED---------IS------HITPTQGFNIKTVQSDGFKLNVWDIGGQRAIRPYWR   76 (173)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCC---------CC------CCCCCCCEEEEEEEECCEEEEEEECCCCHHHHHHHH
T ss_conf             877589999799998899999985699---------86------606811323799998999999985587510126899


Q ss_pred             HHHHCCCCEEEEECCCCCC-CCCHHHHHHH----HHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE-EEEE
Q ss_conf             7740023314520123443-3210677888----86318760233100233356122211012321001110145-3221
Q gi|254780263|r   90 TGATQADGAILVCAAEDGP-KPQTREHILL----ARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY-SDDT  163 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~-~~QT~eh~~l----~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~-~~~~  163 (392)
                      .-...+|++|+|||+++-- ..++++.+.-    ....++| ++++.||+|+.+... .+    ++.+.|....+ ...+
T Consensus        77 ~y~~~a~~iI~VvD~td~~~~~~~~~~l~~~l~~~~~~~~P-iLiv~NK~Dl~~a~~-~~----eI~~~l~l~~~~~~~~  150 (173)
T cd04155          77 NYFENTDCLIYVIDSADKKRLEEAGAELVELLEEEKLAGVP-VLVFANKQDLATAAP-AE----EIAEALNLHDLRDRTW  150 (173)
T ss_pred             HHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCCC-HH----HHHHHHCHHHCCCCCC
T ss_conf             76555637999996675688999999999997413006983-899997666777899-99----9999858764348875


Q ss_pred             ECCCCEEEEE
Q ss_conf             0233114676
Q gi|254780263|r  164 PIIRGSALCA  173 (392)
Q Consensus       164 pii~~sa~~g  173 (392)
                      .++++||.+|
T Consensus       151 ~i~~~SA~tG  160 (173)
T cd04155         151 HIQACSAKTG  160 (173)
T ss_pred             EEEEEECCCC
T ss_conf             8999578579


No 128
>COG2229 Predicted GTPase [General function prediction only]
Probab=99.45  E-value=8.2e-13  Score=98.51  Aligned_cols=150  Identities=25%  Similarity=0.185  Sum_probs=92.3

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCC-EEEEEEECCCCHHHHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869862920637899982199-089998478730246779877
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK-RFYSHIDCPGHADYVKNMITG   91 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~-~~i~iiD~PGH~~f~~~mi~g   91 (392)
                      ..|+++|-+++||||.+..|..+..-.-...+.-++.+.  .|-.|+-.-+-..+..+ +.+.|.|||||+.|-.=+.-.
T Consensus        11 ~KIvv~G~~~agKtTfv~~~s~k~~v~t~~~~~~~s~k~--kr~tTva~D~g~~~~~~~~~v~LfgtPGq~RF~fm~~~l   88 (187)
T COG2229          11 TKIVVIGPVGAGKTTFVRALSDKPLVITEADASSVSGKG--KRPTTVAMDFGSIELDEDTGVHLFGTPGQERFKFMWEIL   88 (187)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCCEEECCCCCCCCCC--CCCEEEEECCCCEEECCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             069998443664066788765345620103355554466--455068632411377586168996589707789899987


Q ss_pred             HHCCCCEEEEECCCCCCCCCHHHHHHHHHHCC-CCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCEE
Q ss_conf             40023314520123443321067788886318-76023310023335612221101232100111014532210233114
Q gi|254780263|r   92 ATQADGAILVCAAEDGPKPQTREHILLARQIG-ISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSA  170 (392)
Q Consensus        92 ~~~~D~ailvVda~~G~~~QT~eh~~l~~~lg-i~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~sa  170 (392)
                      .+.+++|+++||++.++.-.-++-+....... +| ++|++||+|+-+.. -.+    +++++|+...  .+.|+|+.++
T Consensus        89 ~~ga~gaivlVDss~~~~~~a~~ii~f~~~~~~ip-~vVa~NK~DL~~a~-ppe----~i~e~l~~~~--~~~~vi~~~a  160 (187)
T COG2229          89 SRGAVGAIVLVDSSRPITFHAEEIIDFLTSRNPIP-VVVAINKQDLFDAL-PPE----KIREALKLEL--LSVPVIEIDA  160 (187)
T ss_pred             HCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCC-CHH----HHHHHHHHCC--CCCCEEEEEC
T ss_conf             48764289999569996467899999885206887-89995042257789-989----9999997112--7986443442


Q ss_pred             EE
Q ss_conf             67
Q gi|254780263|r  171 LC  172 (392)
Q Consensus       171 ~~  172 (392)
                      ..
T Consensus       161 ~e  162 (187)
T COG2229         161 TE  162 (187)
T ss_pred             CC
T ss_conf             46


No 129
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=99.43  E-value=5.5e-13  Score=99.59  Aligned_cols=145  Identities=21%  Similarity=0.201  Sum_probs=90.9

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHH
Q ss_conf             03882799999046898878999999876444200131268686986292063789998219908999847873024677
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~   87 (392)
                      ++|..++|.++|--.+|||||+.+|.+.         ..+.      -.-|+......++.+++.++|-|+||++.|-.-
T Consensus        10 ~~~~~~KililG~~~sGKTsll~~l~~~---------~~~~------~~pT~G~~~~~~~~~~~~l~iwD~~G~e~~~~~   74 (173)
T cd04154          10 LKEREMRILILGLDNAGKTTILKKLLGE---------DIDT------ISPTLGFQIKTLEYEGYKLNIWDVGGQKTLRPY   74 (173)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHCCC---------CCCC------CCCCCCEEEEEEEECCEEEEEEECCCCCCCCHH
T ss_conf             4457318999989997889999998399---------9897------267057778999989999999966886020058


Q ss_pred             HHHHHHCCCCEEEEECCCCCC-CCCHHHHHH-HH---HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE-EE
Q ss_conf             987740023314520123443-321067788-88---6318760233100233356122211012321001110145-32
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGP-KPQTREHIL-LA---RQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY-SD  161 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~-~~QT~eh~~-l~---~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~-~~  161 (392)
                      .-.-...+|++|+|||+++.. ..+.++-+. ++   ...++| ++|+.||+|+.+.-. .+    ++.+.+..... ..
T Consensus        75 ~~~y~~~a~~ii~VvD~td~~~~~~~~~~l~~ll~~~~~~~~p-ili~~NK~Dl~~~~~-~~----ei~~~l~l~~~~~~  148 (173)
T cd04154          75 WRNYFESTDALIWVVDSSDRLRLDDCKRELKELLQEERLAGAT-LLILANKQDLPGALS-EE----EIREALELDKISSH  148 (173)
T ss_pred             HHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCCC-HH----HHHHHHHHHHCCCC
T ss_conf             9997226653899985565788999999999998635415984-799987656777889-99----99999868744579


Q ss_pred             EEECCCCEEEEE
Q ss_conf             210233114676
Q gi|254780263|r  162 DTPIIRGSALCA  173 (392)
Q Consensus       162 ~~pii~~sa~~g  173 (392)
                      .++++++||.+|
T Consensus       149 ~~~~~~~SAktG  160 (173)
T cd04154         149 HWRIQPCSAVTG  160 (173)
T ss_pred             CCEEEEEECCCC
T ss_conf             829999889669


No 130
>TIGR00450 thdF tRNA modification GTPase TrmE; InterPro: IPR004520   The GTP-binding domain of all TrmE/ThdF orthologues is found in the C-terminal portion of the molecule. The N-terminal half can be removed without affecting the GTP-binding/hydrolysis function of the GTP-binding domain. The last four amino acids of all orthologues of ThdF/TrmE are highly conserved, being either CIGK or CLGK. This matches the Caax (where 'a' represents an aliphatic amino acid, and 'x' represents any amino acid) motif for isoprenylation that anchors small GTP-binding proteins to cell membranes in eukaryotic cells. However, protein isoprenylation has never been shown to occur in bacteria. Interestingly, biochemical experiments have shown that the Escherichia coli TrmE protein peripherally associates with the membrane fraction .    Although the biochemical properties of TrmE have been investigated for the E. coli and Thermotoga maritima proteins, nothing is known about the relationship of this protein to tRNA modification. Orthologues of TrmE are present in eukaryotes and bacteria, but are not present in archaea. In Saccharomyces cerevisiae, Mss1p is a nuclear-encoded mitochondrial protein that is the yeast orthologue of TrmE. Mss1p interacts with the 15S rRNA of the yeast mitochondria, which is equivalent to the 16S rRNA of bacteria. Subsequent analysis of the S. cerevisiae MTO1 gene suggests that MSS1 and MTO1 act together in a pathway involved in optimizing mitochondrial protein synthesis.    TrmE may play a role in tRNA processing and may be directly or indirectly involved in regulating ribosome function.; GO: 0003924 GTPase activity, 0005525 GTP binding, 0006400 tRNA modification, 0005622 intracellular.
Probab=99.42  E-value=2.6e-12  Score=95.40  Aligned_cols=120  Identities=23%  Similarity=0.326  Sum_probs=88.5

Q ss_pred             HHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC---CH
Q ss_conf             210388279999904689887899999987644420013126868698629206378999821990899984787---30
Q gi|254780263|r    6 YVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG---HA   82 (392)
Q Consensus         6 ~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG---H~   82 (392)
                      +++-+.-+.++++|.+.+|||+|+.+++..-.      +-...     -.|-|.|+=-..|+.+|+.+.++||.|   |.
T Consensus       219 l~~l~~g~k~ai~G~~NvGKSSLLNa~l~~Dr------AiVS~-----~kGtTRD~vE~~~~L~G~~~~~lDTAGiR~~~  287 (473)
T TIGR00450       219 LEKLKDGFKLAIVGKPNVGKSSLLNALLKQDR------AIVSD-----IKGTTRDVVEGDFELNGILVKLLDTAGIREHA  287 (473)
T ss_pred             HHHHCCCCEEEEECCCCCCHHHHHHHHHHCCC------EEEEC-----CCCCCCCEEEEEEEECCEEEEEEECCCCCCCH
T ss_conf             99840894799964788757899998762287------05527-----66883204420577746789985146751020


Q ss_pred             HHH-----HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             246-----7798774002331452012344332106778888631876023310023335
Q gi|254780263|r   83 DYV-----KNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAV  137 (392)
Q Consensus        83 ~f~-----~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v  137 (392)
                      |++     .-....+.+||.+|.|+||..++++---+-+.-.+... +++++++||.|+.
T Consensus       288 ~~~E~~GiekS~~~i~~A~LVi~~~D~~~~~~~ddf~li~~~~k~~-k~~~~V~NK~DL~  346 (473)
T TIGR00450       288 DKVERLGIEKSFKAIKQADLVIYVLDASQPLTKDDFELIITLNKKK-KPLILVLNKIDLA  346 (473)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCC-CCEEEEECCCCCC
T ss_conf             0466776899899986057347888747898810589999973217-9779997350165


No 131
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins.  GTPases act as molecular switches regulating diverse cellular processes.  DRG2 and DRG1 comprise the DRG subfamily in eukaryotes.  In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes.  It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding.
Probab=99.39  E-value=5e-12  Score=93.62  Aligned_cols=82  Identities=24%  Similarity=0.236  Sum_probs=60.9

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCH-------HHHH
Q ss_conf             999990468988789999998764442001312686869862920637899982199089998478730-------2467
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHA-------DYVK   86 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~-------~f~~   86 (392)
                      .++++|-..+|||||+.+||+.....+. .           -.-|++.-...+++++..+-|+||||-.       ...+
T Consensus         2 ~V~LVG~PN~GKSTLln~LT~a~~~v~~-y-----------pfTT~~pi~g~~~~~~~~iqlvDtPGli~~a~~g~g~g~   69 (233)
T cd01896           2 RVALVGFPSVGKSTLLSKLTNTKSEVAA-Y-----------EFTTLTCVPGVLEYKGAKIQLLDLPGIIEGAADGKGRGR   69 (233)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCC-C-----------CCCCCCCEEEEEEECCEEEEEEECCCCCCCCCCCCCHHH
T ss_conf             5999999999999999999789954369-8-----------978757477799989989999967300246333320689


Q ss_pred             HHHHHHHCCCCEEEEECCCCC
Q ss_conf             798774002331452012344
Q gi|254780263|r   87 NMITGATQADGAILVCAAEDG  107 (392)
Q Consensus        87 ~mi~g~~~~D~ailvVda~~G  107 (392)
                      +++.-+..||..++|+|+.+.
T Consensus        70 ~~l~~~r~aD~il~VvD~~~~   90 (233)
T cd01896          70 QVIAVARTADLILMVLDATKP   90 (233)
T ss_pred             HHHHHHHHCCEEEEEEECCCC
T ss_conf             999998758999999847982


No 132
>COG0486 ThdF Predicted GTPase [General function prediction only]
Probab=99.36  E-value=6.4e-12  Score=92.99  Aligned_cols=154  Identities=23%  Similarity=0.221  Sum_probs=102.7

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC---CHHHHH
Q ss_conf             88279999904689887899999987644420013126868698629206378999821990899984787---302467
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG---HADYVK   86 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG---H~~f~~   86 (392)
                      ++-++++++|-.++|||||+.+|++.-..-     .+|      --|-|.|+=..++.-+++.+.++||.|   +.|.+-
T Consensus       215 r~G~kvvIiG~PNvGKSSLLNaL~~~d~AI-----VTd------I~GTTRDviee~i~i~G~pv~l~DTAGiRet~d~VE  283 (454)
T COG0486         215 REGLKVVIIGRPNVGKSSLLNALLGRDRAI-----VTD------IAGTTRDVIEEDINLNGIPVRLVDTAGIRETDDVVE  283 (454)
T ss_pred             HCCCEEEEECCCCCCHHHHHHHHHCCCCEE-----ECC------CCCCCCCEEEEEEEECCEEEEEEECCCCCCCCCHHH
T ss_conf             458649998799886799999886678667-----428------999741037899998988999985677666734899


Q ss_pred             H--H---HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             7--9---8774002331452012344332106778888631876023310023335612221101232100111014532
Q gi|254780263|r   87 N--M---ITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        87 ~--m---i~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      .  +   ...+.+||.+|+|+|+++++..+-.+.+. +...+ +++++++||.|++....    . ..+       ....
T Consensus       284 ~iGIeRs~~~i~~ADlvL~v~D~~~~~~~~d~~~~~-~~~~~-~~~i~v~NK~DL~~~~~----~-~~~-------~~~~  349 (454)
T COG0486         284 RIGIERAKKAIEEADLVLFVLDASQPLDKEDLALIE-LLPKK-KPIIVVLNKADLVSKIE----L-ESE-------KLAN  349 (454)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHH-HCCCC-CCEEEEEECHHCCCCCC----C-CHH-------HCCC
T ss_conf             999999999998599899997088777601177887-24368-97799996021156432----1-012-------0267


Q ss_pred             EEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCC
Q ss_conf             2102331146764114445652123320344310252
Q gi|254780263|r  162 DTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIP  198 (392)
Q Consensus       162 ~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~  198 (392)
                      +.+++++|+.++          .++..|.++|.+++.
T Consensus       350 ~~~~i~iSa~t~----------~Gl~~L~~~i~~~~~  376 (454)
T COG0486         350 GDAIISISAKTG----------EGLDALREAIKQLFG  376 (454)
T ss_pred             CCCEEEEEECCC----------CCHHHHHHHHHHHHH
T ss_conf             882699982576----------579999999999986


No 133
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=99.35  E-value=3.3e-12  Score=94.78  Aligned_cols=150  Identities=17%  Similarity=0.154  Sum_probs=90.5

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789998219908999847873024677987740
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGAT   93 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~   93 (392)
                      .|.++|.-.+|||||+.+|........       ... ...-.-|+...+..+++++.++.|-|+||++.|-.-.-.-..
T Consensus         1 ~ivilG~~~~GKTsll~~l~~~~~~~~-------~~~-~~~~~~Tvg~~~~~i~~~~~~l~iwD~~Gqe~~~~l~~~y~~   72 (167)
T cd04160           1 SVLILGLDNAGKTTFLEQLKTLFSKYK-------GLP-PSKITPTVGLNIGTIEVGNARLKFWDLGGQESLRSLWDKYYA   72 (167)
T ss_pred             CEEEECCCCCCHHHHHHHHHHCCCCCC-------CCC-CCCCCCCCCEEEEEEEECCEEEEEEECCCCHHHHHHHHHHCC
T ss_conf             999999999888899998875036767-------776-554035313268999989999999968987888789987428


Q ss_pred             CCCCEEEEECCCCC-CCCCHHHHHH-HH---HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCC
Q ss_conf             02331452012344-3321067788-88---6318760233100233356122211012321001110145322102331
Q gi|254780263|r   94 QADGAILVCAAEDG-PKPQTREHIL-LA---RQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRG  168 (392)
Q Consensus        94 ~~D~ailvVda~~G-~~~QT~eh~~-l~---~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~  168 (392)
                      .+|++|+|||+++- -+.+.++.+. ++   ...++| ++|+.||+|+.+.-. .+++.+.+.......+ ..+++++++
T Consensus        73 ~a~~ii~VvD~sd~~~~~~~~~~l~~~~~~~~~~~~p-ili~~NK~Dl~~~~~-~~ei~~~~~~~~~~~~-~~~~~~~~~  149 (167)
T cd04160          73 ECHAIIYVIDSTDRERFEESKSALEKVLRNEALEGVP-LLILANKQDLPDALS-VEEIKEVFQDKAEEIG-RRDCLVLPV  149 (167)
T ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCC-EEEEEECCCCCCCCC-HHHHHHHHHHHHHHHC-CCCCEEEEE
T ss_conf             9878999986686788999999999975110248962-999970667665778-9999999999999854-699899998


Q ss_pred             EEEEEE
Q ss_conf             146764
Q gi|254780263|r  169 SALCAL  174 (392)
Q Consensus       169 sa~~g~  174 (392)
                      ||.+|.
T Consensus       150 SAktG~  155 (167)
T cd04160         150 SALEGT  155 (167)
T ss_pred             ECCCCC
T ss_conf             878294


No 134
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]
Probab=99.34  E-value=3.3e-12  Score=94.73  Aligned_cols=136  Identities=21%  Similarity=0.284  Sum_probs=94.1

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHH----HH
Q ss_conf             79999904689887899999987644420013126868698629206378999821990899984787302467----79
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVK----NM   88 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~----~m   88 (392)
                      +.+|.+|+.+.|||||..+||+...+.+       +++     |.|++-+...++++++.|.++|.||--++..    +-
T Consensus         4 ~~valvGNPNvGKTtlFN~LTG~~q~Vg-------Nwp-----GvTVEkkeg~~~~~~~~i~ivDLPG~YSL~~~S~DE~   71 (653)
T COG0370           4 LTVALVGNPNVGKTTLFNALTGANQKVG-------NWP-----GVTVEKKEGKLKYKGHEIEIVDLPGTYSLTAYSEDEK   71 (653)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEC-------CCC-----CCEEEEEEEEEEECCCEEEEEECCCCCCCCCCCCHHH
T ss_conf             4389856998548999999856674654-------789-----8069987889973585489986897565888992089


Q ss_pred             H-HH--H-HCCCCEEEEECCCCCCCCCHHHHHHH---HHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             8-77--4-00233145201234433210677888---8631876023310023335612221101232100111014532
Q gi|254780263|r   89 I-TG--A-TQADGAILVCAAEDGPKPQTREHILL---ARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        89 i-~g--~-~~~D~ailvVda~~G~~~QT~eh~~l---~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      + |-  + -.+|..+-||||+     +-++++++   +..+|+| +|+++|++|.....-    ++-+.+++-+.    .
T Consensus        72 Var~~ll~~~~D~ivnVvDA~-----nLeRnLyltlQLlE~g~p-~ilaLNm~D~A~~~G----i~Id~~~L~~~----L  137 (653)
T COG0370          72 VARDFLLEGKPDLIVNVVDAT-----NLERNLYLTLQLLELGIP-MILALNMIDEAKKRG----IRIDIEKLSKL----L  137 (653)
T ss_pred             HHHHHHHCCCCCEEEEEECCC-----HHHHHHHHHHHHHHCCCC-EEEEECCHHHHHHCC----CCCCHHHHHHH----H
T ss_conf             999998638998899960232-----377778999999985998-599961275688649----71269999998----6


Q ss_pred             EEECCCCEEEEEE
Q ss_conf             2102331146764
Q gi|254780263|r  162 DTPIIRGSALCAL  174 (392)
Q Consensus       162 ~~pii~~sa~~g~  174 (392)
                      ..|+++.||..|.
T Consensus       138 GvPVv~tvA~~g~  150 (653)
T COG0370         138 GVPVVPTVAKRGE  150 (653)
T ss_pred             CCCEEEEEECCCC
T ss_conf             8988998730588


No 135
>TIGR03156 GTP_HflX GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like).
Probab=99.32  E-value=1.1e-11  Score=91.59  Aligned_cols=148  Identities=18%  Similarity=0.188  Sum_probs=91.5

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC-CCEEEEEEECCCCHHHH------
Q ss_conf             79999904689887899999987644420013126868698629206378999821-99089998478730246------
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET-DKRFYSHIDCPGHADYV------   85 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~-~~~~i~iiD~PGH~~f~------   85 (392)
                      -.|+++|-.+||||||+.+|++.....   ..+         -.-|.|.....+.. ++..+.+.||+|--+-+      
T Consensus       190 p~ValVGYTNAGKSTL~n~Lt~~~~~~---~d~---------lFaTLd~t~r~~~l~~~~~~ll~DTVGFI~~LP~~Li~  257 (351)
T TIGR03156       190 PTVALVGYTNAGKSTLFNALTGADVYA---ADQ---------LFATLDPTTRRLDLPDGGEVLLTDTVGFIRDLPHELVA  257 (351)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCCC---CCC---------CEEECCCCCCEEECCCCCEEEEEECCCHHHHCCHHHHH
T ss_conf             769996678877899999985177641---034---------31353673204887999769998150056308867999


Q ss_pred             --HHHHHHHHCCCCEEEEECCCC-CCCCCHHHHHHHHHHCCC--CCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEE
Q ss_conf             --779877400233145201234-433210677888863187--602331002333561222110123210011101453
Q gi|254780263|r   86 --KNMITGATQADGAILVCAAED-GPKPQTREHILLARQIGI--SSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYS  160 (392)
Q Consensus        86 --~~mi~g~~~~D~ailvVda~~-G~~~QT~eh~~l~~~lgi--~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~  160 (392)
                        +.++.-+..||..+.|||+++ ....|-.....++..+|+  +++|++.||+|++++++. +..    ..     .+.
T Consensus       258 aF~sTLee~~~aDlllhVvD~S~~~~~~~~~~v~~~L~elg~~~~p~i~V~NKiD~~~~~~~-~~~----~~-----~~~  327 (351)
T TIGR03156       258 AFRATLEEVREADLLLHVVDASDPDREEQIEAVEEVLEELGAEDIPQLLVYNKIDLLDEPRI-ERL----EE-----GYP  327 (351)
T ss_pred             HHHHHHHHHHHCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEECHHCCCHHHH-HHH----HH-----CCC
T ss_conf             99999999985989999805888478999999999999769999988999967015895778-998----73-----799


Q ss_pred             EEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             22102331146764114445652123320344310
Q gi|254780263|r  161 DDTPIIRGSALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       161 ~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                         ..+++||.+|.          ++..|++.|.+
T Consensus       328 ---~~v~ISA~~g~----------gi~~L~~~I~~  349 (351)
T TIGR03156       328 ---EAVFVSAKTGE----------GLDLLLEAIAE  349 (351)
T ss_pred             ---CEEEEECCCCC----------CHHHHHHHHHH
T ss_conf             ---87999689998----------99999999995


No 136
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed
Probab=99.30  E-value=2e-11  Score=89.86  Aligned_cols=145  Identities=23%  Similarity=0.269  Sum_probs=97.0

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHH---HH-
Q ss_conf             88279999904689887899999987644420013126868698629206378999821990899984787302---46-
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHAD---YV-   85 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~---f~-   85 (392)
                      ++-++++++|-+++|||||..+|++.-..-.     .|      .-|=|.|+=...+..+++.++|+||.|-++   -+ 
T Consensus       214 ~~G~~v~i~G~PN~GKSSL~N~L~~~drAIV-----S~------ipGTTRD~ie~~l~l~G~~v~l~DTAGiR~t~d~IE  282 (445)
T PRK05291        214 REGLKVVIAGRPNVGKSSLLNALLGEERAIV-----TD------IAGTTRDVIEEHINLDGIPLRLIDTAGIRETEDEVE  282 (445)
T ss_pred             HCCCEEEEECCCCCCHHHHHHHHHCCCCEEE-----CC------CCCCCCCEEEEEEEECCEEEEEEECCCCCCCCCHHH
T ss_conf             3598699889998768999999857874673-----18------999740402236899998999998997665574588


Q ss_pred             ----HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             ----7798774002331452012344332106778888631876023310023335612221101232100111014532
Q gi|254780263|r   86 ----KNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        86 ----~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                          +-....+..||..|+|+|++.+....-.   .+...+.-++.|+++||+|+.+...                   .
T Consensus       283 ~~GI~ra~~~~~~ADlil~v~D~s~~~~~~~~---~~~~~~~~~~~i~V~NK~DL~~~~~-------------------~  340 (445)
T PRK05291        283 KIGIERSRKAIEEADLVLLVLDASEPLTEEDK---EILEEFKNKPVIVVLNKADLTGEKI-------------------D  340 (445)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCCCCCCHH---HHHHHCCCCCEEEEEEHHHCCCCCC-------------------C
T ss_conf             99999999999839999999879988872259---9998517998799985120466534-------------------7


Q ss_pred             EEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCC
Q ss_conf             210233114676411444565212332034431025
Q gi|254780263|r  162 DTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHI  197 (392)
Q Consensus       162 ~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~  197 (392)
                      ..+.+.+|+.++          .++..|++.|.+.+
T Consensus       341 ~~~~i~iSak~g----------~Gi~~L~~~i~~~~  366 (445)
T PRK05291        341 GLPVIRISAKTG----------EGIDELEEALKQLV  366 (445)
T ss_pred             CCCEEEEECCCC----------CCHHHHHHHHHHHH
T ss_conf             897599983788----------69999999999997


No 137
>pfam01926 MMR_HSR1 GTPase of unknown function.
Probab=99.30  E-value=9.3e-12  Score=91.96  Aligned_cols=98  Identities=23%  Similarity=0.298  Sum_probs=77.7

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC--------HHHHHHHHHHHHCC
Q ss_conf             8878999999876444200131268686986292063789998219908999847873--------02467798774002
Q gi|254780263|r   24 GKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH--------ADYVKNMITGATQA   95 (392)
Q Consensus        24 GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH--------~~f~~~mi~g~~~~   95 (392)
                      |||||+.+|++...      +.+.     ..-|.|.+.....+.+++..+.|+||||-        ..........+..+
T Consensus         1 GKSsLiN~L~~~~~------~~v~-----~~~gtT~~~~~~~~~~~~~~i~liDTPGi~~~~~~~~~~~~~~~~~~~~~~   69 (106)
T pfam01926         1 GKSTLINALTGKKR------AIVS-----DYPGTTRDPNEGRVELDGKQIILVDTPGIIEGASKGEGELGNRTLEAIEEA   69 (106)
T ss_pred             CHHHHHHHHHCCCC------EEEC-----CCCCCCCCCEEEEEEECCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             91279999978885------5552-----889988463558998899889998378732265046788899999723457


Q ss_pred             CCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             33145201234433210677888863187602331002
Q gi|254780263|r   96 DGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNK  133 (392)
Q Consensus        96 D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNK  133 (392)
                      |.+++|+||.++...+..+.+..+...+.| +++++||
T Consensus        70 d~il~viD~~~~~~~~d~~~~~~l~~~~~p-~iiv~NK  106 (106)
T pfam01926        70 DLILHVVDASEGLTEEDLEILDLLLELGKP-VILVLNK  106 (106)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEEC
T ss_conf             379999999999998999999999986998-8999939


No 138
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=99.29  E-value=8e-12  Score=92.37  Aligned_cols=139  Identities=19%  Similarity=0.159  Sum_probs=84.8

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHHC
Q ss_conf             99990468988789999998764442001312686869862920637899982199089998478730246779877400
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQ   94 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~~   94 (392)
                      |+++|.-.+|||||+.+|....         ....      --|+...+..+.+++..+.|.|+||++.|-.-.-.-...
T Consensus         2 i~ilG~~~vGKTsll~~l~~~~---------~~~~------~pTig~~~~~i~~~~~~l~iwDt~G~~~~~~~~~~y~~~   66 (158)
T cd00878           2 ILILGLDGAGKTTILYKLKLGE---------VVTT------IPTIGFNVETVEYKNVSFTVWDVGGQDKIRPLWKHYYEN   66 (158)
T ss_pred             EEEECCCCCCHHHHHHHHHCCC---------CCCC------CCEECCCEEEEEECCEEEEEEECCCCCCCCHHHHHHHCC
T ss_conf             9999999998899999995399---------8874------456074089998488999999889972214489987276


Q ss_pred             CCCEEEEECCCCC-CCCCHHHHHH-HHH---HCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE-EEEEECCCC
Q ss_conf             2331452012344-3321067788-886---318760233100233356122211012321001110145-322102331
Q gi|254780263|r   95 ADGAILVCAAEDG-PKPQTREHIL-LAR---QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY-SDDTPIIRG  168 (392)
Q Consensus        95 ~D~ailvVda~~G-~~~QT~eh~~-l~~---~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~-~~~~pii~~  168 (392)
                      +|++|+|+|+++- -+...++.+. +..   .-++| ++|+.||+|+.+.... +    ++.+.+..... ...++++++
T Consensus        67 a~~~i~V~D~t~~~s~~~~~~~~~~~~~~~~~~~~p-iliv~NK~Dl~~~~~~-~----ei~~~l~~~~~~~~~~~~~~~  140 (158)
T cd00878          67 TNGIIFVVDSSDRERIEEAKEELHKLLNEEELKGVP-LLIFANKQDLPGALSV-S----ELIEKLGLEKILGRRWHIQPC  140 (158)
T ss_pred             CCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCE-EEEEEECCCCCCCCCH-H----HHHHHHHHHHHCCCCCEEEEE
T ss_conf             877689983798889999999999998660557653-8987605476657899-9----999998587510799899999


Q ss_pred             EEEEEE
Q ss_conf             146764
Q gi|254780263|r  169 SALCAL  174 (392)
Q Consensus       169 sa~~g~  174 (392)
                      ||.+|-
T Consensus       141 SAktg~  146 (158)
T cd00878         141 SAVTGD  146 (158)
T ss_pred             ECCCCC
T ss_conf             888792


No 139
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily.  Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus.  Arl5 is developmentally regulated during embryogenesis in mice.  Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion.  Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library.  It is found in brain, heart, lung, cartilage, and kidney.  No function has been assigned for Arl8 to date.
Probab=99.28  E-value=1.9e-11  Score=90.06  Aligned_cols=144  Identities=18%  Similarity=0.123  Sum_probs=91.4

Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHH
Q ss_conf             38827999990468988789999998764442001312686869862920637899982199089998478730246779
Q gi|254780263|r    9 NKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNM   88 (392)
Q Consensus         9 ~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~m   88 (392)
                      .|+..+|.++|--++|||||+.+|....         ...      ..-|+-..+..+.+++..+++-|++|++.|-.-.
T Consensus        12 ~~k~~KililG~~~sGKTsil~~l~~~~---------~~~------~~pT~G~~~~~i~~~~~~~~iwD~~G~e~~~~~~   76 (174)
T cd04153          12 PRKEYKVIIVGLDNAGKTTILYQFLLGE---------VVH------TSPTIGSNVEEIVYKNIRFLMWDIGGQESLRSSW   76 (174)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHCCC---------CCC------CCCCCCCCEEEEEECCEEEEEEECCCCCCCCCHH
T ss_conf             8977999999899998899999997399---------277------1672360469999788899999899986566226


Q ss_pred             HHHHHCCCCEEEEECCCCC-CCCCHHHHHH-HHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCC-EEEEEEEEEEE
Q ss_conf             8774002331452012344-3321067788-8863---187602331002333561222110123210-01110145322
Q gi|254780263|r   89 ITGATQADGAILVCAAEDG-PKPQTREHIL-LARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIR-DLLKEHKYSDD  162 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G-~~~QT~eh~~-l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~-~~l~~~~~~~~  162 (392)
                      -.-...+|++|+|||+++- -....++++. ++..   .++| ++|+.||.|+.+.-. .+++.+++. +.++    ..+
T Consensus        77 ~~y~~~a~~ii~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~p-ili~~NK~Dl~~~~~-~~ei~~~l~l~~~~----~~~  150 (174)
T cd04153          77 NTYYTNTDAVILVIDSTDRERLPLTKEELYKMLAHEDLRKAV-LLVLANKQDLKGAMT-PAEISESLGLTSIR----DHT  150 (174)
T ss_pred             HHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCC-EEEEEECCCCCCCCC-HHHHHHHHHHHHHH----CCC
T ss_conf             777057753799997678889999999999997261016982-899995555655789-99999997477763----598


Q ss_pred             EECCCCEEEEE
Q ss_conf             10233114676
Q gi|254780263|r  163 TPIIRGSALCA  173 (392)
Q Consensus       163 ~pii~~sa~~g  173 (392)
                      +.++++||.+|
T Consensus       151 ~~~~~~SAktG  161 (174)
T cd04153         151 WHIQGCCALTG  161 (174)
T ss_pred             CEEEEEECCCC
T ss_conf             09999668589


No 140
>COG0218 Predicted GTPase [General function prediction only]
Probab=99.28  E-value=2.9e-11  Score=88.89  Aligned_cols=118  Identities=23%  Similarity=0.379  Sum_probs=88.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC---------H-
Q ss_conf             799999046898878999999876444200131268686986292063789998219908999847873---------0-
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH---------A-   82 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH---------~-   82 (392)
                      .-||++|.-..|||||+.+|++...     .+++..+     -|.|..+-|  |++++. +.|+|.||.         + 
T Consensus        25 ~EIaF~GRSNVGKSSlIN~l~~~k~-----LArtSkt-----PGrTq~iNf--f~~~~~-~~lVDlPGYGyAkv~k~~~e   91 (200)
T COG0218          25 PEIAFAGRSNVGKSSLINALTNQKN-----LARTSKT-----PGRTQLINF--FEVDDE-LRLVDLPGYGYAKVPKEVKE   91 (200)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC-----EEECCCC-----CCCCCEEEE--EEECCC-EEEEECCCCCCCCCCHHHHH
T ss_conf             6799981686668999999967863-----5565799-----985423679--983585-79981799540328999999


Q ss_pred             ---HHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHH
Q ss_conf             ---24677987740023314520123443321067788886318760233100233356122211
Q gi|254780263|r   83 ---DYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLD  144 (392)
Q Consensus        83 ---~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~  144 (392)
                         +++-+-+..-.+...++++||++.++...-+|-+..+...++| ++|+.||||.++..++..
T Consensus        92 ~w~~~i~~YL~~R~~L~~vvlliD~r~~~~~~D~em~~~l~~~~i~-~~vv~tK~DKi~~~~~~k  155 (200)
T COG0218          92 KWKKLIEEYLEKRANLKGVVLLIDARHPPKDLDREMIEFLLELGIP-VIVVLTKADKLKKSERNK  155 (200)
T ss_pred             HHHHHHHHHHHHCHHHEEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCHHHHHH
T ss_conf             9999999999635222489999978999868799999999975998-699997110377467888


No 141
>TIGR00437 feoB ferrous iron transport protein B; InterPro: IPR003373 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system and may play a role in the transport of ferrous iron. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent .; GO: 0005525 GTP binding, 0015093 ferrous iron transmembrane transporter activity, 0015684 ferrous iron transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=99.26  E-value=3.7e-12  Score=94.45  Aligned_cols=129  Identities=22%  Similarity=0.314  Sum_probs=90.2

Q ss_pred             ECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHH-H--HHH---
Q ss_conf             0468988789999998764442001312686869862920637899982199089998478730246779-8--774---
Q gi|254780263|r   19 GHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNM-I--TGA---   92 (392)
Q Consensus        19 Ghvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~m-i--~g~---   92 (392)
                      |+.+.|||||..+||+.....+       +++     |.|+|-...++.++++.|+|||+||=-+|.... .  .-+   
T Consensus         1 GNPNVGKStlFN~LTG~~~~vG-------NwP-----G~TVek~eg~l~~~g~~i~ivDLPG~YSL~~~S~~dE~v~~dy   68 (733)
T TIGR00437         1 GNPNVGKSTLFNALTGANQKVG-------NWP-----GVTVEKKEGKLKFQGEDIEIVDLPGIYSLTTFSGLDEKVARDY   68 (733)
T ss_pred             CCCCCHHHHHHHHHHCCCEEEE-------ECC-----CCEEEEEEEEEEECCEEEEEEECCCCCCCCCCCCCHHHHHHHH
T ss_conf             9998158999987415870787-------358-----8707877889752462789984487300589987427999899


Q ss_pred             ---HCCCCEEEEECCCCCCCCCHHHHHHH---HHHCCCCCEEEEECCCCCCCCHH-HHHHCCCCCCEEEEEEEEEEEEEC
Q ss_conf             ---00233145201234433210677888---86318760233100233356122-211012321001110145322102
Q gi|254780263|r   93 ---TQADGAILVCAAEDGPKPQTREHILL---ARQIGISSIVVYMNKVDAVDDDE-LLDISEYEIRDLLKEHKYSDDTPI  165 (392)
Q Consensus        93 ---~~~D~ailvVda~~G~~~QT~eh~~l---~~~lgi~~iIv~iNKmD~v~~~~-~~~~i~~~i~~~l~~~~~~~~~pi  165 (392)
                         -.+|..|-||||.     +=++-+.+   +..+|+| +|+|+|++|.+..+- +.|  .+.+++.|       .+|+
T Consensus        69 l~~e~~DLv~nVVDA~-----nLERnL~LTLQL~E~G~p-~i~~LN~~DeA~k~GI~Id--~~~Lee~L-------GvPV  133 (733)
T TIGR00437        69 LLNEKPDLVVNVVDAS-----NLERNLYLTLQLLELGIP-MILALNLVDEAEKKGIRID--EEKLEERL-------GVPV  133 (733)
T ss_pred             HHCCCCCEEEEEECHH-----HHHHHHHHHHHHHHHCCH-HHHHHHHHHHHHHCCCEEC--HHHHHHHC-------CCCE
T ss_conf             7538996799972566-----777899999999971625-8568726789977296312--57775433-------8652


Q ss_pred             CCCEEEEEE
Q ss_conf             331146764
Q gi|254780263|r  166 IRGSALCAL  174 (392)
Q Consensus       166 i~~sa~~g~  174 (392)
                      +|+||..|.
T Consensus       134 v~~~A~~g~  142 (733)
T TIGR00437       134 VPTSATEGR  142 (733)
T ss_pred             EEEEEEECC
T ss_conf             565321057


No 142
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu.  BipA is a highly conserved protein with global regulatory properties in Escherichia coli.  BipA is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways. BipA functions as a translation factor that is required specifically for the expression of the transcriptional modulator Fis.  BipA binds to ribosomes at a site that coincides with that of EF-G and has a GTPase activity that is sensitive to high GDP:GTP ratios and, is stimulated  by 70S ribosomes programmed with mRNA and aminoacylated tRNAs. The growth rate-dependent induction of BipA allows the efficient expression of Fis, thereby modulating a range of downstream processes, including DNA metabolism and type III secretion.
Probab=99.25  E-value=3.4e-12  Score=94.64  Aligned_cols=82  Identities=32%  Similarity=0.440  Sum_probs=69.9

Q ss_pred             CCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCC----CCCCCCCCCCHHHHHHHCCCCCC
Q ss_conf             10000000135544543014874245348967999506874321254121001----21144321001366641124543
Q gi|254780263|r  208 FLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMF----RKKLDEAIAGDNVGLLLRGVNRA  283 (392)
Q Consensus       208 ~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~----~~~v~~a~aGd~v~l~Lkgi~~~  283 (392)
                      |+|.|..+-+.+++|++.+|||.||+|++||++.++..+++....+|.+++.+    +.++++|.|||+|+++  |  .+
T Consensus         1 f~mlv~~~~~d~~~Gri~~~RV~sG~lk~gd~v~~~~~~~~~~~~rv~~l~~~~g~~~~~v~~a~AGDIvai~--G--l~   76 (86)
T cd03691           1 LQMLVTTLDYDDYVGRIAIGRIFRGTVKVGQQVAVVKRDGKIEKAKITKLFGFEGLKRVEVEEAEAGDIVAIA--G--IE   76 (86)
T ss_pred             CCEEEEEEECCCCCCEEEEEEEECCCCCCCCEEEEECCCCCEEECCCEEEEEEECCCCEEEEEECCCCEEEEC--C--CC
T ss_conf             9689998101887755999998469517999899961678267622307689606985697187599999994--8--88


Q ss_pred             EEECHHEEEC
Q ss_conf             2202117732
Q gi|254780263|r  284 DVPRGRVVCA  293 (392)
Q Consensus       284 di~rGdvl~~  293 (392)
                      +++.||+||+
T Consensus        77 ~~~iGdTl~D   86 (86)
T cd03691          77 DITIGDTICD   86 (86)
T ss_pred             CCCCCCCCCC
T ss_conf             8865471369


No 143
>TIGR00231 small_GTP small GTP-binding protein domain; InterPro: IPR005225   Proteins with a small GTP-binding domain include Ras, RhoA, Rab11, translation elongation factor G, translation initiation factor IF-2, tetratcycline resistance protein TetM, CDC42, Era, ADP-ribosylation factors, tdhF, and many others . In some proteins the domain occurs more than once. Among them there is a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.; GO: 0005525 GTP binding.
Probab=99.23  E-value=2.6e-11  Score=89.17  Aligned_cols=153  Identities=23%  Similarity=0.294  Sum_probs=111.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHH-HH--H--CCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC---CHHH
Q ss_conf             79999904689887899999987644-42--0--013126868698629206378999821990899984787---3024
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSE-EK--K--EYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG---HADY   84 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~-~~--~--~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG---H~~f   84 (392)
                      .+++++||.++|||||+..++..... ..  .  ...+.+.....+.+|.++. +.. ++| ++.++++|+||   |.+|
T Consensus         4 ~~~~~~g~~~~Gk~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~-~~~-~~w-~~~~~~~d~~G~~~~~~~   80 (186)
T TIGR00231         4 IKIGIVGDPNVGKSTLLNRLLGNKGSITESGPTDGTTRDYVTESIEEDGKTIT-GAT-FQW-GYKFNLLDTPGLHRQEDY   80 (186)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHCCCCEEECCCCCCCCHHHHEEEEEECCEEEE-EEE-EEC-CEEEEEEECCCCHHHHHH
T ss_conf             05899734776604555445410120010232333200000011345580234-343-102-427898625771135555


Q ss_pred             -------HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH-HHHHHCCCCCCEEEEE
Q ss_conf             -------67798774002331452012344332106778888631876023310023335612-2211012321001110
Q gi|254780263|r   85 -------VKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDD-ELLDISEYEIRDLLKE  156 (392)
Q Consensus        85 -------~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~-~~~~~i~~~i~~~l~~  156 (392)
                             .+...+.+...|.+++++++.++.++++.+....+...+++ ++++.||+|+.+.. .++..........+..
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~  159 (186)
T TIGR00231        81 DALRRLYYPEVLSSLEVLDLVILVLDVEDGLEKDTKEIIHHADKYGVP-ILLVGNKIDLKDEKPGYFVDLKPHLASLFAK  159 (186)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCCCCEEEHHHHHHHHHHH
T ss_conf             445433223445444333333322211100102567787532212741-6998513365546754010000345555554


Q ss_pred             EEEEEEEE-CCCCEEEE
Q ss_conf             14532210-23311467
Q gi|254780263|r  157 HKYSDDTP-IIRGSALC  172 (392)
Q Consensus       157 ~~~~~~~p-ii~~sa~~  172 (392)
                      ..   ..| +++.++..
T Consensus       160 ~~---~~~~~~~~~~~~  173 (186)
T TIGR00231       160 LN---GEPHFIPLSAET  173 (186)
T ss_pred             HC---CCCCEEECCHHH
T ss_conf             23---664011110011


No 144
>cd01882 BMS1 Bms1.  Bms1 is an essential, evolutionarily conserved, nucleolar protein.  Its depletion interferes with processing of the 35S pre-rRNA at sites A0, A1, and A2, and the formation of 40S subunits.  Bms1, the putative endonuclease Rc11, and the essential U3 small nucleolar RNA form a stable subcomplex that is believed to control an early step in the formation of the 40S subumit.  The C-terminal domain of Bms1 contains a GTPase-activating protein (GAP) that functions intramolecularly.  It is believed that Rc11 activates Bms1 by acting as a guanine-nucleotide exchange factor (GEF) to promote GDP/GTP exchange, and that activated (GTP-bound) Bms1 delivers Rc11 to the preribosomes.
Probab=99.22  E-value=6.9e-11  Score=86.58  Aligned_cols=144  Identities=22%  Similarity=0.308  Sum_probs=104.6

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             88279999904689887899999987644420013126868698629206378999821990899984787302467798
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      -|.+-+++.|-...|||||+..|.+.+.++.-.         |..--||+-      ..+.+++|||.||-  | +-.|+
T Consensus        37 pPP~vVavvGPpgvGKtTLiksLvk~ytk~~l~---------~i~GPiTvv------s~K~rRiTfiEc~n--D-i~smi   98 (225)
T cd01882          37 PPPLVVAVVGPPGVGKTTLIKSLVKNYTKQNIS---------DIKGPITVV------TGKKRRLTFIECPN--D-INAMI   98 (225)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCC---------CCCCCEEEE------ECCCEEEEEEECCC--H-HHHHH
T ss_conf             999699998989977889999999998544375---------578887999------46842689997486--0-99998


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCE
Q ss_conf             77400233145201234433210677888863187602331002333561222110123210011101453221023311
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGS  169 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~s  169 (392)
                      ..+..||.+||+|||+-|.+-.|-|.+.+++..|.|.++-++|.+|.....+.....+..++.-+-.-- -+++..++.|
T Consensus        99 D~AKvADlVLl~iD~s~GfEmEtfEfLnilq~hG~PkV~GVltHlD~fk~~k~lrk~KK~lk~RFwtE~-y~gaKlFyls  177 (225)
T cd01882          99 DIAKVADLVLLLIDASFGFEMETFEFLNILQVHGFPRVMGVLTHLDLFKKNKTLRKTKKRLKHRFWTEV-YQGAKLFYLS  177 (225)
T ss_pred             HHHHHHHEEEEEECCCCCEEEEHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHH-CCCCEEEEEC
T ss_conf             788764336888616655352089999999975999437885443101557889999999999999986-5995688633


Q ss_pred             EEE
Q ss_conf             467
Q gi|254780263|r  170 ALC  172 (392)
Q Consensus       170 a~~  172 (392)
                      .+.
T Consensus       178 g~~  180 (225)
T cd01882         178 GIV  180 (225)
T ss_pred             CCC
T ss_conf             532


No 145
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=99.20  E-value=6.6e-11  Score=86.70  Aligned_cols=141  Identities=19%  Similarity=0.210  Sum_probs=83.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789998219908999847873024677987740
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGAT   93 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~   93 (392)
                      ||.++|.-.+|||||+.+|......       ...      -.-|+......+..++..+++.|++|+..|-.-.-.=..
T Consensus         1 ~Il~lGl~~sGKTtil~~l~~~~~~-------~~~------~~pT~G~~~~~~~~~~~~~~iwD~~G~~~~r~lw~~y~~   67 (162)
T cd04157           1 NILVVGLDNSGKTTIINQLKPENAQ-------SQI------IVPTVGFNVESFEKGNLSFTAFDMSGQGKYRGLWEHYYK   67 (162)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCCC-------CCC------CCCCCCEEEEEEEECCEEEEEEECCCCCCCCHHHHHHHC
T ss_conf             9999999999889999999728987-------564------168507578999839988999985887442055898705


Q ss_pred             CCCCEEEEECCCCC-CCCCHHHHHHHH-H---H--CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE-EEEEEC
Q ss_conf             02331452012344-332106778888-6---3--18760233100233356122211012321001110145-322102
Q gi|254780263|r   94 QADGAILVCAAEDG-PKPQTREHILLA-R---Q--IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY-SDDTPI  165 (392)
Q Consensus        94 ~~D~ailvVda~~G-~~~QT~eh~~l~-~---~--lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~-~~~~pi  165 (392)
                      .+|++|+|||+++- -+...++.+..+ .   .  -++| ++++.||+|+.+... .+    ++.+.|....+ .....+
T Consensus        68 ~~~~iI~VvDssd~~~~~~~~~~l~~ll~~~~~~~~~~P-iLI~~NK~D~~~~~~-~~----ei~~~l~l~~~~~~~~~i  141 (162)
T cd04157          68 NIQGIIFVIDSSDRLRLVVVKDELELLLNHPDIKHRRVP-ILFFANKMDLPDALT-AV----KITQLLGLENIKDKPWHI  141 (162)
T ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHHHHHCHHHCCCCCE-EEEEEECCCCCCCCC-HH----HHHHHHCHHHHCCCCEEE
T ss_conf             674489997076388899999999999717655179845-999981477889999-99----999885866524896499


Q ss_pred             CCCEEEEE
Q ss_conf             33114676
Q gi|254780263|r  166 IRGSALCA  173 (392)
Q Consensus       166 i~~sa~~g  173 (392)
                      +++||++|
T Consensus       142 ~~~SA~tG  149 (162)
T cd04157         142 FASNALTG  149 (162)
T ss_pred             EEEECCCC
T ss_conf             99789789


No 146
>pfam00071 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ral, Ran, Rap Ypt1 and more. Shares P-loop motif with GTP_EFTU, arf and myosin_head. See pfam00009 pfam00025, pfam00063. As regards Rab GTPases, these are important regulators of vesicle formation, motility and fusion. They share a fold in common with all Ras GTPases: this is a six-stranded beta-sheet surrounded by five alpha-helices.
Probab=99.20  E-value=4.4e-11  Score=87.78  Aligned_cols=139  Identities=24%  Similarity=0.216  Sum_probs=85.2

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCC--EEEEEEECCCCHHHHHHHHHH
Q ss_conf             999990468988789999998764442001312686869862920637899982199--089998478730246779877
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK--RFYSHIDCPGHADYVKNMITG   91 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~--~~i~iiD~PGH~~f~~~mi~g   91 (392)
                      .|+++|.-..|||||+.++...            ...++....+..+.....+..++  ..+.|.|+||+++|-.-.-..
T Consensus         1 Ki~vvG~~~vGKTsli~r~~~~------------~f~~~~~~t~~~~~~~~~~~~~~~~~~~~i~Dt~G~e~~~~~~~~~   68 (162)
T pfam00071         1 KLVLVGDGGVGKSSLLIRFTQN------------KFPEEYIPTIGVDFYTKTIEVDGKTVKLQIWDTAGQERFRALRPLY   68 (162)
T ss_pred             CEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCEEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHHH
T ss_conf             9899997997799999999619------------9998747741355678999999999999999789872046788998


Q ss_pred             HHCCCCEEEEECCCCCCCCCHHHHHH----HH-HH--CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             40023314520123443321067788----88-63--1876023310023335612221101232100111014532210
Q gi|254780263|r   92 ATQADGAILVCAAEDGPKPQTREHIL----LA-RQ--IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        92 ~~~~D~ailvVda~~G~~~QT~eh~~----l~-~~--lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                      ...+|++++|.|++.   +.+-+++.    .+ +.  .++| ++++-||+|+.+..+   ...++.+++.+..    +.|
T Consensus        69 ~~~ad~~iivfd~~~---~~S~~~i~~~~~~i~~~~~~~~p-iilvgnK~Dl~~~~~---i~~~e~~~~a~~~----~~~  137 (162)
T pfam00071        69 YRGAQGFLLVYDITS---RDSFENVKKWLEEILRHADDNVP-IVLVGNKCDLEDQRV---VSTEEGEALAKEL----GLP  137 (162)
T ss_pred             HCCCCCCEEECCCCC---HHHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCHHHCCC---CCHHHHHHHHHHH----CCE
T ss_conf             625765504234898---89999999999999985798862-889975247465188---9999999999980----997


Q ss_pred             CCCCEEEEEEE
Q ss_conf             23311467641
Q gi|254780263|r  165 IIRGSALCALQ  175 (392)
Q Consensus       165 ii~~sa~~g~~  175 (392)
                      ++++||.+|.+
T Consensus       138 y~e~Sak~g~g  148 (162)
T pfam00071       138 FMETSAKTNEN  148 (162)
T ss_pred             EEEECCCCCCC
T ss_conf             99973788829


No 147
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=99.19  E-value=7.2e-11  Score=86.47  Aligned_cols=140  Identities=16%  Similarity=0.106  Sum_probs=84.5

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHHC
Q ss_conf             99990468988789999998764442001312686869862920637899982199089998478730246779877400
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQ   94 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~~   94 (392)
                      |+++|--.+|||||+.++....            ..++  .=-||...+.....++..+.+-|+||++.|-.-.-.-...
T Consensus         2 I~llG~~~~GKTsll~~~~~~~------------f~~~--~~pTig~~~~~i~~~~~~l~iwDt~G~e~~~~l~~~y~~~   67 (159)
T cd04159           2 ITLVGLQNSGKTTLVNVIAGGQ------------FSED--TIPTVGFNMRKVTKGNVTLKVWDLGGQPRFRSMWERYCRG   67 (159)
T ss_pred             EEEECCCCCCHHHHHHHHHCCC------------CCCC--CCCCCCEEEEEEEECCEEEEEEECCCHHHHHHHHHHHHCC
T ss_conf             8999999986999999997599------------9886--1673250589999899999999798358779999987468


Q ss_pred             CCCEEEEECCCCCC-CCCHHHHHH-HH---HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCC-EEEEEEEEEEEEECCCC
Q ss_conf             23314520123443-321067788-88---63187602331002333561222110123210-01110145322102331
Q gi|254780263|r   95 ADGAILVCAAEDGP-KPQTREHIL-LA---RQIGISSIVVYMNKVDAVDDDELLDISEYEIR-DLLKEHKYSDDTPIIRG  168 (392)
Q Consensus        95 ~D~ailvVda~~G~-~~QT~eh~~-l~---~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~-~~l~~~~~~~~~pii~~  168 (392)
                      +|++++|+|+++-- ....++.+. +.   ...++| ++++.||+|+.+.....+ +.+++. ..+.    ..+++++++
T Consensus        68 ~~~ii~V~D~sd~~s~~~~~~~l~~~~~~~~~~~~p-iliv~NK~Dl~~~~~~~~-i~~~~~~~~~~----~~~~~~~~~  141 (159)
T cd04159          68 VNAIVYVVDAADRTALEAAKNELHDLLEKPSLEGIP-LLVLGNKNDLPGALSVDE-LIEQMNLKSIT----DREVSCYSI  141 (159)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCCCCCCCHHH-HHHHHHHHHHH----CCCCEEEEE
T ss_conf             636875157787889999999999998544348982-898883567643478999-99999999873----499879999


Q ss_pred             EEEEEE
Q ss_conf             146764
Q gi|254780263|r  169 SALCAL  174 (392)
Q Consensus       169 sa~~g~  174 (392)
                      ||.+|.
T Consensus       142 SAktg~  147 (159)
T cd04159         142 SCKEKT  147 (159)
T ss_pred             ECCCCC
T ss_conf             796896


No 148
>cd04149 Arf6 Arf6 subfamily.  Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions.  In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis.  Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling.  Arf6 is required for and enhances Rac formation of ruffles.  Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection.  In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells.  Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis.  Arf6 is believed t
Probab=99.18  E-value=6.3e-11  Score=86.80  Aligned_cols=144  Identities=15%  Similarity=0.108  Sum_probs=86.8

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             88279999904689887899999987644420013126868698629206378999821990899984787302467798
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      |..++|.++|.-++|||||+.+|...  ..      ..       .-.|+......++.++..+++-|++|++.|-.-.-
T Consensus         7 kk~~kililG~~~sGKTsil~~l~~~--~~------~~-------~~pTvg~~~~~~~~~~~~l~iwD~~Gqe~~r~l~~   71 (168)
T cd04149           7 NKEMRILMLGLDAAGKTTILYKLKLG--QS------VT-------TIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWR   71 (168)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHCC--CC------CC-------CCCCCCCEEEEEEECCEEEEEEECCCCCCCCCHHH
T ss_conf             88889999999999989999999669--98------76-------02626700799998988999998999974660657


Q ss_pred             HHHHCCCCEEEEECCCCC-CCCCHHHHHH-HH---HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE-EEEE
Q ss_conf             774002331452012344-3321067788-88---6318760233100233356122211012321001110145-3221
Q gi|254780263|r   90 TGATQADGAILVCAAEDG-PKPQTREHIL-LA---RQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY-SDDT  163 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G-~~~QT~eh~~-l~---~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~-~~~~  163 (392)
                      .=...+|++++|||+++- -..+.++-+. ++   ...++| ++|+.||.|+.+.-. .+++    .+.+..... ...+
T Consensus        72 ~y~~~~~~iifVvDstd~~~~~~~~~~l~~~l~~~~~~~~p-ilI~~NK~Dl~~~~~-~~ei----~~~l~l~~~~~~~~  145 (168)
T cd04149          72 HYYTGTQGLIFVVDSADRDRIDEARQELHRIINDREMRDAL-LLVFANKQDLPDAMK-PHEI----QEKLGLTRIRDRNW  145 (168)
T ss_pred             HHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCHHHCCCE-EEEEEECCCCCCCCC-HHHH----HHHHCHHHHHCCCC
T ss_conf             64378866899983776789999999999997145227986-999997566777889-9999----99978765517980


Q ss_pred             ECCCCEEEEEE
Q ss_conf             02331146764
Q gi|254780263|r  164 PIIRGSALCAL  174 (392)
Q Consensus       164 pii~~sa~~g~  174 (392)
                      .++++||.+|-
T Consensus       146 ~i~~~SA~tG~  156 (168)
T cd04149         146 YVQPSCATSGD  156 (168)
T ss_pred             EEEEEECCCCC
T ss_conf             99980687896


No 149
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=99.17  E-value=2.2e-10  Score=83.47  Aligned_cols=146  Identities=14%  Similarity=0.150  Sum_probs=90.6

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             88279999904689887899999987644420013126868698629206378999821990899984787302467798
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      |...+|.++|--.|||||++.+|...  .       ...      ---|+......+++++..+++-|.+|++.|-.---
T Consensus        17 ~k~~kIlilGld~aGKTTil~~l~~~--~-------~~~------~~PT~Gfn~e~i~~~~~~~~~wDvgG~~~~R~lW~   81 (190)
T cd00879          17 NKEAKILFLGLDNAGKTTLLHMLKDD--R-------LAQ------HVPTLHPTSEELTIGNIKFKTFDLGGHEQARRLWK   81 (190)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHCC--C-------CCE------ECCCCCCCEEEEEECCEEEEEEECCCCCCCCCCHH
T ss_conf             77048999906999889999998079--9-------531------52655874599998999999998999845554388


Q ss_pred             HHHHCCCCEEEEECCCC-CCCCCHHHHHHHH----HHCCCCCEEEEECCCCCCCC---HHHHHHCCCCCCEEEEEEEE--
Q ss_conf             77400233145201234-4332106778888----63187602331002333561---22211012321001110145--
Q gi|254780263|r   90 TGATQADGAILVCAAED-GPKPQTREHILLA----RQIGISSIVVYMNKVDAVDD---DELLDISEYEIRDLLKEHKY--  159 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~-G~~~QT~eh~~l~----~~lgi~~iIv~iNKmD~v~~---~~~~~~i~~~i~~~l~~~~~--  159 (392)
                      .-...+|+.|+|||+++ .-+.++++.+.-+    ...++| +.|+.||.|+.+.   ++..+..  .+..+......  
T Consensus        82 ~Y~~~~~~iIfVVDssD~~r~~eak~~L~~lL~~~~l~~~P-lLIlaNK~Dl~~a~~~~ei~~~L--~L~~~~~~~~~~~  158 (190)
T cd00879          82 DYFPEVDGIVFLVDAADPERFQESKEELDSLLSDEELANVP-FLILGNKIDLPGAVSEEELRQAL--GLYGTTTGKGVSL  158 (190)
T ss_pred             HHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCCHHHHHHHC--CCCCCCCCCCCCC
T ss_conf             88431137999997767789999999999998555006980-89998666776798999999883--9842015544334


Q ss_pred             ----EEEEECCCCEEEEE
Q ss_conf             ----32210233114676
Q gi|254780263|r  160 ----SDDTPIIRGSALCA  173 (392)
Q Consensus       160 ----~~~~pii~~sa~~g  173 (392)
                          ...+.+.++||++|
T Consensus       159 ~~~~~r~~~i~~csA~tG  176 (190)
T cd00879         159 KVSGIRPIEVFMCSVVKR  176 (190)
T ss_pred             CCCCCCCEEEEEEEEECC
T ss_conf             545776149996550679


No 150
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=99.15  E-value=2.7e-10  Score=82.95  Aligned_cols=143  Identities=17%  Similarity=0.131  Sum_probs=88.1

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             88279999904689887899999987644420013126868698629206378999821990899984787302467798
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      |..++|.++|--.+|||||+.+|...  ..      ...       --|+......++.++..+++-|++|++.|- .+-
T Consensus        11 kk~~kililG~~~~GKTsil~~l~~~--~~------~~~-------~pTvg~~~~~~~~~~~~l~iwD~~Gqe~~r-~l~   74 (175)
T smart00177       11 NKEMRILMVGLDAAGKTTILYKLKLG--ES------VTT-------IPTIGFNVETVTYKNISFTVWDVGGQDKIR-PLW   74 (175)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHCC--CC------CCC-------CCCCCCEEEEEEECCEEEEEEECCCCCCCC-HHH
T ss_conf             88899999988999989999999659--97------775-------797881079999898999999899985455-367


Q ss_pred             -HHHHCCCCEEEEECCCCC-CCCCHHHHHHHH----HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCE-EEEEEEEEEE
Q ss_conf             -774002331452012344-332106778888----631876023310023335612221101232100-1110145322
Q gi|254780263|r   90 -TGATQADGAILVCAAEDG-PKPQTREHILLA----RQIGISSIVVYMNKVDAVDDDELLDISEYEIRD-LLKEHKYSDD  162 (392)
Q Consensus        90 -~g~~~~D~ailvVda~~G-~~~QT~eh~~l~----~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~-~l~~~~~~~~  162 (392)
                       .=...||++|+|||+++- -+.+.++.+.-+    ...++| ++++.||.|+.+.-. .+++.+++.- .++    ...
T Consensus        75 ~~Yy~~a~~iIfVvD~sd~~~~~~~~~~l~~~l~~~~~~~~p-iLil~NK~Dl~~~~~-~~ei~~~l~l~~~~----~~~  148 (175)
T smart00177       75 RHYYTNTQGLIFVVDSNDRDRIDEAREELHRMLNEDELRDAV-ILVFANKQDLPDAMK-AAEITEKLGLHSIR----DRN  148 (175)
T ss_pred             HHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCE-EEEEEECCCCCCCCC-HHHHHHHHCHHHHC----CCC
T ss_conf             775577618999986687789999999999996315316986-999984566767889-99999996866540----797


Q ss_pred             EECCCCEEEEEE
Q ss_conf             102331146764
Q gi|254780263|r  163 TPIIRGSALCAL  174 (392)
Q Consensus       163 ~pii~~sa~~g~  174 (392)
                      +.+.++||.+|-
T Consensus       149 ~~i~~~SA~tG~  160 (175)
T smart00177      149 WYIQPTCATSGD  160 (175)
T ss_pred             EEEEEEECCCCC
T ss_conf             599982687896


No 151
>PRK11058 putative GTPase HflX; Provisional
Probab=99.14  E-value=1.3e-10  Score=84.81  Aligned_cols=165  Identities=19%  Similarity=0.141  Sum_probs=99.4

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC-CCEEEEEEECCCCH---------
Q ss_conf             79999904689887899999987644420013126868698629206378999821-99089998478730---------
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET-DKRFYSHIDCPGHA---------   82 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~-~~~~i~iiD~PGH~---------   82 (392)
                      -.++++|-.+||||||+.+|++..-   ....++.         -|.|.....+.. ++..+-+.||.|--         
T Consensus       198 ~~ValVGYTNAGKSTL~n~Lt~~~v---~~~d~LF---------ATLD~t~R~~~l~~~~~~lltDTVGFI~~LP~~Lve  265 (426)
T PRK11058        198 PTVSLVGYTNAGKSTLFNRITEARV---YAADQLF---------ATLDPTLRRIDVADVGETVLADTVGFIRHLPHDLVA  265 (426)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC---CCCCCCC---------CCCCCCEEEEECCCCCEEEEECCCHHHHHCCHHHHH
T ss_conf             7699973577778999877752887---6325450---------147862026786999869997150666519899999


Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCC-CCCCHHHHHHHHHHCCC--CCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE
Q ss_conf             2467798774002331452012344-33210677888863187--60233100233356122211012321001110145
Q gi|254780263|r   83 DYVKNMITGATQADGAILVCAAEDG-PKPQTREHILLARQIGI--SSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY  159 (392)
Q Consensus        83 ~f~~~mi~g~~~~D~ailvVda~~G-~~~QT~eh~~l~~~lgi--~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~  159 (392)
                      .| +.++.-+..||.-+.|||+++- +..|-.....++..+|+  ++.|++.||+|++++.+.  .+    ...  ..++
T Consensus       266 AF-~sTLeEv~~ADlLLhVvD~S~p~~~~q~~~v~~vL~elg~~~~p~i~V~NKiD~~~~~~~--~~----~~~--~~~~  336 (426)
T PRK11058        266 AF-KATLQETRQATLLLHVIDAADVRVQENIEAVNTVLEEIDAHEIPTLLVMNKIDMLDDFEP--RI----DRD--EENK  336 (426)
T ss_pred             HH-HHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCHHH--HH----HHH--HCCC
T ss_conf             99-999999963988999984999379999999999999759999977999977023896445--56----665--3399


Q ss_pred             EEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECC
Q ss_conf             322102331146764114445652123320344310252222100001100000
Q gi|254780263|r  160 SDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIE  213 (392)
Q Consensus       160 ~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~  213 (392)
                      .   ..+.+||.+|          .+++.|+++|...++...  ..-.+.+|.+
T Consensus       337 p---~~V~iSA~tg----------~Gi~~L~~~I~~~L~~~~--~~~~l~iP~~  375 (426)
T PRK11058        337 P---IRVWLSAQTG----------AGIPLLFQALTERLSGEV--AQHTLRLPPQ  375 (426)
T ss_pred             C---CEEEEECCCC----------CCHHHHHHHHHHHCCCCC--EEEEEEECHH
T ss_conf             8---7799978999----------899999999998703376--8999997865


No 152
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily.  This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins.  Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation.  Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state.  GDP/GTP exchange exposes the helix, which anchors to the membrane.  Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein.  A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site.  Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned.  Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI.  It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins.  Humans, but not rodents
Probab=99.12  E-value=3.2e-10  Score=82.48  Aligned_cols=139  Identities=17%  Similarity=0.114  Sum_probs=84.9

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378999821990899984787302467798774
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGA   92 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~   92 (392)
                      +.|.++|--.+|||||+.+|....        ..+.       --|+......++.++..+++-|++||+.|-.-.-.=.
T Consensus         1 ~KililG~~~sGKTsll~~l~~~~--------~~~~-------~pT~g~~~~~~~~~~~~l~iwD~~G~~~~r~l~~~Y~   65 (159)
T cd04150           1 MRILMVGLDAAGKTTILYKLKLGE--------IVTT-------IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYF   65 (159)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCC--------CCCC-------CCCCCCCEEEEEECCEEEEEEECCCCCCCCHHHHHHC
T ss_conf             999999999999899999997299--------6775-------8968701799998989999997899721465678647


Q ss_pred             HCCCCEEEEECCCCC-CCCCHHHHHHH----HHHCCCCCEEEEECCCCCCCCHHHHHHCCCCC--CEEEEEEEEEEEEEC
Q ss_conf             002331452012344-33210677888----86318760233100233356122211012321--001110145322102
Q gi|254780263|r   93 TQADGAILVCAAEDG-PKPQTREHILL----ARQIGISSIVVYMNKVDAVDDDELLDISEYEI--RDLLKEHKYSDDTPI  165 (392)
Q Consensus        93 ~~~D~ailvVda~~G-~~~QT~eh~~l----~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i--~~~l~~~~~~~~~pi  165 (392)
                      ..++++++|||+++- -....++.+.-    ....++| ++++.||+|+.+.-.. +++.+++  .. ++.    ..+.+
T Consensus        66 ~~a~~iI~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~p-ili~~NK~Dl~~~~~~-~ei~~~l~l~~-~~~----~~~~i  138 (159)
T cd04150          66 QNTQGLIFVVDSNDRERIGEAREELQRMLNEDELRDAV-LLVFANKQDLPNAMSA-AEVTDKLGLHS-LRN----RNWYI  138 (159)
T ss_pred             CCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCE-EEEEEECCCCCCCCCH-HHHHHHHCHHH-HHC----CCEEE
T ss_conf             68738999997777789999999999996235336982-9999975667789899-99999968666-637----98599


Q ss_pred             CCCEEEEE
Q ss_conf             33114676
Q gi|254780263|r  166 IRGSALCA  173 (392)
Q Consensus       166 i~~sa~~g  173 (392)
                      +++||.+|
T Consensus       139 ~~~SA~tG  146 (159)
T cd04150         139 QATCATSG  146 (159)
T ss_pred             EEEECCCC
T ss_conf             98268679


No 153
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=99.11  E-value=2.7e-10  Score=82.86  Aligned_cols=139  Identities=17%  Similarity=0.131  Sum_probs=84.4

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHHC
Q ss_conf             99990468988789999998764442001312686869862920637899982199089998478730246779877400
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQ   94 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~~   94 (392)
                      |.++|--.+|||||+.++...         ..+..      --|+......+.+++.++.+-|++||+.|-.-.-.=...
T Consensus         2 il~lG~~~~GKTsll~~~~~~---------~~~~~------~pTig~~~~~i~~~~~~~~iwD~~G~e~~r~~~~~y~~~   66 (158)
T cd04151           2 ILILGLDNAGKTTILYRLQLG---------EVVTT------IPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSN   66 (158)
T ss_pred             EEEECCCCCCHHHHHHHHHCC---------CCCCC------CCCCCCCEEEEEECCEEEEEEECCCCCCCCHHHHHHCCC
T ss_conf             999999999899999999709---------96775------784882469999898899999679862446278874667


Q ss_pred             CCCEEEEECCCCCC-CCCHHHHHHH----HHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCC-EEEEEEEEEEEEECCCC
Q ss_conf             23314520123443-3210677888----863187602331002333561222110123210-01110145322102331
Q gi|254780263|r   95 ADGAILVCAAEDGP-KPQTREHILL----ARQIGISSIVVYMNKVDAVDDDELLDISEYEIR-DLLKEHKYSDDTPIIRG  168 (392)
Q Consensus        95 ~D~ailvVda~~G~-~~QT~eh~~l----~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~-~~l~~~~~~~~~pii~~  168 (392)
                      +|++++|+|+++-- ....++.+.-    ....++| ++++.||+|+.+.-...+ +...+. +.++    ...++++++
T Consensus        67 ~~~ii~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~p-iliv~NK~Dl~~~~~~~~-i~~~l~l~~~~----~~~~~~~~t  140 (158)
T cd04151          67 TDAIIYVVDSTDRDRLGTAKEELHAMLEEEELKGAV-LLVFANKQDMPGALSEAE-ISEKLGLSELK----DRTWSIFKT  140 (158)
T ss_pred             CCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCCHHH-HHHHHHHHHHH----CCCCEEEEE
T ss_conf             889999974578789999999999998346536981-999997667765779999-99998598741----699689996


Q ss_pred             EEEEEE
Q ss_conf             146764
Q gi|254780263|r  169 SALCAL  174 (392)
Q Consensus       169 sa~~g~  174 (392)
                      ||.+|.
T Consensus       141 SA~tG~  146 (158)
T cd04151         141 SAIKGE  146 (158)
T ss_pred             ECCCCC
T ss_conf             787893


No 154
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=99.11  E-value=4.4e-10  Score=81.60  Aligned_cols=143  Identities=18%  Similarity=0.121  Sum_probs=87.5

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             88279999904689887899999987644420013126868698629206378999821990899984787302467798
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      |..++|.++|--.+|||||+.+|...  ..      ...       --|+......+++++..+++-|++|++.|-.-.-
T Consensus        15 kk~~kililGl~~sGKTsil~~l~~~--~~------~~~-------~pTvg~~~~~~~~~~~~l~iwD~~Gqe~~r~lw~   79 (182)
T PTZ00133         15 KKEVRILMVGLDAAGKTTILYKLKLG--EV------VTT-------IPTIGFNVETVEYKNLKFTMWDVGGQDKLRPLWR   79 (182)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHCC--CC------CCC-------CCCCCCCEEEEEECCEEEEEEECCCCCCCCHHHH
T ss_conf             87479999967998899999999629--97------773-------7868845699997888999998999845474787


Q ss_pred             HHHHCCCCEEEEECCCCC-CCCCHHHHHHH-H---HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE-EEEE
Q ss_conf             774002331452012344-33210677888-8---6318760233100233356122211012321001110145-3221
Q gi|254780263|r   90 TGATQADGAILVCAAEDG-PKPQTREHILL-A---RQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY-SDDT  163 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G-~~~QT~eh~~l-~---~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~-~~~~  163 (392)
                      .=...+|++|+|||+++- -..+.++.+.- +   ...++| ++|+.||.|+.+.-. .+++.++    +..... +.++
T Consensus        80 ~yy~~~~giI~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~p-iLi~~NK~Dl~~a~~-~~ei~~~----l~l~~~~~~~~  153 (182)
T PTZ00133         80 HYYQNTNGIIFVVDSNDRERIGDARQELEKMLAEDELRNAV-LLVFANKQDLPNAMS-TTEVTEK----LGLHSVRQRNW  153 (182)
T ss_pred             HCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCE-EEEEECCCCCCCCCC-HHHHHHH----HCHHHHHCCCC
T ss_conf             60567644999996678789999999999997144224885-999970668778889-9999999----69555615995


Q ss_pred             ECCCCEEEEE
Q ss_conf             0233114676
Q gi|254780263|r  164 PIIRGSALCA  173 (392)
Q Consensus       164 pii~~sa~~g  173 (392)
                      .+.++||.+|
T Consensus       154 ~i~~~SA~tG  163 (182)
T PTZ00133        154 YIQGCCATTA  163 (182)
T ss_pred             EEEEEECCCC
T ss_conf             8998257589


No 155
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=99.11  E-value=1.4e-10  Score=84.69  Aligned_cols=139  Identities=20%  Similarity=0.155  Sum_probs=82.2

Q ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC--CCEEEEEEECCCCHHHHHHHHHHHHC
Q ss_conf             9904689887899999987644420013126868698629206378999821--99089998478730246779877400
Q gi|254780263|r   17 TIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET--DKRFYSHIDCPGHADYVKNMITGATQ   94 (392)
Q Consensus        17 ~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~--~~~~i~iiD~PGH~~f~~~mi~g~~~   94 (392)
                      ++|+.++|||||+.++++..-.            .+.....+++.....+..  ..+.++|.|+|||.+|......-...
T Consensus         1 vvG~~~~GKSsl~~~~~~~~~~------------~~~~~~~~~~~~~~~~~~~~~~~~~~i~D~~g~~~~~~~~~~~~~~   68 (157)
T cd00882           1 VVGDSGVGKTSLLNRLLGGEFV------------PEEYETTIIDFYSKTIEVDGKKVKLQIWDTAGQERFRSLRRLYYRG   68 (157)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCC------------CCCCCCCEEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             9294996889999999719888------------7646871578999999999999999999858951156789999753


Q ss_pred             CCCEEEEECCCCCCCCCHHHHH--HHHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCE
Q ss_conf             2331452012344332106778--88863---187602331002333561222110123210011101453221023311
Q gi|254780263|r   95 ADGAILVCAAEDGPKPQTREHI--LLARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGS  169 (392)
Q Consensus        95 ~D~ailvVda~~G~~~QT~eh~--~l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~s  169 (392)
                      +|++++|+|+++...-+..+.+  .+...   .++| ++++.||.|+.+........  .... +..   ....|++++|
T Consensus        69 ~~~~i~v~d~~~~~s~~~~~~~~~~~~~~~~~~~~~-iiiv~nK~Dl~~~~~~~~~~--~~~~-~~~---~~~~~~~~~S  141 (157)
T cd00882          69 ADGIILVYDVTDRESFENVKEWLLLILINKEGENIP-IILVGNKIDLPEERVVSEEE--LAEQ-LAK---ELGVPYFETS  141 (157)
T ss_pred             CCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEEEECCCCHHCCCCCHHH--HHHH-HHH---HCCCEEEEEC
T ss_conf             579999986588888999999999999975258984-99998535615406688999--9999-998---7898699984


Q ss_pred             EEEEE
Q ss_conf             46764
Q gi|254780263|r  170 ALCAL  174 (392)
Q Consensus       170 a~~g~  174 (392)
                      +..+.
T Consensus       142 a~~~~  146 (157)
T cd00882         142 AKTGE  146 (157)
T ss_pred             CCCCC
T ss_conf             78883


No 156
>COG2262 HflX GTPases [General function prediction only]
Probab=99.09  E-value=3.9e-10  Score=81.89  Aligned_cols=154  Identities=20%  Similarity=0.157  Sum_probs=96.3

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC-CEEEEEEECCCCHHH-----
Q ss_conf             82799999046898878999999876444200131268686986292063789998219-908999847873024-----
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD-KRFYSHIDCPGHADY-----   84 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~-~~~i~iiD~PGH~~f-----   84 (392)
                      ..-.|+++|-.+||||||..+||+...-   ....+.         -|.+.....+..+ ++.+-+-||-|--+=     
T Consensus       191 ~~p~vaLvGYTNAGKSTL~N~LT~~~~~---~~d~LF---------ATLdpttR~~~l~~g~~vlLtDTVGFI~~LP~~L  258 (411)
T COG2262         191 GIPLVALVGYTNAGKSTLFNALTGADVY---VADQLF---------ATLDPTTRRIELGDGRKVLLTDTVGFIRDLPHPL  258 (411)
T ss_pred             CCCEEEEEEECCCCHHHHHHHHHCCCEE---CCCCCC---------CCCCCCEEEEEECCCCEEEEECCCCCCCCCCHHH
T ss_conf             9975898732344499999887245713---046664---------2105740489807996499865756715598679


Q ss_pred             ---HHHHHHHHHCCCCEEEEECCCCC-CCCCHHHHHHHHHHCCC--CCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEE
Q ss_conf             ---67798774002331452012344-33210677888863187--6023310023335612221101232100111014
Q gi|254780263|r   85 ---VKNMITGATQADGAILVCAAEDG-PKPQTREHILLARQIGI--SSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHK  158 (392)
Q Consensus        85 ---~~~mi~g~~~~D~ailvVda~~G-~~~QT~eh~~l~~~lgi--~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~  158 (392)
                         .+.++--...||..+.||||++. +..|-.....++..+|+  +++|++.||+|++.++....    .+....    
T Consensus       259 V~AFksTLEE~~~aDlllhVVDaSdp~~~~~~~~v~~vL~el~~~~~p~i~v~NKiD~~~~~~~~~----~~~~~~----  330 (411)
T COG2262         259 VEAFKSTLEEVKEADLLLHVVDASDPEILEKLEAVEDVLAEIGADEIPIILVLNKIDLLEDEEILA----ELERGS----  330 (411)
T ss_pred             HHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCHHHHH----HHHHCC----
T ss_conf             999999898762277799974068851899999999999974889997899976410157322234----566348----


Q ss_pred             EEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCC
Q ss_conf             5322102331146764114445652123320344310252
Q gi|254780263|r  159 YSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIP  198 (392)
Q Consensus       159 ~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~  198 (392)
                        +  ..+++||.+|.          +++.|.+.|...++
T Consensus       331 --~--~~v~iSA~~~~----------gl~~L~~~i~~~l~  356 (411)
T COG2262         331 --P--NPVFISAKTGE----------GLDLLRERIIELLS  356 (411)
T ss_pred             --C--CEEEEEECCCC----------CHHHHHHHHHHHHH
T ss_conf             --9--74899806675----------98999999999863


No 157
>TIGR02528 EutP ethanolamine utilization protein, EutP; InterPro: IPR012381   Members of this family function in ethanolamine  and propanediol  degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively.  The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems.  Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose , . More than 10f the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect , . The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella , , . Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 biogenic amine metabolic process.
Probab=99.08  E-value=2.4e-10  Score=83.26  Aligned_cols=136  Identities=26%  Similarity=0.321  Sum_probs=90.3

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-EEECCCEEEEEEECCC----CHHHHHHH
Q ss_conf             999990468988789999998764442001312686869862920637899-9821990899984787----30246779
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-SYETDKRFYSHIDCPG----HADYVKNM   88 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~~~~~~~~i~iiD~PG----H~~f~~~m   88 (392)
                      +|+++|.+.+|||||+..|-+.                      -+...=+ ..||..+  ..|||||    |+.|-...
T Consensus         2 r~~f~G~~gCGKTTL~q~L~g~----------------------~~~YKKTQAvE~~~k--~~IDTPGEY~enr~~Y~AL   57 (144)
T TIGR02528         2 RIMFIGSVGCGKTTLTQALQGE----------------------EIKYKKTQAVEYKDK--EAIDTPGEYVENRRYYSAL   57 (144)
T ss_pred             EEEEEECCCCCHHHHHHHCCCC----------------------CCCEEEEEEEEECCC--CCCCCCCCCCCCCCHHHHH
T ss_conf             1788715888744354311687----------------------321023344542588--8655985001575237888


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCC-CEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCC
Q ss_conf             8774002331452012344332106778888631876-023310023335612221101232100111014532210233
Q gi|254780263|r   89 ITGATQADGAILVCAAEDGPKPQTREHILLARQIGIS-SIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIR  167 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~-~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~  167 (392)
                      +.-++-||.-+||-+|.++...-.   ...+.. ..+ +.|=.|+|+|+.+.+...+..+.    +|.+.|.   -+++.
T Consensus        58 ~vtaaDAd~i~lV~~a~~~~~~f~---PgF~~~-f~kK~~IG~vTK~DLA~~d~~i~r~~~----~L~~AG~---~~iF~  126 (144)
T TIGR02528        58 IVTAADADVIALVQSATDEESRFS---PGFASI-FVKKEVIGIVTKIDLAEADKDIERAKR----LLETAGA---EKIFE  126 (144)
T ss_pred             HHHHHCCEEEEEEECCCCCCCCCC---CCCCCC-CCCCCEEEEEEECCCCCCHHHHHHHHH----HHHHCCC---CCCEE
T ss_conf             888721023667735776422378---500023-678863478840378877347999999----9872365---43316


Q ss_pred             CEEEEEEECCCCCCCCCCCCCHHHHHH
Q ss_conf             114676411444565212332034431
Q gi|254780263|r  168 GSALCALQGTNKELGEDSIHALMKAVD  194 (392)
Q Consensus       168 ~sa~~g~~~~n~~~~~~~~~~Ll~~i~  194 (392)
                      +|...          ..+++.|++.|.
T Consensus       127 ~~~~d----------~~G~~~l~~yL~  143 (144)
T TIGR02528       127 ISSVD----------EKGIEELVDYLN  143 (144)
T ss_pred             ECCCC----------CHHHHHHHHHHC
T ss_conf             50778----------045899999844


No 158
>PRK12299 obgE GTPase ObgE; Reviewed
Probab=99.08  E-value=4e-10  Score=81.85  Aligned_cols=150  Identities=17%  Similarity=0.273  Sum_probs=86.9

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC-----CH------
Q ss_conf             9999904689887899999987644420013126868698629206378999821990899984787-----30------
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG-----HA------   82 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG-----H~------   82 (392)
                      -++++|-..+|||||+.+|+....+.+..   ..++       .+=.++...+. +.+.+.+.|.||     |+      
T Consensus       160 DVgLVG~PNaGKSTLl~~is~A~pkIa~Y---pFTT-------l~P~lGvv~~~-d~~~~~iaDiPGlIegA~~g~GLG~  228 (334)
T PRK12299        160 DVGLVGLPNAGKSTLISSVSAAKPKIADY---PFTT-------LHPNLGVVRVD-DYKSFVIADIPGLIEGASEGAGLGH  228 (334)
T ss_pred             CCEEEECCCCCHHHHHHHHHCCCCCCCCC---CCEE-------CCCEEEEEEEC-CCCEEEEEECCCCCCCCCCCCCCHH
T ss_conf             30146369874669999876476433578---7300-------38754799946-8867899866743355234777478


Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCC-CCCCH---HHHHHH--HHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEE
Q ss_conf             2467798774002331452012344-33210---677888--86318760233100233356122211012321001110
Q gi|254780263|r   83 DYVKNMITGATQADGAILVCAAEDG-PKPQT---REHILL--ARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKE  156 (392)
Q Consensus        83 ~f~~~mi~g~~~~D~ailvVda~~G-~~~QT---~eh~~l--~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~  156 (392)
                      +|++.    +.-+...+.|||++.. +..+-   ++.+..  -.++. ++.+|++||||+++.++..+..+    ++.+.
T Consensus       229 ~FLrH----ieR~~~L~~viD~s~~d~~~~~~~l~~EL~~y~~~L~~-Kp~ivvlNK~Dl~~~~~~~~~~~----~~~~~  299 (334)
T PRK12299        229 RFLKH----IERTRLLLHLVDASSEDPVEDYKTIRNELEKYSPELAD-KPRILVLNKIDLLDEEERKEKIK----ELIKA  299 (334)
T ss_pred             HHHHH----HHHCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCC-CCEEEEEECCCCCCHHHHHHHHH----HHHHH
T ss_conf             99876----65343699999799889899999999999985065536-98799998810688567899999----99987


Q ss_pred             EEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCC
Q ss_conf             14532210233114676411444565212332034431025
Q gi|254780263|r  157 HKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHI  197 (392)
Q Consensus       157 ~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~  197 (392)
                      .    +.+++++||.++.          +++.|++.+.+.+
T Consensus       300 ~----~~~v~~ISA~~g~----------Gl~eL~~~i~~~L  326 (334)
T PRK12299        300 L----GGPVFLISAVTGE----------GLDELLRALWEFL  326 (334)
T ss_pred             C----CCCEEEEECCCCC----------CHHHHHHHHHHHH
T ss_conf             0----9968999787784----------9999999999999


No 159
>cd04095 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu. Escherichia coli ATPS consists of CysN and a smaller subunit CysD and CysN. ATPS produces adenosine-5'-phosphosulfate (APS) from ATP and sulfate, coupled with GTP hydrolysis. In the subsequent reaction APS is phosphorylated by an APS kinase (CysC), to produce 3'-phosphoadenosine-5'-phosphosulfate (PAPS) for use in amino acid (aa) biosynthesis. The Rhizobiaceae group (alpha-proteobacteria) appears to carry out the same chemistry for the sufation of a nodulation factor. In Rhizobium meliloti, a the hererodimeric complex comprised of NodP and NodQ appears to possess both ATPS and APS kinase activities. The N and C termini of NodQ correspond to CysN and CysC, respectively.   Other eubacteria, Archaea, and eukaryotes use a different ATP sulfurylase, which s
Probab=99.05  E-value=2.5e-09  Score=76.93  Aligned_cols=83  Identities=20%  Similarity=0.319  Sum_probs=66.8

Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEE-----------CCCHHHHCCCCEEEEEEEECCCEEE
Q ss_conf             30001689997105678755551159789999541477799996-----------1895570789769999997781775
Q gi|254780263|r  299 EYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIIL-----------SPGSQAVMPGDRVDLEVELIYPIAM  367 (392)
Q Consensus       299 ~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~-----------~~~~~~i~~g~~~~v~l~l~~pi~~  367 (392)
                      .+..|+|+++||+..      ++..|.++.+.+++..+.+++..           ......|..||++.|+|++.+|+++
T Consensus         2 ~s~~f~a~l~Wl~~~------pl~~g~~y~lk~~t~~~~~~I~~I~~~iDi~tl~~~~~~~l~~NdIa~v~i~~~~~i~~   75 (103)
T cd04095           2 VSDQFAATLVWMDEE------PLRPGRKYLLKLGTRTVRATVTAIKYRVDVNTLEHEAADTLELNDIGRVELSLSKPLAF   75 (103)
T ss_pred             CCCEEEEEEEEECCC------CCCCCCEEEEEECCEEEEEEEEEEEEEEECCCCCCCCCCEECCCCEEEEEEEECCCCCC
T ss_conf             243998999997398------68899999999877099999954489982264252443423799469999997996336


Q ss_pred             CCC------CEEEEEE--CCEEEEEEEE
Q ss_conf             469------8499998--9969998999
Q gi|254780263|r  368 EPN------QTFSMRE--GGKTVGAGLI  387 (392)
Q Consensus       368 e~~------~rfilRd--~~~tig~G~I  387 (392)
                      ++|      ++|+|.|  ++.|+|+|+|
T Consensus        76 D~y~~n~~~G~fILID~~tn~TvgaG~I  103 (103)
T cd04095          76 DPYRENRATGSFILIDRLTNATVGAGMI  103 (103)
T ss_pred             CHHHHCCCCCCEEEEECCCCCEEEEEEC
T ss_conf             7056285861199998999968988729


No 160
>COG1084 Predicted GTPase [General function prediction only]
Probab=99.05  E-value=1.9e-09  Score=77.61  Aligned_cols=115  Identities=21%  Similarity=0.244  Sum_probs=76.0

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHH--HH------
Q ss_conf             9999904689887899999987644420013126868698629206378999821990899984787302--46------
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHAD--YV------   85 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~--f~------   85 (392)
                      .++++|+.+-|||||+..||+..-+.+.   +-.++       ..|.+||  |+.+..++-+|||||--|  +-      
T Consensus       170 TivVaG~PNVGKSSlv~~lT~AkpEvA~---YPFTT-------K~i~vGh--fe~~~~R~QvIDTPGlLDRPl~ErN~IE  237 (346)
T COG1084         170 TIVVAGYPNVGKSSLVRKLTTAKPEVAP---YPFTT-------KGIHVGH--FERGYLRIQVIDTPGLLDRPLEERNEIE  237 (346)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCC---CCCCC-------CCEEEEE--EECCCCEEEEECCCCCCCCCHHHHCHHH
T ss_conf             3898569987589999887548976678---88533-------6546765--5048705898428864578857736899


Q ss_pred             HHHHHHHHC-CCCEEEEECCCC----CCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHH
Q ss_conf             779877400-233145201234----43321067788886318760233100233356122
Q gi|254780263|r   86 KNMITGATQ-ADGAILVCAAED----GPKPQTREHILLARQIGISSIVVYMNKVDAVDDDE  141 (392)
Q Consensus        86 ~~mi~g~~~-~D~ailvVda~~----G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~  141 (392)
                      ++-+.++.. .++.|.++|+++    .++.|-.=--.+-..+. +++++++||+|.++.++
T Consensus       238 ~qAi~AL~hl~~~IlF~~D~Se~cgy~lE~Q~~L~~eIk~~f~-~p~v~V~nK~D~~~~e~  297 (346)
T COG1084         238 RQAILALRHLAGVILFLFDPSETCGYSLEEQISLLEEIKELFK-APIVVVINKIDIADEEK  297 (346)
T ss_pred             HHHHHHHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHCC-CCEEEEEECCCCCCHHH
T ss_conf             9999999974285899976850028999999999999998538-87699974101246667


No 161
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=99.04  E-value=7e-10  Score=80.33  Aligned_cols=139  Identities=22%  Similarity=0.218  Sum_probs=82.5

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCC--EEEEEEECCCCHHHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869862920637899982199--08999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK--RFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~--~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.++++|.-..|||||+.++...            ...++-...+..+.....+..++  ..+.|.||||+++|-.-.-.
T Consensus         1 ~Ki~vvG~~~vGKTsli~~~~~~------------~f~~~~~~Tig~d~~~~~~~~~~~~~~l~iwDt~G~e~~~~l~~~   68 (159)
T cd00154           1 FKIVLIGDSGVGKTSLLLRFVDG------------KFDENYKSTIGVDFKSKTIEIDGKTVKLQIWDTAGQERFRSITPS   68 (159)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHH
T ss_conf             98999996996899999999709------------999984886664799999999999999999978982657788999


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHH----HHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEE
Q ss_conf             74002331452012344332106778----888631---87602331002333561222110123210011101453221
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHI----LLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDT  163 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~----~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~  163 (392)
                      -...+|++++|.|.++-   ++-+++    ..++..   .+| ++++-||+|+.+..+   ...++..++.++.    +.
T Consensus        69 ~~~~~d~~ilv~d~~~~---~Sf~~~~~~~~~i~~~~~~~~~-iilvgnK~DL~~~~~---v~~~~~~~~a~~~----~~  137 (159)
T cd00154          69 YYRGAHGAILVYDITNR---ESFENLDKWLKELKEYAPENIP-IILVGNKIDLEDQRQ---VSTEEAQQFAKEN----GL  137 (159)
T ss_pred             HHHHCCEEEEECCCCCH---HHHHHHHHHHHHHHHHCCCCCC-EEEEEECCCCHHCCC---CCHHHHHHHHHHC----CC
T ss_conf             97541275672448988---9999999999999986898882-699997456301168---9999999999986----99


Q ss_pred             ECCCCEEEEEE
Q ss_conf             02331146764
Q gi|254780263|r  164 PIIRGSALCAL  174 (392)
Q Consensus       164 pii~~sa~~g~  174 (392)
                      +++.+||.++.
T Consensus       138 ~~~e~SAk~~~  148 (159)
T cd00154         138 LFFETSAKTGE  148 (159)
T ss_pred             EEEEECCCCCC
T ss_conf             79998768881


No 162
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=99.03  E-value=8.2e-10  Score=79.92  Aligned_cols=139  Identities=14%  Similarity=0.150  Sum_probs=82.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC-CEEEEEEECCCCHHHHHHHHHHHH
Q ss_conf             9999046898878999999876444200131268686986292063789998219-908999847873024677987740
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD-KRFYSHIDCPGHADYVKNMITGAT   93 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~-~~~i~iiD~PGH~~f~~~mi~g~~   93 (392)
                      |.++|--.+|||||+.++...         ....      .--|+......+..+ +..+++-|++|.+.|-.-.-.=..
T Consensus         2 ivilG~~~~GKTsil~r~~~~---------~~~~------~~pTig~~~~~~~~~~~~~l~iwD~~G~e~~~~~~~~y~~   66 (160)
T cd04156           2 VLLLGLDSAGKSTLLYKLKHA---------ELVT------TIPTVGFNVEMLQLEKHLSLTVWDVGGQEKMRTVWKCYLE   66 (160)
T ss_pred             EEEECCCCCCHHHHHHHHHCC---------CCCC------CCCCCCEEEEEEEECCEEEEEEEECCCCCCCCHHHHHHHC
T ss_conf             999999999999999999569---------8777------5776150389999899899999978986247415887745


Q ss_pred             CCCCEEEEECCCCCC-CCCHHHHHH-HHHH---CCCCCEEEEECCCCCCCCHHHHHHCCC--CCCEEEEEEEEEEEEECC
Q ss_conf             023314520123443-321067788-8863---187602331002333561222110123--210011101453221023
Q gi|254780263|r   94 QADGAILVCAAEDGP-KPQTREHIL-LARQ---IGISSIVVYMNKVDAVDDDELLDISEY--EIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        94 ~~D~ailvVda~~G~-~~QT~eh~~-l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~--~i~~~l~~~~~~~~~pii  166 (392)
                      .+|++|+|+|+++-. ..+.++.+. +++.   .++| ++++.||+|+.+.-. .+++..  ++.++.+.    .++++.
T Consensus        67 ~a~~iI~V~D~td~~~~~~~~~~~~~~l~~~~~~~~p-ili~~NK~Dl~~~~~-~~ei~~~l~~~~~~~~----~~~~i~  140 (160)
T cd04156          67 NTDGLVYVVDSSDEARLDESQKELKHILKNEHIKGVP-VVLLANKQDLPGALT-AEEITRRFKLKKYCSD----RDWYVQ  140 (160)
T ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCCCCCCC-HHHHHHHHHHHHHHHC----CCCEEE
T ss_conf             6778999985686788787999999998663537874-999998633656679-9999999869999853----999999


Q ss_pred             CCEEEEEE
Q ss_conf             31146764
Q gi|254780263|r  167 RGSALCAL  174 (392)
Q Consensus       167 ~~sa~~g~  174 (392)
                      ++||.+|-
T Consensus       141 ~~SAktGe  148 (160)
T cd04156         141 PCSAVTGE  148 (160)
T ss_pred             EEECCCCC
T ss_conf             86688495


No 163
>pfam09439 SRPRB Signal recognition particle receptor beta subunit. The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase which anchors the alpha subunit to the endoplasmic reticulum membrane.
Probab=99.01  E-value=1.9e-09  Score=77.68  Aligned_cols=113  Identities=19%  Similarity=0.245  Sum_probs=74.0

Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEEECCCEEEEEEECCCCHHHHH
Q ss_conf             388279999904689887899999987644420013126868698629206--378999821990899984787302467
Q gi|254780263|r    9 NKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSYETDKRFYSHIDCPGHADYVK   86 (392)
Q Consensus         9 ~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~~~~~~~i~iiD~PGH~~f~~   86 (392)
                      ++|  .|.++|=-+||||||.-+|......      .+         --||  +.++.+...++..++++|.|||..+-.
T Consensus         2 ~~p--tvLllGl~~sGKT~Lf~~L~~~~~~------~T---------~tS~~~n~~~~~~~~~~~~~~lvD~PGh~klR~   64 (181)
T pfam09439         2 SQP--AVIIAGLCDSGKTSLFTLLTTGSVR------KT---------VTSQEPSAAYKYMNNKGNSLTLIDFPGHVKLRY   64 (181)
T ss_pred             CCC--EEEEECCCCCCHHHHHHHHHCCCCC------CE---------ECCCCCCCEEEEECCCCCEEEEEECCCCHHHHH
T ss_conf             988--6999868999899999999759948------75---------888678640687516896689998899689999


Q ss_pred             HHHH---HHHCCCCEEEEECCCC--CCCCCHHHHHHH-HH---H--CCCCCEEEEECCCCCCCC
Q ss_conf             7987---7400233145201234--433210677888-86---3--187602331002333561
Q gi|254780263|r   87 NMIT---GATQADGAILVCAAED--GPKPQTREHILL-AR---Q--IGISSIVVYMNKVDAVDD  139 (392)
Q Consensus        87 ~mi~---g~~~~D~ailvVda~~--G~~~QT~eh~~l-~~---~--lgi~~iIv~iNKmD~v~~  139 (392)
                      .+..   ..+.+.+.|.|||+..  .-...+.|.+.- +.   .  -++| +.|+.||+|+...
T Consensus        65 ~~~~~~~~~~~~~gIVfVVDS~~~~~~l~~~Ae~Ly~iL~~~~~~~~~vP-vLI~cNKqDl~~A  127 (181)
T pfam09439        65 KLLETLKDSSSLRGLVFVVDSTAFPKEVTDTAEFLYDILSITELLKNGID-ILIACNKQEIFTA  127 (181)
T ss_pred             HHHHHHHHHCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHCHHHCCCCCC-EEEEEECCCCCCC
T ss_conf             99986430026449999997866566799999999999844543368997-8999737463357


No 164
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=98.99  E-value=1.4e-09  Score=78.47  Aligned_cols=142  Identities=18%  Similarity=0.147  Sum_probs=85.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEE--EEEEECCCEEEEEEECCCCHHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378--9998219908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATA--HVSYETDKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~--~~~~~~~~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.|+++|.-..|||+|+.+++..            ...++-..-+..+..  ...+......+.|.|+||+++|-...-.
T Consensus         1 ~KivvvG~~~vGKTsli~r~~~~------------~f~~~~~~ti~~~~~~~~~~~~~~~~~l~iwDt~g~~~~~~~~~~   68 (161)
T cd01863           1 LKILLIGDSGVGKSSLLLRFTDD------------TFDPDLAATIGVDFKVKTLTVDGKKVKLAIWDTAGQERFRTLTSS   68 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCCCCCEEEEEEECCEEEEEEEEECCCCCCCCCCHHH
T ss_conf             98999997995799999999639------------999984873133423899999999999999999998423534224


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHH-HHHHHC----CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEEC
Q ss_conf             74002331452012344332106778-888631----8760233100233356122211012321001110145322102
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHI-LLARQI----GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPI  165 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~-~l~~~l----gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pi  165 (392)
                      -...+|+++||.|.+.-..=+..+++ ..++..    .+| ++++-||.|+-+.+    ...++.+++.++.    +.++
T Consensus        69 ~~~~a~~~ilvfd~~~~~Sf~~i~~~~~~i~~~~~~~~~~-~ilVgnK~D~~~~~----v~~~~~~~~a~~~----~~~y  139 (161)
T cd01863          69 YYRGAQGVILVYDVTRRDTFTNLETWLNELETYSTNNDIV-KMLVGNKIDKENRE----VTREEGLKFARKH----NMLF  139 (161)
T ss_pred             HHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCE-EEEEEECCCCCCCC----CCHHHHHHHHHHC----CCEE
T ss_conf             4132153489976782656999999999999856888873-78873104400068----9999999999986----9999


Q ss_pred             CCCEEEEEEE
Q ss_conf             3311467641
Q gi|254780263|r  166 IRGSALCALQ  175 (392)
Q Consensus       166 i~~sa~~g~~  175 (392)
                      +.+||.+|.+
T Consensus       140 ~e~Sak~g~n  149 (161)
T cd01863         140 IETSAKTRDG  149 (161)
T ss_pred             EEECCCCCCC
T ss_conf             9971586815


No 165
>PRK12298 obgE GTPase ObgE; Reviewed
Probab=98.98  E-value=2e-09  Score=77.57  Aligned_cols=138  Identities=16%  Similarity=0.258  Sum_probs=84.2

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC-----CH------
Q ss_conf             9999904689887899999987644420013126868698629206378999821990899984787-----30------
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG-----HA------   82 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG-----H~------   82 (392)
                      -|+.+|-..+|||||+.+++....+.+.   +..++       .+=+++...+. +.+.+.+.|.||     |+      
T Consensus       161 DVGLvG~PNAGKSTll~~iS~AkPKIAd---YpFTT-------L~PnLGvV~~~-~~~~fviADIPGLIeGAs~G~GLG~  229 (380)
T PRK12298        161 DVGLLGLPNAGKSTFIRAVSAAKPKVAD---YPFTT-------LVPNLGVVRVD-DERSFVIADIPGLIEGAAEGAGLGI  229 (380)
T ss_pred             CCCEEECCCCCCHHHHHHHHCCCCCCCC---CCCCC-------CCCEEEEEEEC-CCCEEEEEECCCCCCCCCCCCCHHH
T ss_conf             6514636988610899885558975478---87533-------68746799946-9866999877755577555877289


Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCC--CCCCCHHHHHHH--------HHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCE
Q ss_conf             246779877400233145201234--433210677888--------8631876023310023335612221101232100
Q gi|254780263|r   83 DYVKNMITGATQADGAILVCAAED--GPKPQTREHILL--------ARQIGISSIVVYMNKVDAVDDDELLDISEYEIRD  152 (392)
Q Consensus        83 ~f~~~mi~g~~~~D~ailvVda~~--G~~~QT~eh~~l--------~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~  152 (392)
                      +|++.+.|    +..-+.|||+..  +-.|.- ....|        -.++.-|+ ||++||||+.+.+++.+.    +++
T Consensus       230 ~FLrHieR----t~~LlhviD~s~~~~~dp~~-~~~~i~~EL~~Y~~~L~~kp~-iiv~NK~Dl~~~~e~~~~----~~~  299 (380)
T PRK12298        230 RFLKHLER----CRVLLHLIDIAPIDGSDPVE-NARIIVNELEKYSPKLAEKPR-WLVFNKIDLLDEEEAEER----AKE  299 (380)
T ss_pred             HHHHHHHH----HCEEEEEEECCCCCCCCHHH-HHHHHHHHHHHHCHHHCCCCE-EEEEECCCCCCHHHHHHH----HHH
T ss_conf             99999875----35899999688777519999-999999999985976605987-999988548997999999----999


Q ss_pred             EEEEEEEEEEEECCCCEEEEEE
Q ss_conf             1110145322102331146764
Q gi|254780263|r  153 LLKEHKYSDDTPIIRGSALCAL  174 (392)
Q Consensus       153 ~l~~~~~~~~~pii~~sa~~g~  174 (392)
                      +++..++.  .|++++||+++.
T Consensus       300 ~~~~~~~~--~~v~~ISA~tge  319 (380)
T PRK12298        300 IVEALGWE--GPVYLISAASGE  319 (380)
T ss_pred             HHHHCCCC--CCEEEEECCCCC
T ss_conf             99970888--887999787687


No 166
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=98.98  E-value=1.8e-09  Score=77.75  Aligned_cols=140  Identities=24%  Similarity=0.261  Sum_probs=85.9

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHHC
Q ss_conf             99990468988789999998764442001312686869862920637899982199089998478730246779877400
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQ   94 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~~   94 (392)
                      |.++|=-+||||||+-+|....         .      ..--=|+-.....+++++..+++-|.+|+..|-+---.=...
T Consensus         2 ililGLd~aGKTTil~~l~~~~---------~------~~~~PT~G~~~~~~~~~~~~l~~~DlgG~~~~R~lW~~Y~~~   66 (167)
T cd04161           2 LLTVGLDNAGKTTLVSALQGEI---------P------KKVAPTVGFTPTKLRLDKYEVCIFDLGGGANFRGIWVNYYAE   66 (167)
T ss_pred             EEEEEECCCCHHHHHHHHCCCC---------C------CCCCCCCCCCEEEEEECCEEEEEEECCCCHHHHHHHHHHCCC
T ss_conf             8999008998899999982899---------8------765087773179999899999999899877888999987347


Q ss_pred             CCCEEEEECCCC-CCCCCHHHHHHHH----HHCCCCCEEEEECCCCCCCC---HHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             233145201234-4332106778888----63187602331002333561---222110123210011101453221023
Q gi|254780263|r   95 ADGAILVCAAED-GPKPQTREHILLA----RQIGISSIVVYMNKVDAVDD---DELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        95 ~D~ailvVda~~-G~~~QT~eh~~l~----~~lgi~~iIv~iNKmD~v~~---~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
                      +|+.|+|||+++ .-+.+.++.+.-+    ...++| +.|+.||.|+.+.   ++..+..  .+.++....  ...+.+.
T Consensus        67 ~~gIIfVVDssD~~rl~eak~~L~~lL~~~~l~~~P-iLIlaNKqDl~~a~~~~ei~~~L--~L~~l~~~~--~~~~~I~  141 (167)
T cd04161          67 AHGLVFVVDSSDDDRVQEVKEILRELLQHPRVSGKP-ILVLANKQDKKNALLGADVIEYL--SLEKLVNEN--KSLCHIE  141 (167)
T ss_pred             CCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCE-EEEEEECCCCCCCCCHHHHHHHH--CCHHHCCCC--CCEEEEE
T ss_conf             765799985575889999999999996588778995-99998865761589999999881--974240899--8637999


Q ss_pred             CCEEEEEE
Q ss_conf             31146764
Q gi|254780263|r  167 RGSALCAL  174 (392)
Q Consensus       167 ~~sa~~g~  174 (392)
                      ++||++|.
T Consensus       142 ~csA~tG~  149 (167)
T cd04161         142 PCSAIEGL  149 (167)
T ss_pred             ECEEECCC
T ss_conf             57644488


No 167
>TIGR02729 Obg_CgtA GTP-binding protein Obg/CgtA; InterPro: IPR014100   This entry describes a universal, mostly one-gene-per-genome GTP-binding protein that associates with ribosomal subunits and appears to play a role in ribosomal RNA maturation. Mutations in this gene are pleiotropic, but it appears that effects on cellular functions such as chromosome partition may be secondary to the effect on ribosome structure..
Probab=98.98  E-value=4.6e-09  Score=75.27  Aligned_cols=110  Identities=19%  Similarity=0.249  Sum_probs=74.6

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCC--EEEEEEECCC-----CH----
Q ss_conf             999990468988789999998764442001312686869862920637899982199--0899984787-----30----
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK--RFYSHIDCPG-----HA----   82 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~--~~i~iiD~PG-----H~----   82 (392)
                      -|+.+|=..||||||+.+++....|.+.   +..++       +.=+++...++...  +.|.|.|-||     |+    
T Consensus       160 DVGLvGfPNAGKSTLLs~~S~AkPKiAd---YPFTT-------L~P~LGvv~~~~~~Y~~~fviADIPGLIEGAs~G~GL  229 (296)
T TIGR02729       160 DVGLVGFPNAGKSTLLSAISNAKPKIAD---YPFTT-------LEPNLGVVRVDDNKYERSFVIADIPGLIEGASEGKGL  229 (296)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEECC---CCCCC-------CCCCEEEEEECCCCEEEEEEEEECCCCHHHHHCCCCC
T ss_conf             0210357887468888887627882238---78745-------6531128987487416889998568615666268875


Q ss_pred             --HHHHHHHHHHHCCCCEEEEECCCCC-----CCCCHHHHHH-HHHH-------CCCCCEEEEECCCCCC
Q ss_conf             --2467798774002331452012344-----3321067788-8863-------1876023310023335
Q gi|254780263|r   83 --DYVKNMITGATQADGAILVCAAEDG-----PKPQTREHIL-LARQ-------IGISSIVVYMNKVDAV  137 (392)
Q Consensus        83 --~f~~~mi~g~~~~D~ailvVda~~G-----~~~QT~eh~~-l~~~-------lgi~~iIv~iNKmD~v  137 (392)
                        +|+|...|    +-.-+.|||++.-     ...--.+.+. |.+.       |--++-||++||||+.
T Consensus       230 G~~FLKHIER----t~~L~hviD~~~~qlSkh~~~~p~~~y~~l~~EL~~Y~~~L~~k~~~iv~NK~Dl~  295 (296)
T TIGR02729       230 GHKFLKHIER----TRLLLHVIDASGIQLSKHDGRDPIEDYETLRNELELYSPELADKPQIIVLNKIDLL  295 (296)
T ss_pred             CHHHHHHHHH----EEEEEEEEECCCCEEEECCCCCHHHHHHHHHHHHHHCCHHHCCCCEEEEEEECCCC
T ss_conf             3355457520----26688798068753424289888999999999997508736278079998606778


No 168
>pfam03144 GTP_EFTU_D2 Elongation factor Tu domain 2. Elongation factor Tu consists of three structural domains, this is the second domain. This domain adopts a beta barrel structure. This the second domain is involved in binding to charged tRNA. This domain is also found in other proteins such as elongation factor G and translation initiation factor IF-2. This domain is structurally related to pfam03143, and in fact has weak sequence matches to this domain.
Probab=98.97  E-value=4e-10  Score=81.82  Aligned_cols=70  Identities=40%  Similarity=0.639  Sum_probs=62.6

Q ss_pred             CCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEE
Q ss_conf             54301487424534896799950687432125412100121144321001366641124543220211773
Q gi|254780263|r  222 GTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVC  292 (392)
Q Consensus       222 G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~  292 (392)
                      |++++|||+||+|++||++.++|. +.....+|++|++++...+++.+|+.+++.+.+.+..|+++||+|+
T Consensus         1 G~v~~grv~~G~lk~gd~v~~~~~-~~~~~~kV~~l~~~~~~~~~~~~g~~~g~iv~~~~~~~i~~Gdti~   70 (70)
T pfam03144         1 GTVATGRVESGTLKKGDKVVIGPN-GTGKKGRVTSLEMFHGDLREAVAGANAGIILAGIGLKDIKRGDTLT   70 (70)
T ss_pred             CEEEEEEEEECEEECCCEEEEECC-CCCCCEEEEEEEEECCCHHHHHCCCCCEEEEEECCCCCCCCCCEEC
T ss_conf             959999998098965999999369-9622137718999775512211511000378746704572467949


No 169
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=98.97  E-value=3.4e-09  Score=76.07  Aligned_cols=146  Identities=14%  Similarity=0.132  Sum_probs=89.1

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             88279999904689887899999987644420013126868698629206378999821990899984787302467798
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      |+..+|.++|==.|||||++.+|...         ....      ---|+......+.+++..+++-|..|+..|-.-=-
T Consensus        15 ~ke~~ililGLd~aGKTTil~~lk~~---------~~~~------~~PT~g~~~e~~~~~~~~~~~wDlgG~~~~R~lW~   79 (184)
T smart00178       15 NKHAKILFLGLDNAGKTTLLHMLKND---------RLAQ------HQPTQHPTSEELAIGNIKFTTFDLGGHQQARRLWK   79 (184)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCC---------CCCC------CCCCCCCCEEEEEECCEEEEEEECCCCHHHHHHHH
T ss_conf             66147999965889889999998069---------9753------05787886489999999999998898777889999


Q ss_pred             HHHHCCCCEEEEECCCCC-CCCCHHHHHHHH----HHCCCCCEEEEECCCCCCC---CHHHHHHCCCCCCEEEEEEEE--
Q ss_conf             774002331452012344-332106778888----6318760233100233356---122211012321001110145--
Q gi|254780263|r   90 TGATQADGAILVCAAEDG-PKPQTREHILLA----RQIGISSIVVYMNKVDAVD---DDELLDISEYEIRDLLKEHKY--  159 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G-~~~QT~eh~~l~----~~lgi~~iIv~iNKmD~v~---~~~~~~~i~~~i~~~l~~~~~--  159 (392)
                      .=...+|+.|+|||+++- -+.+.++.+.-+    ...++| +.|+.||.|+.+   .++..+..  .+.++......  
T Consensus        80 ~Yy~~~~~iIfVVDssD~~r~~eak~~L~~ll~~~~l~~~P-lLilaNKqDl~~a~~~~ei~~~L--~L~~~~~~~~~~~  156 (184)
T smart00178       80 DYFPEVNGIVYLVDAYDKERFAESKRELDALLSDEELATVP-FLILGNKIDAPYAASEDELRYAL--GLTNTTGSKGKVG  156 (184)
T ss_pred             HHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCCHHHHHHHH--CCHHHHCCCCCCC
T ss_conf             88216758999972686889999999999986467655970-99999756777899999999881--9512326557667


Q ss_pred             EEEEECCCCEEEEE
Q ss_conf             32210233114676
Q gi|254780263|r  160 SDDTPIIRGSALCA  173 (392)
Q Consensus       160 ~~~~pii~~sa~~g  173 (392)
                      ...+.+.++||++|
T Consensus       157 ~r~~~i~~~SA~tG  170 (184)
T smart00178      157 VRPLEVFMCSVVRR  170 (184)
T ss_pred             CCCEEEEEEECCCC
T ss_conf             76319997356079


No 170
>PRK12296 obgE GTPase ObgE; Reviewed
Probab=98.96  E-value=2.5e-09  Score=76.88  Aligned_cols=136  Identities=21%  Similarity=0.268  Sum_probs=82.7

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC-----C------
Q ss_conf             79999904689887899999987644420013126868698629206378999821990899984787-----3------
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG-----H------   81 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG-----H------   81 (392)
                      -.++.+|-..+|||||+.+|+....+.+..   ..++       ++=+++..  +.++.+|++.|.||     |      
T Consensus       160 ADVGLvG~PNaGKSTLl~~iS~AkpkIA~Y---pFTT-------L~PnLGvv--~~~d~~f~iADiPGLIeGAs~g~GLG  227 (495)
T PRK12296        160 ADVGLVGFPSAGKSSLISAISAAKPKIADY---PFTT-------LVPNLGVV--SAGDHTFTVADVPGLIPGASEGRGLG  227 (495)
T ss_pred             ECCCEECCCCCCHHHHHHHHHCCCCCCCCC---CCCC-------CCCEEEEE--ECCCCEEEEEECCCCCCCCCCCCCCH
T ss_conf             131101189996158998875488765787---7554-------57546789--70795289985664346500389843


Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCC---CCCCC----HHHHHHHHH------------HCCCCCEEEEECCCCCCCCHHH
Q ss_conf             0246779877400233145201234---43321----067788886------------3187602331002333561222
Q gi|254780263|r   82 ADYVKNMITGATQADGAILVCAAED---GPKPQ----TREHILLAR------------QIGISSIVVYMNKVDAVDDDEL  142 (392)
Q Consensus        82 ~~f~~~mi~g~~~~D~ailvVda~~---G~~~Q----T~eh~~l~~------------~lgi~~iIv~iNKmD~v~~~~~  142 (392)
                      -+|++.+.|    +-+-+.|||+..   |-.|-    +.+.=.-++            ++.-| -||++||||+.+.++.
T Consensus       228 ~~FLRHieR----~~vL~hviD~~~~e~~rDP~~d~~~I~~EL~~Y~~~l~~~~~~~~L~erp-qIVvlNKiDlp~a~e~  302 (495)
T PRK12296        228 LDFLRHIER----CAVLVHVVDCATLEPGRDPISDIDALEAELAAYTPTLQGDAGLGDLAERP-RLVVLNKIDVPDAREL  302 (495)
T ss_pred             HHHHHHHHH----CCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCHHHHCCCCCCCCCCCC-EEEEEECCCCCCHHHH
T ss_conf             999998752----54799999688766678969999999999997191430443323210196-5999966567576999


Q ss_pred             HHHCCCCCCEEEEEEEEEEEEECCCCEEEEE
Q ss_conf             1101232100111014532210233114676
Q gi|254780263|r  143 LDISEYEIRDLLKEHKYSDDTPIIRGSALCA  173 (392)
Q Consensus       143 ~~~i~~~i~~~l~~~~~~~~~pii~~sa~~g  173 (392)
                      .+.++.    .|++.    ..|++++||+++
T Consensus       303 ~e~~~~----~l~~~----g~~Vf~ISA~t~  325 (495)
T PRK12296        303 AEFVRP----ELEER----GWPVFEVSTVTR  325 (495)
T ss_pred             HHHHHH----HHHHC----CCCEEEEECCCC
T ss_conf             999999----99874----995799864100


No 171
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily.  Arl4 (Arf-like 4) is highly expressed in testicular germ cells, and is found in the nucleus and nucleolus.  In mice, Arl4 is developmentally expressed during embryogenesis, and a role in somite formation and central nervous system differentiation has been proposed.  Arl7 has been identified as the only Arf/Arl protein to be induced by agonists of liver X-receptor and retinoid X-receptor and by cholesterol loading in human macrophages.  Arl7 is proposed to play a role in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway.  Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily.
Probab=98.96  E-value=2e-09  Score=77.51  Aligned_cols=144  Identities=17%  Similarity=0.142  Sum_probs=79.4

Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE--EE---ECCCEEEEEEECCCCHHHHH
Q ss_conf             27999990468988789999998764442001312686869862920637899--98---21990899984787302467
Q gi|254780263|r   12 SLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV--SY---ETDKRFYSHIDCPGHADYVK   86 (392)
Q Consensus        12 ~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~--~~---~~~~~~i~iiD~PGH~~f~~   86 (392)
                      .++|+++|--.+|||||+.++....        ..+.       --|+-..+.  .+   ..+...+.|-||+|++.|-.
T Consensus         3 ~~kIvilG~~~~GKTsil~r~~~~~--------f~~~-------~pTiG~~~~~~~~~~~~~~~v~l~iwDtaGqe~~r~   67 (183)
T cd04152           3 SLHIVMLGLDSAGKTTVLYRLKFNE--------FVNT-------VPTKGFNTEKIKVSLGNSKGITFHFWDVGGQEKLRP   67 (183)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCC--------CCCC-------CCCCCEEEEEEEEECCCCCEEEEEEEECCCCCCCCE
T ss_conf             7999999999998899999996498--------6776-------870355789999961678667999997898734510


Q ss_pred             HHHHHHHCCCCEEEEECCCCC-CCCCHHHHHH-HH---HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             798774002331452012344-3321067788-88---631876023310023335612221101232100111014532
Q gi|254780263|r   87 NMITGATQADGAILVCAAEDG-PKPQTREHIL-LA---RQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        87 ~mi~g~~~~D~ailvVda~~G-~~~QT~eh~~-l~---~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      -.-.=...+|++|+|+|+++- -+.+.++.+. +.   ...++| ++++-||.|+.+.-. .++++..+.  +.+.....
T Consensus        68 l~~~Y~r~a~g~i~V~D~td~~~~~~~~~~l~~~~~~~~~~~~p-iliv~NK~Dl~~~~~-~~ei~~~l~--l~~~~~~~  143 (183)
T cd04152          68 LWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRFSENQGVP-VLVLANKQDLPNALS-VSEVEKLLA--LHELSAST  143 (183)
T ss_pred             EHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCE-EEEEEECCCCCCCCC-HHHHHHHHH--HHHHHCCC
T ss_conf             08767467867899996776889999999999997321237962-999986677766878-899999971--99986669


Q ss_pred             EEECCCCEEEEEE
Q ss_conf             2102331146764
Q gi|254780263|r  162 DTPIIRGSALCAL  174 (392)
Q Consensus       162 ~~pii~~sa~~g~  174 (392)
                      .+.+.++||.+|-
T Consensus       144 ~~~i~~tSA~tG~  156 (183)
T cd04152         144 PWHVQPACAIIGE  156 (183)
T ss_pred             CCEEEEEECCCCC
T ss_conf             9899972799796


No 172
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=98.96  E-value=2.8e-09  Score=76.63  Aligned_cols=153  Identities=19%  Similarity=0.211  Sum_probs=86.3

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE--EEEECC--CEEEEEEECCCCHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789--998219--9089998478730246779
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH--VSYETD--KRFYSHIDCPGHADYVKNM   88 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~--~~~~~~--~~~i~iiD~PGH~~f~~~m   88 (392)
                      +.|+++|.-..|||+|+.++...            ...++..  -||...+  ..+..+  ..++.|.||+|++.|-.-.
T Consensus         2 ~KivviGd~~vGKTsli~r~~~~------------~f~~~~~--~Tig~~~~~k~i~~~~~~v~l~iwDtaG~e~~~~~~   67 (163)
T cd01860           2 FKLVLLGDSSVGKSSLVLRFVKN------------EFSENQE--STIGAAFLTQTVNLDDTTVKFEIWDTAGQERYRSLA   67 (163)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHC------------CCCCCCC--CCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHHH
T ss_conf             79999995996899999999439------------8999868--866678899999999999999999799971002788


Q ss_pred             HHHHHCCCCEEEEECCCCCCC-CCHHHHHHHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             877400233145201234433-2106778888631---876023310023335612221101232100111014532210
Q gi|254780263|r   89 ITGATQADGAILVCAAEDGPK-PQTREHILLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G~~-~QT~eh~~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                      -.-...+|+++||.|.+.-.. ...+.-+.-++..   .++ ++++-||+|+.+..+   ...++.+++.++.    +.+
T Consensus        68 ~~~~~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~~~-iilVgnK~DL~~~r~---V~~~e~~~~a~~~----~~~  139 (163)
T cd01860          68 PMYYRGAAAAIVVYDITSEESFEKAKSWVKELQRNASPNII-IALVGNKADLESKRQ---VSTEEAQEYADEN----GLL  139 (163)
T ss_pred             HHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCHHHCCC---CCHHHHHHHHHHC----CCE
T ss_conf             98851677149998189979999999999999985598723-677553357565089---9999999999982----997


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCC
Q ss_conf             233114676411444565212332034431025
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTHI  197 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~  197 (392)
                      ++.+||.+|.          ++..+++.|...+
T Consensus       140 ~~E~SAk~~~----------nV~e~F~~l~~~i  162 (163)
T cd01860         140 FFETSAKTGE----------NVNELFTEIAKKL  162 (163)
T ss_pred             EEEECCCCCC----------CHHHHHHHHHHHC
T ss_conf             9998626590----------7899999999858


No 173
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]
Probab=98.96  E-value=9.3e-09  Score=73.38  Aligned_cols=113  Identities=19%  Similarity=0.322  Sum_probs=92.2

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             88279999904689887899999987644420013126868698629206378999821990899984787302467798
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      -|.+-+|++|-...|||||+..|.+.+.+.-.         .|..--||+-      ..+.++|||+.||   +=+-.||
T Consensus        67 PPPfIvavvGPpGtGKsTLirSlVrr~tk~ti---------~~i~GPiTvv------sgK~RRiTflEcp---~Dl~~mi  128 (1077)
T COG5192          67 PPPFIVAVVGPPGTGKSTLIRSLVRRFTKQTI---------DEIRGPITVV------SGKTRRITFLECP---SDLHQMI  128 (1077)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHH---------HCCCCCEEEE------ECCEEEEEEEECH---HHHHHHH
T ss_conf             99758996369988746899999999877542---------0367864786------1563578988671---7888887


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH
Q ss_conf             774002331452012344332106778888631876023310023335612
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDD  140 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~  140 (392)
                      .-+..||.+||+||+.-|.+-.|.|.+.++...|.|.+..+++..|+-..+
T Consensus       129 DvaKIaDLVlLlIdgnfGfEMETmEFLnil~~HGmPrvlgV~ThlDlfk~~  179 (1077)
T COG5192         129 DVAKIADLVLLLIDGNFGFEMETMEFLNILISHGMPRVLGVVTHLDLFKNP  179 (1077)
T ss_pred             HHHHHHHEEEEEECCCCCCEEHHHHHHHHHHHCCCCCEEEEEEECCCCCCH
T ss_conf             688752135788636667042488999998664897247888621133583


No 174
>KOG1191 consensus
Probab=98.95  E-value=4.7e-09  Score=75.21  Aligned_cols=121  Identities=19%  Similarity=0.222  Sum_probs=85.3

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHH---
Q ss_conf             03882799999046898878999999876444200131268686986292063789998219908999847873024---
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADY---   84 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f---   84 (392)
                      .-|.-++||++|-.+.|||||+.+|++.-....           --+-|-|.|+--+.|+.+++.+.++||.|-+.=   
T Consensus       264 ~lq~gl~iaIvGrPNvGKSSLlNaL~~~drsIV-----------Spv~GTTRDaiea~v~~~G~~v~L~DTAGiRe~~~~  332 (531)
T KOG1191         264 RLQSGLQIAIVGRPNVGKSSLLNALSREDRSIV-----------SPVPGTTRDAIEAQVTVNGVPVRLSDTAGIREESND  332 (531)
T ss_pred             HHHCCCEEEEECCCCCCHHHHHHHHHCCCCEEE-----------CCCCCCCHHHHEEEEECCCEEEEEEECCCCCCCCCC
T ss_conf             763577289976998778899988750774476-----------789996410012276308758999734131002687


Q ss_pred             HHHHH------HHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCC-----------CCEEEEECCCCCCCC
Q ss_conf             67798------77400233145201234433210677888863187-----------602331002333561
Q gi|254780263|r   85 VKNMI------TGATQADGAILVCAAEDGPKPQTREHILLARQIGI-----------SSIVVYMNKVDAVDD  139 (392)
Q Consensus        85 ~~~mi------~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi-----------~~iIv~iNKmD~v~~  139 (392)
                      ..+++      ..+-++|..++||||.++.+.+--....++...+.           .++|.++||.|++.+
T Consensus       333 ~iE~~gI~rA~k~~~~advi~~vvda~~~~t~sd~~i~~~l~~~~~g~~~~~~~~~~~~~i~~~nk~D~~s~  404 (531)
T KOG1191         333 GIEALGIERARKRIERADVILLVVDAEESDTESDLKIARILETEGVGLVVIVNKMEKQRIILVANKSDLVSK  404 (531)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCEEEEECHHHCCCC
T ss_conf             067776899998876547799996330033325328999988742555897044434623788610221576


No 175
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=98.95  E-value=2.4e-09  Score=77.05  Aligned_cols=139  Identities=13%  Similarity=0.085  Sum_probs=85.8

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHHC
Q ss_conf             99990468988789999998764442001312686869862920637899982199089998478730246779877400
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQ   94 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~~   94 (392)
                      |.++|--.+||||++.+|....-        .+.       --|+-.....+++++..+++-|++|++.|-.-.-.=...
T Consensus         2 IlilGl~~sGKTtil~~l~~~~~--------~~~-------~pT~G~~~~~i~~~~~~l~iwD~gG~~~~r~~w~~Yy~~   66 (169)
T cd04158           2 VVTLGLDGAGKTTILFKLKQDEF--------MQP-------IPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLN   66 (169)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCC--------CCC-------CCCCCCCEEEEEECCEEEEEEECCCCCCCCHHHHHHCCC
T ss_conf             99999899988999999957996--------897-------786881669999898899999899972446367875557


Q ss_pred             CCCEEEEECCCC-CCCCCHHHHHHH----HHHCCCCCEEEEECCCCCCCCHHHHHHCCC--CCCEEEEEEEEEEEEECCC
Q ss_conf             233145201234-433210677888----863187602331002333561222110123--2100111014532210233
Q gi|254780263|r   95 ADGAILVCAAED-GPKPQTREHILL----ARQIGISSIVVYMNKVDAVDDDELLDISEY--EIRDLLKEHKYSDDTPIIR  167 (392)
Q Consensus        95 ~D~ailvVda~~-G~~~QT~eh~~l----~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~--~i~~~l~~~~~~~~~pii~  167 (392)
                      +|++++|||+++ .-+...++.+.-    ....++| ++++.||.|+.+.-. .+++.+  .+.++.    -...+.+.+
T Consensus        67 ~~~iIfVvDssd~~~~~ea~~~l~~ll~~~~~~~~p-iLIlaNK~Dl~~~~~-~~ei~~~l~l~~~~----~~~~~~i~~  140 (169)
T cd04158          67 TQAVVFVVDSSHRDRVSEAHSELAKLLTEKELRDAL-LLIFANKQDVAGALS-VEEMTELLSLHKLC----CGRSWYIQG  140 (169)
T ss_pred             CCEEEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCE-EEEEEECCCCCCCCC-HHHHHHHHCCHHHC----CCCCEEEEE
T ss_conf             627999998630677999999999997127537984-999973556777989-99999985705452----699629995


Q ss_pred             CEEEEEE
Q ss_conf             1146764
Q gi|254780263|r  168 GSALCAL  174 (392)
Q Consensus       168 ~sa~~g~  174 (392)
                      +||.+|.
T Consensus       141 ~SA~tG~  147 (169)
T cd04158         141 CDARSGM  147 (169)
T ss_pred             EECCCCC
T ss_conf             5572795


No 176
>KOG1423 consensus
Probab=98.95  E-value=3.5e-09  Score=75.98  Aligned_cols=117  Identities=24%  Similarity=0.290  Sum_probs=75.8

Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC------CH
Q ss_conf             388279999904689887899999987644420013126868698629206378999821990899984787------30
Q gi|254780263|r    9 NKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG------HA   82 (392)
Q Consensus         9 ~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG------H~   82 (392)
                      .+.-+++|+||-.++|||||+..+.+.  +..-...+++++.++         ...-+..+...+-|.||||      |+
T Consensus        69 ~~k~L~vavIG~PNvGKStLtN~mig~--kv~~vS~K~~TTr~~---------ilgi~ts~eTQlvf~DTPGlvs~~~~r  137 (379)
T KOG1423          69 AQKSLYVAVIGAPNVGKSTLTNQMIGQ--KVSAVSRKVHTTRHR---------ILGIITSGETQLVFYDTPGLVSKKMHR  137 (379)
T ss_pred             CCEEEEEEEECCCCCCHHHHHHHHHCC--CCCCCCCCCCCEEEE---------EEEEEECCCEEEEEECCCCCCCCCHHH
T ss_conf             115789999708976545544576487--212011566530201---------357871596589996487645334135


Q ss_pred             H------HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHH----HHHCCCCCEEEEECCCCCCCCH
Q ss_conf             2------46779877400233145201234433210677888----8631876023310023335612
Q gi|254780263|r   83 D------YVKNMITGATQADGAILVCAAEDGPKPQTREHILL----ARQIGISSIVVYMNKVDAVDDD  140 (392)
Q Consensus        83 ~------f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l----~~~lgi~~iIv~iNKmD~v~~~  140 (392)
                      .      |+-+--+++-.||..++|+||..   +-+.-|-.+    -....+|.+ .++||+|.....
T Consensus       138 ~~~l~~s~lq~~~~a~q~AD~vvVv~Das~---tr~~l~p~vl~~l~~ys~ips~-lvmnkid~~k~k  201 (379)
T KOG1423         138 RHHLMMSVLQNPRDAAQNADCVVVVVDASA---TRTPLHPRVLHMLEEYSKIPSI-LVMNKIDKLKQK  201 (379)
T ss_pred             HHHHHHHHHHCHHHHHHHCCEEEEEEECCC---CCCCCCHHHHHHHHHHHCCCCE-EECCCHHCCHHH
T ss_conf             678888765378988863887999985567---7675680787778998618720-330400022146


No 177
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta).  SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane.  Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP.  SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane.  The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane.  SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon.  High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ
Probab=98.94  E-value=4.7e-09  Score=75.19  Aligned_cols=126  Identities=20%  Similarity=0.273  Sum_probs=75.2

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEE--ECCCEEEEEEECCCCHHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789998--2199089998478730246779877
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSY--ETDKRFYSHIDCPGHADYVKNMITG   91 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~--~~~~~~i~iiD~PGH~~f~~~mi~g   91 (392)
                      .|.++|=-+||||||.-.|......  ..   ..        -++-+.++...  ...++.++++|+|||..+-..+..-
T Consensus         2 tvLl~Gl~~aGKT~Lf~~L~~~~~~--~T---~t--------S~~~n~~~~~~~~~~~~~~~~lvD~PGH~klR~~~~~~   68 (203)
T cd04105           2 TVLLLGPSDSGKTALFTKLTTGKYR--ST---VT--------SIEPNVATFILNSEGKGKKFRLVDVPGHPKLRDKLLET   68 (203)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCC--CC---CC--------CCCCCCEEEECCCCCCCCEEEEEECCCCHHHHHHHHHH
T ss_conf             5999907999899999999749988--87---78--------88786206640246687279999879968899999999


Q ss_pred             HH-CCCCEEEEECCCCC--CCCCHHHHHHH-H---HH--CCCCCEEEEECCCCCCCC---HHHHHHCCCCCCEE
Q ss_conf             40-02331452012344--33210677888-8---63--187602331002333561---22211012321001
Q gi|254780263|r   92 AT-QADGAILVCAAEDG--PKPQTREHILL-A---RQ--IGISSIVVYMNKVDAVDD---DELLDISEYEIRDL  153 (392)
Q Consensus        92 ~~-~~D~ailvVda~~G--~~~QT~eh~~l-~---~~--lgi~~iIv~iNKmD~v~~---~~~~~~i~~~i~~~  153 (392)
                      .. .+++.++||||.+=  -...+.|.|.- +   ..  -++| +.|+.||+|+...   +...+..+.|+..+
T Consensus        69 ~~~~~~gIVfvVDs~~~~~~l~~~Ae~Ly~iL~~~~~~~~~iP-vLIacNKqDl~tA~~~~~Ik~~LE~Ei~~l  141 (203)
T cd04105          69 LKNSAKGIVFVVDSATFQKNLKDVAEFLYDILTDLEKVKNKIP-VLIACNKQDLFTAKPAKKIKEQLEKELNTL  141 (203)
T ss_pred             HHHCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCC-EEEEEECCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             8754989999996887511199999999999862664368998-899986614345789999999999999999


No 178
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins. Elongation factor Tu consists of three structural domains, this family represents the second domain. Domain II adopts a beta barrel structure and is involved in binding to charged tRNA. Domain II is found in other proteins such as elongation factor G and translation initiation factor IF-2. This group also includes the C2 subdomain of domain IV of IF-2 that has the same fold as domain II of (EF-Tu). Like IF-2 from certain prokaryotes such as Thermus thermophilus, mitochondrial IF-2 lacks domain II, which is thought  to be involved in binding of E.coli IF-2 to 30S subunits.
Probab=98.94  E-value=4.7e-10  Score=81.43  Aligned_cols=83  Identities=31%  Similarity=0.485  Sum_probs=73.1

Q ss_pred             CCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEC
Q ss_conf             10000000135544543014874245348967999506874321254121001211443210013666411245432202
Q gi|254780263|r  208 FLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPR  287 (392)
Q Consensus       208 ~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~r  287 (392)
                      ++++|.++|.+++.|++++|||.+|++++|+.+.+.|. ......++.+|+.++.+++++.||+.+++.+...  .++++
T Consensus         1 ~~~~v~~~~~~~~~g~v~~~rv~~G~l~~g~~v~~~~~-~~~~~~~v~~i~~~~~~~~~~~aG~~~~~~~~~~--~~~~~   77 (83)
T cd01342           1 LRALVFKVFKDKGRGTVATGRVESGTLKKGDKVRVGPG-GGGVKGKVKSLKRFKGEVDEAVAGDIVGIVLKDK--DDIKI   77 (83)
T ss_pred             CEEEEEEEEEECCCEEEEEEEECCCEEECCCEEEEECC-CCCEEEEEEEEEEECCCCCEECCCCEEEEEECCH--HHCCC
T ss_conf             91299999991896899999993429989999999709-9638999989999223777984898999997163--53479


Q ss_pred             HHEEEC
Q ss_conf             117732
Q gi|254780263|r  288 GRVVCA  293 (392)
Q Consensus       288 Gdvl~~  293 (392)
                      ||+++.
T Consensus        78 gd~~~~   83 (83)
T cd01342          78 GDTLTD   83 (83)
T ss_pred             CCEECC
T ss_conf             989829


No 179
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=98.94  E-value=1.1e-09  Score=79.06  Aligned_cols=142  Identities=22%  Similarity=0.156  Sum_probs=82.4

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHC--CCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHH
Q ss_conf             999990468988789999998764442001312686869862--920637899982199089998478730246779877
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLR--GITIATAHVSYETDKRFYSHIDCPGHADYVKNMITG   91 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~r--GiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g   91 (392)
                      .|+++|.-..|||+|+.++....            ..++...  |.+........+.....+.|.|+||+++|-.-.-.-
T Consensus         2 Ki~vvG~~~vGKTsli~r~~~~~------------f~~~~~~ti~~~~~~k~i~~~~~~~~l~iwDt~G~~~~~~~~~~~   69 (162)
T cd04123           2 KVVLLGEGRVGKTSLVLRYVENK------------FNEKHESTTQASFFQKTVNIGGKRIDLAIWDTAGQERYHALGPIY   69 (162)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCC------------CCCCCCCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCCCCHHH
T ss_conf             89999999967999999998398------------998767752647999999999999999999589973035563133


Q ss_pred             HHCCCCEEEEECCCCCCCCCHHHHH--HHHHH--CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCC
Q ss_conf             4002331452012344332106778--88863--1876023310023335612221101232100111014532210233
Q gi|254780263|r   92 ATQADGAILVCAAEDGPKPQTREHI--LLARQ--IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIR  167 (392)
Q Consensus        92 ~~~~D~ailvVda~~G~~~QT~eh~--~l~~~--lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~  167 (392)
                      ...+|+.+||.|.+.-..-+.-+.+  .+.+.  -.+| +|++-||.|+.+..+   ...++..++.++.    +.+++.
T Consensus        70 ~~~a~~~ilv~d~t~~~Sf~~i~~~~~~i~~~~~~~~~-iilvgnK~Dl~~~r~---v~~~e~~~~a~~~----~~~y~e  141 (162)
T cd04123          70 YRDADGAILVYDITDADSFQKVKKWIKELKQMRGNNIS-LVIVGNKIDLERQRV---VSKSEAEEYAKSV----GAKHFE  141 (162)
T ss_pred             EECCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCC-EEEECCCCCCHHHCC---CCHHHHHHHHHHC----CCEEEE
T ss_conf             01144579996389989999999999999987699974-686633213254088---8999999999982----998999


Q ss_pred             CEEEEEEE
Q ss_conf             11467641
Q gi|254780263|r  168 GSALCALQ  175 (392)
Q Consensus       168 ~sa~~g~~  175 (392)
                      +||.+|.+
T Consensus       142 ~Sak~g~n  149 (162)
T cd04123         142 TSAKTGKG  149 (162)
T ss_pred             EECCCCCC
T ss_conf             81278819


No 180
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=98.93  E-value=2.6e-09  Score=76.78  Aligned_cols=142  Identities=20%  Similarity=0.222  Sum_probs=81.3

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC--CCEEEEEEECCCCHHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378999821--9908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET--DKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~--~~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.++++|.-..|||+|+.++...            ..+++-..-+.++.....+..  ....+.|.||||+++|-.-.-.
T Consensus         1 ~Ki~vvG~~~vGKTsli~r~~~~------------~f~~~~~~Ti~~~~~~~~i~~~~~~~~l~iwDt~G~e~~~~l~~~   68 (164)
T smart00175        1 FKIILIGDSGVGKSSLLSRFTDG------------KFSEQYKSTIGVDFKTKTIEVDGKRVKLQIWDTAGQERFRSITSS   68 (164)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHH
T ss_conf             98999998997799999999419------------999986884566667799999999999999967994466477998


Q ss_pred             HHHCCCCEEEEECCCCCCC-CCHHHHHHHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             7400233145201234433-2106778888631---87602331002333561222110123210011101453221023
Q gi|254780263|r   91 GATQADGAILVCAAEDGPK-PQTREHILLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~-~QT~eh~~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
                      -...+|+++||.|.++-.. ....+-+..++..   ++| ++++-||+|+.+..+   ...++..++.++.    +.+++
T Consensus        69 ~~~~~~~~ilvfdi~~~~Sf~~i~~w~~~i~~~~~~~~p-iilvgnK~Dl~~~r~---V~~~e~~~~a~~~----~~~~~  140 (164)
T smart00175       69 YYRGAVGALLVYDITNRESFENLKNWLKELREYADPNVV-IMLVGNKSDLEDQRQ---VSREEAEAFAEEH----GLPFF  140 (164)
T ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCC-EEECCCCCCHHHHCC---CCHHHHHHHHHHC----CCEEE
T ss_conf             833665368843689989999999999999986799982-551164568565187---9999999999984----99799


Q ss_pred             CCEEEEEE
Q ss_conf             31146764
Q gi|254780263|r  167 RGSALCAL  174 (392)
Q Consensus       167 ~~sa~~g~  174 (392)
                      .+||.+|.
T Consensus       141 e~SAk~~~  148 (164)
T smart00175      141 ETSAKTNT  148 (164)
T ss_pred             EECCCCCC
T ss_conf             98316690


No 181
>PRK12297 obgE GTPase ObgE; Reviewed
Probab=98.91  E-value=7e-09  Score=74.15  Aligned_cols=135  Identities=19%  Similarity=0.243  Sum_probs=80.2

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC-----C------H
Q ss_conf             9999904689887899999987644420013126868698629206378999821990899984787-----3------0
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG-----H------A   82 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG-----H------~   82 (392)
                      .|+++|-..+|||||+.+|+....+.+..   ..++       ++=+++...+. +.+.+.+.|.||     |      -
T Consensus       160 DVGLvG~PNaGKSTll~~is~A~pkIa~Y---pFTT-------l~P~lGvv~~~-~~~~~~iADiPGLIeGA~~g~GLG~  228 (429)
T PRK12297        160 DVGLVGFPNVGKSTLLSVVSNAKPKIANY---HFTT-------LVPNLGVVETD-DGRSFVMADLPGLIEGASEGVGLGH  228 (429)
T ss_pred             CCCEEECCCCCHHHHHHHHHCCCCCCCCC---CCCC-------CCCEEEEEEEC-CCCEEEEEECCCCCCCCCCCCCCCH
T ss_conf             76336479984578998875489755787---7402-------57666689856-9866999626745677446888668


Q ss_pred             HHHHHHHHHHHCCCCEEEEECCC--CCCCCC----HHH-HHH--HHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEE
Q ss_conf             24677987740023314520123--443321----067-788--886318760233100233356122211012321001
Q gi|254780263|r   83 DYVKNMITGATQADGAILVCAAE--DGPKPQ----TRE-HIL--LARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDL  153 (392)
Q Consensus        83 ~f~~~mi~g~~~~D~ailvVda~--~G~~~Q----T~e-h~~--l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~  153 (392)
                      +|++.+.|    +..-+.|||++  ++-.|.    +.+ -+.  -..++.-| -||++||||+.+.++.++..++    .
T Consensus       229 ~FLrHieR----~~~L~hviD~s~~~~~dp~~d~~~i~~EL~~y~~~L~~kp-~ivv~NK~Dl~~~~~~~~~~~~----~  299 (429)
T PRK12297        229 QFLRHIER----TRVIVHVIDMSGSEGRDPIEDYETINKELKKYNLRLLERP-QIIVANKMDLPEAEENLEEFKE----K  299 (429)
T ss_pred             HHHHHHHH----CCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCHHHHCCC-EEEEEECCCCCCHHHHHHHHHH----H
T ss_conf             88887662----4679999978787777989999999999998689872696-6999976458576999999999----7


Q ss_pred             EEEEEEEEEEECCCCEEEEE
Q ss_conf             11014532210233114676
Q gi|254780263|r  154 LKEHKYSDDTPIIRGSALCA  173 (392)
Q Consensus       154 l~~~~~~~~~pii~~sa~~g  173 (392)
                      +..     ..+++++||+++
T Consensus       300 ~~~-----~~~i~~iSa~t~  314 (429)
T PRK12297        300 LAK-----GKKVFPISALTK  314 (429)
T ss_pred             HHC-----CCCEEEEECCCC
T ss_conf             534-----697899968445


No 182
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=98.90  E-value=2.6e-09  Score=76.83  Aligned_cols=141  Identities=19%  Similarity=0.197  Sum_probs=81.4

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC--CEEEEEEECCCCHHHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789998219--908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD--KRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~--~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.|+++|.-..|||+|+.++...            ...++-..-+-.+.....+..+  ...+.|.||+|+++|-.-.-.
T Consensus         1 ~KivlvGd~~VGKTsli~r~~~~------------~f~~~y~~Tig~d~~~k~i~~~~~~~~l~iwDtaG~e~~~~l~~~   68 (172)
T cd01862           1 LKVIILGDSGVGKTSLMNQYVNK------------KFSNQYKATIGADFLTKEVTVDDKLVTLQIWDTAGQERFQSLGVA   68 (172)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHH
T ss_conf             98999998997899999999529------------889875775551699999999999999999969998311068899


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHHH-----HHHHC------CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE
Q ss_conf             740023314520123443321067788-----88631------8760233100233356122211012321001110145
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHIL-----LARQI------GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY  159 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~~-----l~~~l------gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~  159 (392)
                      -...+|+++||.|.+.   ++|-+.+.     +....      .+| +|++-||+|+.+..+   ...++.+++.+..+ 
T Consensus        69 ~~~~a~~~ilvydvt~---~~Sf~~l~~w~~~~~~~~~~~~~~~~p-iilvgNK~Dl~~~r~---V~~~e~~~~a~~~~-  140 (172)
T cd01862          69 FYRGADCCVLVYDVTN---PKSFESLDSWRDEFLIQASPSDPENFP-FVVLGNKIDLEEKRQ---VSTKKAQQWCQSNG-  140 (172)
T ss_pred             HHHHCCEEEEEECCCC---HHHHHHHHHHHHHHHHHCCCCCCCCCC-EEEEEECCCHHHCCC---CCHHHHHHHHHHCC-
T ss_conf             8652757999933899---899999999999999972767765763-899963368364189---99999999999769-


Q ss_pred             EEEEECCCCEEEEEEE
Q ss_conf             3221023311467641
Q gi|254780263|r  160 SDDTPIIRGSALCALQ  175 (392)
Q Consensus       160 ~~~~pii~~sa~~g~~  175 (392)
                        ..+++.+||.++.+
T Consensus       141 --~~~~~E~SAk~~~n  154 (172)
T cd01862         141 --NIPYFETSAKEAIN  154 (172)
T ss_pred             --CCEEEEECCCCCCC
T ss_conf             --97899975267919


No 183
>cd01893 Miro1 Miro1 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the N-terminal GTPase domain of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=98.90  E-value=5.4e-09  Score=74.81  Aligned_cols=157  Identities=17%  Similarity=0.224  Sum_probs=87.8

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378999821990899984787302467798774
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGA   92 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~   92 (392)
                      +.|+++|.-..|||+|+-++....=.+     .....-+    -.|+.   ..+..+...++|.||+|.++|-.-.-.-.
T Consensus         1 lKiv~vGd~~VGKTsli~r~~~~~F~~-----~~~~t~~----~~~~~---~~~~~~~v~l~i~DtaG~e~~~~~~~~~~   68 (166)
T cd01893           1 VRIVLIGDEGVGKSSLIMSLVSEEFPE-----NVPRVLP----EITIP---ADVTPERVPTTIVDTSSRPQDRANLAAEI   68 (166)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCCC-----CCCCCCC----CEEEE---EEECCEEEEEEEEECCCCCCCCHHHHHHH
T ss_conf             989999999989999999998497888-----7776345----68999---99889099999998998723024579873


Q ss_pred             HCCCCEEEEECCCCCCC-CCHHHH-HHHHHH--CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCC
Q ss_conf             00233145201234433-210677-888863--18760233100233356122211012321001110145322102331
Q gi|254780263|r   93 TQADGAILVCAAEDGPK-PQTREH-ILLARQ--IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRG  168 (392)
Q Consensus        93 ~~~D~ailvVda~~G~~-~QT~eh-~~l~~~--lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~  168 (392)
                      ..+|+++||-|.+.-.. ..-.+. +..++.  -.+| +|++-||+|+.+..+... .+.+...+..+.  ..-.+++.+
T Consensus        69 ~~a~~~ilvydit~~~Sf~~i~~~w~~~i~~~~~~~p-iilvGNK~DL~~~r~~~~-~e~~~~~~~~~~--~~~~~~~Et  144 (166)
T cd01893          69 RKANVICLVYSVDRPSTLERIRTKWLPLIRRLGVKVP-IILVGNKSDLRDGSSQAG-LEEEMLPIMNEF--REIETCVEC  144 (166)
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCCCCCH-HHHHHHHHHHHH--CCCCEEEEE
T ss_conf             6898899997089877899999999999998689996-899998865400250335-889999999973--074889990


Q ss_pred             EEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             146764114445652123320344310
Q gi|254780263|r  169 SALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       169 sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                      ||.+|.+          +..+++++..
T Consensus       145 SAktg~n----------V~e~F~~~~k  161 (166)
T cd01893         145 SAKTLIN----------VSEVFYYAQK  161 (166)
T ss_pred             CCCCCCC----------HHHHHHHHHH
T ss_conf             6588919----------8999999999


No 184
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=98.89  E-value=4.1e-09  Score=75.60  Aligned_cols=144  Identities=17%  Similarity=0.171  Sum_probs=81.7

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCC--EEEEEEECCCCHHHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869862920637899982199--08999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK--RFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~--~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.|+++|-...|||+|+.++....-        .+    +-..-+..+.....+..++  .+++|.|++|+.+|-.-.-.
T Consensus         1 lKivvvG~~~vGKTSLi~r~~~~~f--------~~----~y~pTig~~~~~k~~~~~~~~~~l~iwDt~G~~~~~~~~~~   68 (168)
T cd04119           1 IKVISMGNSGVGKSCIIKRYCEGRF--------VS----KYLPTIGIDYGVKKVSVRNKEVRVNFFDLSGHPEYLEVRNE   68 (168)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCC--------CC----CCCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHH
T ss_conf             9899999599568999999963999--------99----85897655777999999999999999989997647899999


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHH--HHHHH------CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEE
Q ss_conf             74002331452012344332106778--88863------18760233100233356122211012321001110145322
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHI--LLARQ------IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDD  162 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~--~l~~~------lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~  162 (392)
                      -.+.+|++|||.|+++-..=+..+.+  .+.+.      ..-.+++++-||+|+.+....   ..++..++.+..    +
T Consensus        69 ~~~~ad~~ilvydit~~~Sf~~l~~w~~~~~~~~~~~~~~~~~~~ilvgnK~Dl~~~r~v---~~~~~~~~a~~~----~  141 (168)
T cd04119          69 FYKDTQGVLLVYDVTDRQSFEALDSWLKEMKQEGGPHGNMENIVVVVCANKIDLTKHRAV---SEDEGRLWAESK----G  141 (168)
T ss_pred             HHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCCCCCC---CHHHHHHHHHHC----C
T ss_conf             987477889995089744489999999999998245345668629998540344425788---999999999986----9


Q ss_pred             EECCCCEEEEEEE
Q ss_conf             1023311467641
Q gi|254780263|r  163 TPIIRGSALCALQ  175 (392)
Q Consensus       163 ~pii~~sa~~g~~  175 (392)
                      .+++.+||.+|.+
T Consensus       142 ~~~~E~Sak~g~~  154 (168)
T cd04119         142 FKYFETSACTGEG  154 (168)
T ss_pred             CEEEEECCCCCCC
T ss_conf             9899988577908


No 185
>cd04116 Rab9 Rab9 subfamily.  Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47).  Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs.  Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=98.88  E-value=5.3e-09  Score=74.87  Aligned_cols=143  Identities=19%  Similarity=0.170  Sum_probs=82.9

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC--CCEEEEEEECCCCHHHHHH
Q ss_conf             88279999904689887899999987644420013126868698629206378999821--9908999847873024677
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET--DKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~--~~~~i~iiD~PGH~~f~~~   87 (392)
                      .+-+.|+++|.-..|||+|+.++...            ..+++-..-+..+.....++.  ..+.+.|.||||+++|-.-
T Consensus         3 ~~~~KivvlGd~~VGKTsli~r~~~~------------~f~~~~~~Tig~~~~~k~i~~~~~~v~l~iwDtaG~e~~~~l   70 (170)
T cd04116           3 SSLLKVILLGDGGVGKSSLMNRYVTN------------KFDTQLFHTIGVEFLNKDLEVDGHFVTLQIWDTAGQERFRSL   70 (170)
T ss_pred             CEEEEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCCC
T ss_conf             60899999999997899999999739------------899988887607989999999999999999989997243524


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHH-----HHHH------CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEE
Q ss_conf             987740023314520123443321067788-----8863------18760233100233356122211012321001110
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHIL-----LARQ------IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKE  156 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~-----l~~~------lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~  156 (392)
                      .-.-...+|++|||.|.+.-   +|-+.+.     +.+.      -.+| +|++-||+|+-+.+    ...++.+++.++
T Consensus        71 ~~~~~~~a~~~ilvydit~~---~Sf~~~~~w~~~~~~~~~~~~~~~~p-iilvgnK~Dl~~r~----v~~~e~~~~a~~  142 (170)
T cd04116          71 RTPFYRGSDCCLLTFAVDDS---QSFQNLSNWKKEFIYYADVKEPESFP-FVVLGNKNDIPERQ----VSTEEAQAWCRE  142 (170)
T ss_pred             HHHHEECCCEEEEEEECCCH---HHHHHHHHHHHHHHHHHCCCCCCCCE-EEEEECCCHHHHCC----CCHHHHHHHHHH
T ss_conf             17660047733999978887---99999999999999971445788840-99996111130378----899999999998


Q ss_pred             EEEEEEEECCCCEEEEEEE
Q ss_conf             1453221023311467641
Q gi|254780263|r  157 HKYSDDTPIIRGSALCALQ  175 (392)
Q Consensus       157 ~~~~~~~pii~~sa~~g~~  175 (392)
                      .   ...+++.+||.+|.+
T Consensus       143 ~---~~~~~~E~SAk~g~n  158 (170)
T cd04116         143 N---GDYPYFETSAKDATN  158 (170)
T ss_pred             C---CCCEEEEECCCCCCC
T ss_conf             5---997899988888818


No 186
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=98.87  E-value=8e-09  Score=73.79  Aligned_cols=144  Identities=18%  Similarity=0.209  Sum_probs=82.1

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEE--EEEEEC----------CCEEEEEEECCC
Q ss_conf             79999904689887899999987644420013126868698629206378--999821----------990899984787
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATA--HVSYET----------DKRFYSHIDCPG   80 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~--~~~~~~----------~~~~i~iiD~PG   80 (392)
                      +.|+++|.-..|||+|+-++...            ...++-..-+.++..  ...++.          ....+.|.||+|
T Consensus         5 ~KivvvGd~~VGKTsli~r~~~~------------~f~~~y~~Tig~~~~~k~i~~~~~~~~~~~~~~~~v~l~iwDtaG   72 (180)
T cd04127           5 IKFLALGDSGVGKTSFLYQYTDN------------KFNPKFITTVGIDFREKRVVYNSSGPGGTLGRGQRIHLQLWDTAG   72 (180)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCC------------CCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCEEEEEEEECCC
T ss_conf             89999999998889999999619------------589986884322688999998476554445788589999998988


Q ss_pred             CHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCHHHHHHHHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEE
Q ss_conf             30246779877400233145201234433-210677888863---18760233100233356122211012321001110
Q gi|254780263|r   81 HADYVKNMITGATQADGAILVCAAEDGPK-PQTREHILLARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKE  156 (392)
Q Consensus        81 H~~f~~~mi~g~~~~D~ailvVda~~G~~-~QT~eh~~l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~  156 (392)
                      ++.|-.-.-.-...+|++|||.|.+.--. ..-++-+..++.   ..-++++++-||+|+.+..+   ...++.+++.++
T Consensus        73 qe~~~~l~~~~~~~a~~~ilvydit~~~Sf~~l~~w~~~i~~~~~~~~~~iilVGNK~DL~~~r~---V~~~e~~~~a~~  149 (180)
T cd04127          73 QERFRSLTTAFFRDAMGFLLIFDLTNEQSFLNVRNWMSQLQTHAYCENPDIVLCGNKADLEDQRQ---VSEEQAKALADK  149 (180)
T ss_pred             CHHHHHHHHHHHHHHCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHCCC---CCHHHHHHHHHH
T ss_conf             63047888999875436589996898899998999999999854668985787503236675088---899999999998


Q ss_pred             EEEEEEEECCCCEEEEEEE
Q ss_conf             1453221023311467641
Q gi|254780263|r  157 HKYSDDTPIIRGSALCALQ  175 (392)
Q Consensus       157 ~~~~~~~pii~~sa~~g~~  175 (392)
                      .    +.|++.+||.+|.+
T Consensus       150 ~----~~~~~E~SAk~g~n  164 (180)
T cd04127         150 Y----GIPYFETSAATGTN  164 (180)
T ss_pred             C----CCEEEEECCCCCCC
T ss_conf             4----99799980377919


No 187
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily.  Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II.  Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells.  In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine 
Probab=98.87  E-value=1.2e-08  Score=72.61  Aligned_cols=143  Identities=17%  Similarity=0.192  Sum_probs=88.2

Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEE--EEEEEEEC--CCEEEEEEECCCCHHHHHH
Q ss_conf             2799999046898878999999876444200131268686986292063--78999821--9908999847873024677
Q gi|254780263|r   12 SLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA--TAHVSYET--DKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        12 ~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~--~~~~~~~~--~~~~i~iiD~PGH~~f~~~   87 (392)
                      .+.|+++|.-..|||+|+.+++..            ...++-+  -||.  .....++.  ....+.|.||+|.+.|-+.
T Consensus         2 ~~Kiv~lGd~~VGKTsli~r~~~~------------~F~~~~~--~Tig~d~~~k~i~v~~~~v~l~iwDtaG~e~~~~s   67 (170)
T cd04115           2 IFKIIVIGDSNVGKTCLTYRFCAG------------RFPERTE--ATIGVDFRERTVEIDGERIKVQLWDTAGQERFRKS   67 (170)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCC------------CCCCCCC--CCEEEEEEEEEEEECCEEEEEEEEECCCCHHHHHH
T ss_conf             699999997997799999999539------------8899878--86307878999999999999999977885305677


Q ss_pred             HHHH-HHCCCCEEEEECCCCCCCCCHHHHH----HHHHH----CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEE
Q ss_conf             9877-4002331452012344332106778----88863----1876023310023335612221101232100111014
Q gi|254780263|r   88 MITG-ATQADGAILVCAAEDGPKPQTREHI----LLARQ----IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHK  158 (392)
Q Consensus        88 mi~g-~~~~D~ailvVda~~G~~~QT~eh~----~l~~~----lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~  158 (392)
                      |... ...+|++|||.|.+.-   ++-+.+    ..++.    -.+| ++++-||.|+.+.-+   ...++.+++.++. 
T Consensus        68 ~~~~~~~~a~~~ilvydvt~~---~Sf~~~~~w~~~i~~~~~~~~~p-~vlVGNK~DL~~~r~---Vs~~e~~~~a~~~-  139 (170)
T cd04115          68 MVQHYYRNVHAVVFVYDVTNM---ASFHSLPSWIEECEQHSLPNEVP-RILVGNKCDLREQIQ---VPTDLAQRFADAH-  139 (170)
T ss_pred             HHHHHHCCCCEEEEEEECCCH---HHHHHHHHHHHHHHHHCCCCCCC-EEEEEECCCCHHHCC---CCHHHHHHHHHHC-
T ss_conf             789984577357999504747---67999999999999865888997-999999821341178---7999999999977-


Q ss_pred             EEEEEECCCCEEEEEEECCCC
Q ss_conf             532210233114676411444
Q gi|254780263|r  159 YSDDTPIIRGSALCALQGTNK  179 (392)
Q Consensus       159 ~~~~~pii~~sa~~g~~~~n~  179 (392)
                         +.+++.+||..|.++.|.
T Consensus       140 ---~~~~~E~SAK~~~~~~nV  157 (170)
T cd04115         140 ---SMPLFETSAKDPSENDHV  157 (170)
T ss_pred             ---CCEEEEECCCCCCCCCCH
T ss_conf             ---999999888998517088


No 188
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=98.84  E-value=9.7e-09  Score=73.25  Aligned_cols=143  Identities=19%  Similarity=0.184  Sum_probs=82.3

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC--CCEEEEEEECCCCHHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378999821--9908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET--DKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~--~~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.|+++|.-..|||+|+.++...            ...++-..-+.++.....+..  ....+.|.||+|++.|-.-.-.
T Consensus         3 ~Kiv~vGd~~vGKTsli~r~~~~------------~f~~~y~~Tig~~~~~~~i~~~~~~~~l~iwDtaG~e~~~~~~~~   70 (166)
T cd01869           3 FKLLLIGDSGVGKSCLLLRFADD------------TYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSS   70 (166)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHHH
T ss_conf             99999999997899999999439------------999874785440489999999999999999989998234626788


Q ss_pred             HHHCCCCEEEEECCCCCC-CCCHHHHHHHH-H--HCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             740023314520123443-32106778888-6--3187602331002333561222110123210011101453221023
Q gi|254780263|r   91 GATQADGAILVCAAEDGP-KPQTREHILLA-R--QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~-~~QT~eh~~l~-~--~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
                      -...+|++|||.|.+.-. +..-.+-+..+ +  .-.+| +|++-||+|+.+..+   ...++.+++.++.    +.+++
T Consensus        71 ~~~~a~~~ilvfdit~~~Sf~~i~~w~~~i~~~~~~~~~-~ilvgNK~DL~~~r~---v~~~~~~~~a~~~----~~~~~  142 (166)
T cd01869          71 YYRGAHGIIIVYDVTDQESFNNVKQWLQEIDRYASENVN-KLLVGNKCDLTDKRV---VDYSEAQEFADEL----GIPFL  142 (166)
T ss_pred             HHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCC-EEEEEEEECCCCCCC---CCHHHHHHHHHHC----CCEEE
T ss_conf             856326779971179989999999999999986787774-488613201131466---7999999999983----99699


Q ss_pred             CCEEEEEEE
Q ss_conf             311467641
Q gi|254780263|r  167 RGSALCALQ  175 (392)
Q Consensus       167 ~~sa~~g~~  175 (392)
                      .+||.+|.+
T Consensus       143 E~SAk~g~n  151 (166)
T cd01869         143 ETSAKNATN  151 (166)
T ss_pred             EECCCCCCC
T ss_conf             987687806


No 189
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=98.84  E-value=1.2e-08  Score=72.76  Aligned_cols=142  Identities=20%  Similarity=0.231  Sum_probs=84.3

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-EEEC--CCEEEEEEECCCCHHHHHH
Q ss_conf             827999990468988789999998764442001312686869862920637899-9821--9908999847873024677
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-SYET--DKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~~~~--~~~~i~iiD~PGH~~f~~~   87 (392)
                      |+..|+++|.-..|||+|+.+++...            ..+|  .--|+.-.+. ....  ....+.|.||+|+++|-.-
T Consensus         1 pt~Kiv~lGd~~VGKTsli~r~~~~~------------f~~~--y~~Ti~~~~~k~~~~~~~~~~l~iwDtaG~e~~~~~   66 (164)
T cd04145           1 PTYKLVVVGGGGVGKSALTIQFIQSY------------FVTD--YDPTIEDSYTKQCEIDGQWAILDILDTAGQEEFSAM   66 (164)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHCCC------------CCCC--CCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCHH
T ss_conf             93799999999978899999998098------------9875--678413589999999999999999989886031256


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHH--HHHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEE
Q ss_conf             98774002331452012344332106778--88863---18760233100233356122211012321001110145322
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHI--LLARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDD  162 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~--~l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~  162 (392)
                      .-.-...||+++||.|.++-..=+..+.+  .+.+.   -.+| +|++-||+|+.+..+   ...++.+++.++.    +
T Consensus        67 ~~~~~~~a~~~ilvydi~~~~Sf~~~~~~~~~i~~~~~~~~~p-iilVgNK~DL~~~r~---Vs~~e~~~~a~~~----~  138 (164)
T cd04145          67 REQYMRTGEGFLLVFSVTDRGSFEEVDKFHTQILRVKDRDEFP-MILVGNKADLEHQRK---VSREEGQELARKL----K  138 (164)
T ss_pred             HHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCC-EEEECCCCCHHHHCC---CCHHHHHHHHHHC----C
T ss_conf             7987346787468985673543999999999999861887775-265303457354088---9999999999981----9


Q ss_pred             EECCCCEEEEEE
Q ss_conf             102331146764
Q gi|254780263|r  163 TPIIRGSALCAL  174 (392)
Q Consensus       163 ~pii~~sa~~g~  174 (392)
                      .+++.+||..+.
T Consensus       139 ~~~~E~SAk~~~  150 (164)
T cd04145         139 IPYIETSAKDRL  150 (164)
T ss_pred             CEEEEECCCCCC
T ss_conf             989998548682


No 190
>cd04128 Spg1 Spg1p.  Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase.  Spg1p is an essential gene that localizes to the spindle pole bodies.  When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p.  Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p.  The existence of a SIN-related pathway in plants has been proposed.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP.  Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are
Probab=98.84  E-value=1.1e-08  Score=72.94  Aligned_cols=149  Identities=16%  Similarity=0.155  Sum_probs=81.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378999821990899984787302467798774
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGA   92 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~   92 (392)
                      +.|+++|....|||+|+-+.....        ..+.  .+..-|+...............+.|.||+|.+.|-.-.-.-.
T Consensus         1 iKivlvGd~~VGKTsLi~rf~~~~--------F~~~--y~~Tig~d~~~k~i~v~~~~v~l~iwDtaGqe~f~~~~~~y~   70 (182)
T cd04128           1 LKIGLLGDAQIGKTSLMVKYVEGE--------FDED--YIQTLGVNFMEKTISIRGTEITFSIWDLGGQREFINMLPLVC   70 (182)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCC--------CCCC--CCCCCEEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHHHH
T ss_conf             989999999989899999995399--------9999--888733898999999999999999986776487899999986


Q ss_pred             HCCCCEEEEECCCCCCC-CCHHHHHHHHHHC-CCCCEEEEECCCCCCCCH--HHHHHCCCCCCEEEEEEEEEEEEECCCC
Q ss_conf             00233145201234433-2106778888631-876023310023335612--2211012321001110145322102331
Q gi|254780263|r   93 TQADGAILVCAAEDGPK-PQTREHILLARQI-GISSIVVYMNKVDAVDDD--ELLDISEYEIRDLLKEHKYSDDTPIIRG  168 (392)
Q Consensus        93 ~~~D~ailvVda~~G~~-~QT~eh~~l~~~l-gi~~iIv~iNKmD~v~~~--~~~~~i~~~i~~~l~~~~~~~~~pii~~  168 (392)
                      ..|++++||.|.+.-.. ..-++-+..++.. .-...|++-||.|+....  +..+.+..+-.++.++.    +.|++.+
T Consensus        71 ~~a~~~ilvfDit~~~Sf~~~~~w~~~i~~~~~~~~~ilVGnK~DL~~~~~~~~~~~~~~~~~~~a~~~----~~~f~et  146 (182)
T cd04128          71 NDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPILVGTKYDLFADLPPEEQEEITKQARKYAKAM----KAPLIFC  146 (182)
T ss_pred             CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCHHEEHHHHHHHHHHHHC----CCEEEEE
T ss_conf             478789999978998999989999999997689998899998663556556223102489999999984----9989999


Q ss_pred             EEEEEEE
Q ss_conf             1467641
Q gi|254780263|r  169 SALCALQ  175 (392)
Q Consensus       169 sa~~g~~  175 (392)
                      ||.++.+
T Consensus       147 SAk~~~n  153 (182)
T cd04128         147 STSHSIN  153 (182)
T ss_pred             ECCCCCC
T ss_conf             4799979


No 191
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=98.83  E-value=6.6e-09  Score=74.29  Aligned_cols=137  Identities=20%  Similarity=0.226  Sum_probs=83.0

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE---EEEECCCEEEEEEECCCCHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789---998219908999847873024677987
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH---VSYETDKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~---~~~~~~~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      .|+++|....|||+|+.++...            ...++-  --|+...+   .....+...+.|.||+|+++|-.-.-.
T Consensus         2 KvvlvGd~~VGKTsli~r~~~~------------~F~~~y--~pTi~~~~~~~~~~~~~~v~l~iwDtaG~e~~~~l~~~   67 (164)
T cd04139           2 KVIVVGAGGVGKSALTLQFMYD------------EFVEDY--EPTKADSYRKKVVLDGEDVQLNILDTAGQEDYAAIRDN   67 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHHC------------CCCCCC--CCCCCCEEEEEEEECCEEEEEEEEECCCCHHHHHHHHH
T ss_conf             7999999998899999999719------------898774--88544168999999999999999989886624889999


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHH-----HHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEE
Q ss_conf             74002331452012344332106778-----888631---8760233100233356122211012321001110145322
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHI-----LLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDD  162 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~-----~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~  162 (392)
                      -...||+++||.|.+.-   +|-+.+     .+.+..   .+| ++++-||+|+.+..+   ...++.+++.++.    +
T Consensus        68 ~~~~a~~~ilvydvt~~---~Sf~~~~~~~~~~~~~~~~~~~p-iilVgNK~DL~~~r~---v~~~e~~~~a~~~----~  136 (164)
T cd04139          68 YHRSGEGFLLVFSITDM---ESFTATAEFREQILRVKDDDNVP-LLLVGNKCDLEDKRQ---VSSEEAANLARQW----G  136 (164)
T ss_pred             HHHHCCEEEEEEECCCH---HHHHHHHHHHHHHHHHHCCCCCC-EEEEEEEHHHHHCCC---CCHHHHHHHHHHC----C
T ss_conf             88637688999977977---88999999999999860878863-698733032334177---8999999999983----9


Q ss_pred             EECCCCEEEEEEE
Q ss_conf             1023311467641
Q gi|254780263|r  163 TPIIRGSALCALQ  175 (392)
Q Consensus       163 ~pii~~sa~~g~~  175 (392)
                      .+++.+||.+|.+
T Consensus       137 ~~~~E~SAk~g~n  149 (164)
T cd04139         137 VPYVETSAKTRQN  149 (164)
T ss_pred             CEEEEECCCCCCC
T ss_conf             9899982687908


No 192
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2.  Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhi
Probab=98.83  E-value=9e-09  Score=73.45  Aligned_cols=143  Identities=21%  Similarity=0.163  Sum_probs=82.1

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC--CEEEEEEECCCCHHHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789998219--908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD--KRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~--~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.|+++|.-..|||+|+.++...            ...++-..-+.++.....++.+  ...+.|.||+|++.|-.-.-.
T Consensus         4 ~KivlvGd~~vGKTsli~r~~~~------------~f~~~~~~Tig~~~~~k~v~~~~~~i~l~iwDt~G~e~~~~~~~~   71 (167)
T cd01867           4 FKLLLIGDSGVGKSCLLLRFSED------------SFNPSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTA   71 (167)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCHHHHHHH
T ss_conf             99999999997889999999609------------999986898646889999999999999999989997001166799


Q ss_pred             HHHCCCCEEEEECCCCCCC-CCHHHHHHHHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             7400233145201234433-210677888863---187602331002333561222110123210011101453221023
Q gi|254780263|r   91 GATQADGAILVCAAEDGPK-PQTREHILLARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~-~QT~eh~~l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
                      -...+|++|||.|.+.-.. ..-++-+.-++.   -.+| ++++-||.|+.+..+   ...++..++.++.    +.+++
T Consensus        72 y~~~a~~~ilvfdit~~~Sf~~~~~w~~~i~~~~~~~~~-~ilVgNK~Dl~~~r~---v~~~e~~~~a~~~----~~~~~  143 (167)
T cd01867          72 YYRGAMGIILVYDITDEKSFENIRNWMRNIEEHASEDVE-RMLVGNKCDMEEKRV---VSKEEGEALADEY----GIKFL  143 (167)
T ss_pred             HHHHCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCC-EEEECCCCCCHHCCC---CCHHHHHHHHHHH----CCEEE
T ss_conf             856505889955689879999999999999986699970-576421245023077---9999999999980----99699


Q ss_pred             CCEEEEEEE
Q ss_conf             311467641
Q gi|254780263|r  167 RGSALCALQ  175 (392)
Q Consensus       167 ~~sa~~g~~  175 (392)
                      .+||.+|.+
T Consensus       144 e~SAktg~n  152 (167)
T cd01867         144 ETSAKANIN  152 (167)
T ss_pred             EECCCCCCC
T ss_conf             982257907


No 193
>cd00157 Rho Rho (Ras homology) family.  Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop.  There are 22 human Rho family members identified currently.  These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli.  They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase.  These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors).  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho protein
Probab=98.83  E-value=1e-08  Score=73.10  Aligned_cols=145  Identities=20%  Similarity=0.188  Sum_probs=79.9

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE-EEEEEEEECCC--EEEEEEECCCCHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206-37899982199--0899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI-ATAHVSYETDK--RFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi-~~~~~~~~~~~--~~i~iiD~PGH~~f~~~mi   89 (392)
                      +.|+++|....|||+|+.++....            .+++-  --|+ +.-...+..++  ..+.|.||+|+++|-.-.-
T Consensus         1 iKi~llGd~~VGKTsli~r~~~~~------------f~~~y--~~Ti~~~~~~~~~~~~~~~~l~iwDt~G~e~~~~~~~   66 (171)
T cd00157           1 IKIVVVGDGAVGKTCLLISYTTGK------------FPTEY--VPTVFDNYSATVTVDGKQVNLGLWDTAGQEEYDRLRP   66 (171)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCC------------CCCCC--CCEEEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHH
T ss_conf             989999999966999999996299------------99875--8803466689999999999999998998710241322


Q ss_pred             HHHHCCCCEEEEECCCCCC-CCCHHH-HHH-HHHH-CCCCCEEEEECCCCCCCCHHHHH--------HCCCCCCEEEEEE
Q ss_conf             7740023314520123443-321067-788-8863-18760233100233356122211--------0123210011101
Q gi|254780263|r   90 TGATQADGAILVCAAEDGP-KPQTRE-HIL-LARQ-IGISSIVVYMNKVDAVDDDELLD--------ISEYEIRDLLKEH  157 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~-~~QT~e-h~~-l~~~-lgi~~iIv~iNKmD~v~~~~~~~--------~i~~~i~~~l~~~  157 (392)
                      .-...+|++|||.|.++-. +..-++ -+. +-+. -.+| +|++-||+|+.+......        ...++..++.++.
T Consensus        67 ~~~~~a~~~ilvydit~~~Sf~~i~~~w~~~i~~~~~~~p-iilvgNK~DL~~~~~~~~~~~~~~r~V~~~e~~~~a~~~  145 (171)
T cd00157          67 LSYPNTDVFLICFSVDSPSSFENVKTKWIPEIRHYCPNVP-IILVGTKIDLRDDENTLKKLEKGKEPITPEEGEKLAKEI  145 (171)
T ss_pred             HHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHC
T ss_conf             3444265899999689778899999999999998599986-899998710012300022331147515899999999984


Q ss_pred             EEEEEEECCCCEEEEEEE
Q ss_conf             453221023311467641
Q gi|254780263|r  158 KYSDDTPIIRGSALCALQ  175 (392)
Q Consensus       158 ~~~~~~pii~~sa~~g~~  175 (392)
                      +   ..+++.+||.+|.+
T Consensus       146 ~---~~~f~E~SAk~g~n  160 (171)
T cd00157         146 G---AIGYMECSALTQEG  160 (171)
T ss_pred             C---CCEEEEECCCCCCC
T ss_conf             9---98899978789959


No 194
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=98.82  E-value=1.4e-08  Score=72.33  Aligned_cols=135  Identities=27%  Similarity=0.278  Sum_probs=81.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE-EEEEEEEECC--CEEEEEEECCCCHHHHHHHHHH
Q ss_conf             999904689887899999987644420013126868698629206-3789998219--9089998478730246779877
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI-ATAHVSYETD--KRFYSHIDCPGHADYVKNMITG   91 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi-~~~~~~~~~~--~~~i~iiD~PGH~~f~~~mi~g   91 (392)
                      |+++|.-..|||+|+.+++...-.        +    +-  --|+ +.-...+..+  ..++.|.|++|+++|..-.-.-
T Consensus         2 i~ivG~~~vGKTsli~r~~~~~f~--------~----~~--~pTi~~~~~~~~~~~~~~~~l~i~Dt~g~~~~~~~~~~~   67 (160)
T cd00876           2 VVVLGAGGVGKSAITIQFVKGTFV--------E----EY--DPTIEDSYRKTIVVDGETYTLDILDTAGQEEFSAMRDLY   67 (160)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCC--------C----CC--CCCEEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHHH
T ss_conf             999996996799999999619599--------8----77--883004899999976699999999799962355788999


Q ss_pred             HHCCCCEEEEECCCCCCCCCHHHHH----H-HHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEE
Q ss_conf             4002331452012344332106778----8-88631---87602331002333561222110123210011101453221
Q gi|254780263|r   92 ATQADGAILVCAAEDGPKPQTREHI----L-LARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDT  163 (392)
Q Consensus        92 ~~~~D~ailvVda~~G~~~QT~eh~----~-l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~  163 (392)
                      ...+|+++||.|.+.-   +|-+++    . +.+..   .+| ++++-||.|+.+..+   ...++.+++.++.    ..
T Consensus        68 ~~~a~~~ilvfd~~~~---~Sf~~i~~~~~~i~~~~~~~~~p-iilvgnK~Dl~~~~~---V~~~e~~~~a~~~----~~  136 (160)
T cd00876          68 IRQGDGFILVYSITDR---ESFEEIKGYREQILRVKDDEDIP-IVLVGNKCDLENERQ---VSKEEGKALAKEW----GC  136 (160)
T ss_pred             HHHCCEEEEEECCCCH---HHHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCCHHCCC---CCHHHHHHHHHHC----CC
T ss_conf             7643689997328987---89999999999999972878862-999997456223078---9999999999984----99


Q ss_pred             ECCCCEEEEEE
Q ss_conf             02331146764
Q gi|254780263|r  164 PIIRGSALCAL  174 (392)
Q Consensus       164 pii~~sa~~g~  174 (392)
                      +++.+||.+|.
T Consensus       137 ~y~e~Sak~g~  147 (160)
T cd00876         137 PFIETSAKDNI  147 (160)
T ss_pred             EEEEECCCCCC
T ss_conf             79998479894


No 195
>cd04125 RabA_like RabA-like subfamily.  RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells.  The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression.  The function of RabA remains unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=98.82  E-value=8.7e-09  Score=73.55  Aligned_cols=145  Identities=17%  Similarity=0.118  Sum_probs=83.8

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC--CCEEEEEEECCCCHHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378999821--9908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET--DKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~--~~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.|+++|.-..|||+|+-++...            ...++-..-+..+.....+..  ....+.|.||+|.+.|-.-.-.
T Consensus         1 ~KivvvGd~~VGKTsli~r~~~~------------~f~~~~~~Tig~~~~~k~i~~~~~~~~l~iwDtaG~e~~~~l~~~   68 (188)
T cd04125           1 FKVVIIGDYGVGKSSLLKRFTED------------EFSESTKSTIGVDFKIKTVYIENKIIKLQIWDTNGQERFRSLNNS   68 (188)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHH
T ss_conf             97999999997899999999519------------689986886540357999999999999999989997104578999


Q ss_pred             HHHCCCCEEEEECCCCCCC-CCHHHHHHHHHHC--CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCC
Q ss_conf             7400233145201234433-2106778888631--876023310023335612221101232100111014532210233
Q gi|254780263|r   91 GATQADGAILVCAAEDGPK-PQTREHILLARQI--GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIR  167 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~-~QT~eh~~l~~~l--gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~  167 (392)
                      -...||++|||.|.+.-.. ....+.+..++..  .-+++|++-||+|+.+..+   ...++.+++.++.    +.+++.
T Consensus        69 ~~~~a~~~ilvydit~~~Sf~~l~~w~~~i~~~~~~~~~iilvgNK~DL~~~r~---V~~~e~~~~a~~~----~~~~~E  141 (188)
T cd04125          69 YYRGAHGYLLVYDVTDQESFENLKFWINEINRYARENVIKVIVANKSDLVNNKV---VDSNIAKSFCDSL----NIPFFE  141 (188)
T ss_pred             HHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCHHHHHHCCC---CCHHHHHHHHHHC----CCEEEE
T ss_conf             863786799980389878999999999999987898662451001344766067---9999999999986----998999


Q ss_pred             CEEEEEEEC
Q ss_conf             114676411
Q gi|254780263|r  168 GSALCALQG  176 (392)
Q Consensus       168 ~sa~~g~~~  176 (392)
                      +||.++.+.
T Consensus       142 ~SAktg~nV  150 (188)
T cd04125         142 TSAKQSINV  150 (188)
T ss_pred             ECCCCCCCH
T ss_conf             747889098


No 196
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=98.82  E-value=1.4e-08  Score=72.28  Aligned_cols=140  Identities=16%  Similarity=0.171  Sum_probs=80.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHH--HHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869--86292063789998219908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEE--KLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E--~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.|+++|....|||+|+.++...            ...++  ..-|.+.......+......+.|-||||++.|-.-.-.
T Consensus         1 iKivllGd~~VGKTsli~r~~~~------------~f~~~~~~Tig~~~~~~~~~~~~~~~~l~iwDtaG~e~f~~~~~~   68 (161)
T cd04124           1 VKIILLGDSAVGKSKLVERFLMD------------GYEPQQLSTYALTLYKHNAKFEGKTILVDFWDTAGQERFQTMHAS   68 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCHHHHH
T ss_conf             98999998996789999999809------------779972665415799999999999999999979998434324699


Q ss_pred             HHHCCCCEEEEECCCCCCC-CCHHHHHHHHHH--CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCC
Q ss_conf             7400233145201234433-210677888863--1876023310023335612221101232100111014532210233
Q gi|254780263|r   91 GATQADGAILVCAAEDGPK-PQTREHILLARQ--IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIR  167 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~-~QT~eh~~l~~~--lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~  167 (392)
                      -...||+++||.|.+.-.. ..-.+-+.-++.  -.+| +|++-||+|+- .+ ..+    +-.++.++.    +.|++.
T Consensus        69 y~~~a~~~ilvfDit~~~Sf~~~~~w~~~i~~~~~~~p-~ilVgNK~DL~-~~-~~~----~~~~~a~~~----~~~f~e  137 (161)
T cd04124          69 YYHKAHACILVFDVTRKITYKNLSKWYEELREYRPEIP-CIVVANKIDLD-PS-VTQ----KKFNFAEKH----NLPLYY  137 (161)
T ss_pred             HHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCC-CH-HHH----HHHHHHHHC----CCEEEE
T ss_conf             73568767999968977889999999999998686998-99999971177-42-589----999999986----991999


Q ss_pred             CEEEEEEE
Q ss_conf             11467641
Q gi|254780263|r  168 GSALCALQ  175 (392)
Q Consensus       168 ~sa~~g~~  175 (392)
                      +||.+|.+
T Consensus       138 tSAk~g~n  145 (161)
T cd04124         138 VSAADGTN  145 (161)
T ss_pred             EECCCCCC
T ss_conf             90783809


No 197
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily.  Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice.  This isoform is associated with membrane ruffles and promotes macropinosome formation.  Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further re
Probab=98.82  E-value=1.3e-08  Score=72.53  Aligned_cols=145  Identities=17%  Similarity=0.088  Sum_probs=82.2

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC--CEEEEEEECCCCHHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789998219--9089998478730246779877
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD--KRFYSHIDCPGHADYVKNMITG   91 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~--~~~i~iiD~PGH~~f~~~mi~g   91 (392)
                      .|+++|.-..|||+|+-++...            ..+++-.--+.++.....++.+  ...+.|-||+|.+.|-.-.-.-
T Consensus         2 KivlvGd~~VGKTsli~r~~~~------------~f~~~y~~Tig~d~~~k~~~v~~~~~~l~iwDtaGqe~f~~l~~~y   69 (170)
T cd04108           2 KVIVVGDLSVGKTCLINRFCKD------------VFDKNYKATIGVDFEMERFEILGVPFSLQLWDTAGQERFKCIASTY   69 (170)
T ss_pred             EEEEECCCCCCHHHHHHHHHCC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHHHH
T ss_conf             8999998998989999999639------------8899725634505899999999999999999899997466443777


Q ss_pred             HHCCCCEEEEECCCCCCC-CCHHHHHH-HHHHC--CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCC
Q ss_conf             400233145201234433-21067788-88631--876023310023335612221101232100111014532210233
Q gi|254780263|r   92 ATQADGAILVCAAEDGPK-PQTREHIL-LARQI--GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIR  167 (392)
Q Consensus        92 ~~~~D~ailvVda~~G~~-~QT~eh~~-l~~~l--gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~  167 (392)
                      ...||++|||.|.+.-.. ...++-+. +.+..  ..+.++++-||+|+.+..++.. .+++..++-++.    +.|++.
T Consensus        70 ~r~a~~~ilvyDvt~~~Sf~~~~~w~~~~~~~~~~~~~~i~LvgNK~DL~~~~~~~~-~~~~~~~~a~~~----~~~~~E  144 (170)
T cd04108          70 YRGAQAIIIVFDLTDVASLEHTRQWLEDALKENDPSSVLLFLVGTKKDLSSPAQYAL-MEQDAIKLAAEM----QAEYWS  144 (170)
T ss_pred             HCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCEEEE-EHHHHHHHHHHC----CCEEEE
T ss_conf             327875899997898789999999999999850899982999998413798755764-489999999877----987999


Q ss_pred             CEEEEEEE
Q ss_conf             11467641
Q gi|254780263|r  168 GSALCALQ  175 (392)
Q Consensus       168 ~sa~~g~~  175 (392)
                      +||.+|.+
T Consensus       145 ~SAk~g~n  152 (170)
T cd04108         145 VSALSGEN  152 (170)
T ss_pred             ECCCCCCC
T ss_conf             85578818


No 198
>cd04113 Rab4 Rab4 subfamily.  Rab4 has been implicated in numerous functions within the cell.  It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A.  Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane.  It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p
Probab=98.81  E-value=1.1e-08  Score=72.97  Aligned_cols=142  Identities=19%  Similarity=0.198  Sum_probs=81.7

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEE--ECCCEEEEEEECCCCHHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789998--2199089998478730246779877
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSY--ETDKRFYSHIDCPGHADYVKNMITG   91 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~--~~~~~~i~iiD~PGH~~f~~~mi~g   91 (392)
                      .|+++|.-..|||+|+.++...            ...++-..-+.++.....+  ......+.|.||+|.+.|-.-.-.-
T Consensus         2 Kivl~Gd~~vGKTsli~r~~~~------------~f~~~~~~Tig~~~~~k~~~~~~~~~~l~iwDtaG~e~~~~~~~~~   69 (161)
T cd04113           2 KFIIIGSSGTGKSCLLHRFVEN------------KFKEDSQHTIGVEFGSKIIRVGGKRVKLQIWDTAGQERFRSVTRSY   69 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHHH
T ss_conf             8999994996799999999729------------8999879976457899999999999999999899970122678998


Q ss_pred             HHCCCCEEEEECCCCCCC-CCHHHHHHHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCC
Q ss_conf             400233145201234433-2106778888631---876023310023335612221101232100111014532210233
Q gi|254780263|r   92 ATQADGAILVCAAEDGPK-PQTREHILLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIR  167 (392)
Q Consensus        92 ~~~~D~ailvVda~~G~~-~QT~eh~~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~  167 (392)
                      ...+|+++||.|.++-.. ..-.+-+..++..   .+| ++++-||+|+.+..+   ...++.+++.++.    +.+++.
T Consensus        70 ~~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~~~-iilVgNK~Dl~~~r~---V~~~e~~~~a~~~----~~~~~E  141 (161)
T cd04113          70 YRGAAGALLVYDITNRTSFEALPTWLSDARALASPNIV-VILVGNKSDLADQRE---VTFLEASRFAQEN----GLLFLE  141 (161)
T ss_pred             HHCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCE-EEEECCCCCCHHCCC---CCHHHHHHHHHHC----CCEEEE
T ss_conf             40577789953689889999999999999986799964-986034344000378---8999999999985----997999


Q ss_pred             CEEEEEEE
Q ss_conf             11467641
Q gi|254780263|r  168 GSALCALQ  175 (392)
Q Consensus       168 ~sa~~g~~  175 (392)
                      +||.+|.+
T Consensus       142 ~SAk~~~n  149 (161)
T cd04113         142 TSALTGEN  149 (161)
T ss_pred             ECCCCCCC
T ss_conf             74156905


No 199
>cd04121 Rab40 Rab40 subfamily.  This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous.  In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle.  Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components.  Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide d
Probab=98.81  E-value=1e-08  Score=73.11  Aligned_cols=139  Identities=14%  Similarity=0.204  Sum_probs=82.5

Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEE--ECCCEEEEEEECCCCHHHHHH
Q ss_conf             279999904689887899999987644420013126868698629206--3789998--219908999847873024677
Q gi|254780263|r   12 SLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSY--ETDKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        12 ~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~--~~~~~~i~iiD~PGH~~f~~~   87 (392)
                      .+.|+++|--.-|||+|+.++....-            .++  ..-|+  +.....+  +.....+.|-||+|++.|..-
T Consensus         6 ~~KivllGd~~VGKTsl~~r~~~~~f------------~~~--y~~Tig~~~~~k~~~~~~~~v~l~iwDtaGqe~f~~l   71 (189)
T cd04121           6 LLKFLLVGDSDVGKGEILASLQDGST------------ESP--YGYNMGIDYKTTTILLDGRRVKLQLWDTSGQGRFCTI   71 (189)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCCC------------CCC--CCCCCCEEEEEEEEEECCEEEEEEEECCCCCCCHHHH
T ss_conf             99999999899789999999974997------------898--6876537989999999999999999817886221167


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHH----HHHH--HCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             98774002331452012344332106778----8886--31876023310023335612221101232100111014532
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHI----LLAR--QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~----~l~~--~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      .-.=...||++|||-|.+.-   +|-+.+    ..++  .-++| +|++-||+|+....+   ...++.+++.+..    
T Consensus        72 ~~~y~r~a~~~ilvyDvt~~---~Sf~~l~~w~~~i~~~~~~~p-~iLVGNK~DL~~~r~---V~~ee~~~~A~~~----  140 (189)
T cd04121          72 FRSYSRGAQGIILVYDITNR---WSFDGIDRWIKEIDEHAPGVP-KILVGNRLHLAFKRQ---VATEQAQAYAERN----  140 (189)
T ss_pred             HHHHHHHCCCEEEEECCCCH---HHHHHHHHHHHHHHHHCCCCC-EEEEEECCCHHHCCC---CCHHHHHHHHHHC----
T ss_conf             89886633704898227988---999999999999999768987-899613255033088---9999999999988----


Q ss_pred             EEECCCCEEEEEEE
Q ss_conf             21023311467641
Q gi|254780263|r  162 DTPIIRGSALCALQ  175 (392)
Q Consensus       162 ~~pii~~sa~~g~~  175 (392)
                      +++++.+||.+|.+
T Consensus       141 ~~~f~EtSAk~g~n  154 (189)
T cd04121         141 GMTFFEVSPLCNFN  154 (189)
T ss_pred             CCEEEEECCCCCCC
T ss_conf             99999960067939


No 200
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily.  Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project.  It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2).  This is a novel subfamily identified in human cancers that is uncharacterized to date.
Probab=98.80  E-value=2.1e-08  Score=71.21  Aligned_cols=110  Identities=20%  Similarity=0.237  Sum_probs=74.4

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHHC
Q ss_conf             99990468988789999998764442001312686869862920637899982199089998478730246779877400
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQ   94 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~~   94 (392)
                      |.++|==+|||||++.+|....        ..+.      .--|+-.....+++++.++++-|.+|++.|-.-.-.=...
T Consensus         2 IlilGLd~aGKTTil~~l~~~~--------~~~~------~~PT~Gf~~~~i~~~~~~l~~wDlgGq~~~R~~W~~Y~~~   67 (164)
T cd04162           2 ILVLGLDGAGKTSLLHSLSSER--------SLES------VVPTTGFNSVAIPTQDAIMELLEIGGSQNLRKYWKRYLSG   67 (164)
T ss_pred             EEEECCCCCCHHHHHHHHHCCC--------CCCC------CCCCCCCCEEEEEECCEEEEEEECCCHHHHHHHHHHHHHC
T ss_conf             9999679998999999981699--------8765------3563277469999899999998537528886569987117


Q ss_pred             CCCEEEEECCCC-CCCCCHHHHHHH--HHHCCCCCEEEEECCCCCCCC
Q ss_conf             233145201234-433210677888--863187602331002333561
Q gi|254780263|r   95 ADGAILVCAAED-GPKPQTREHILL--ARQIGISSIVVYMNKVDAVDD  139 (392)
Q Consensus        95 ~D~ailvVda~~-G~~~QT~eh~~l--~~~lgi~~iIv~iNKmD~v~~  139 (392)
                      +|+.++|||+++ .-+.+.++.+.-  ....++| ++|+-||.|+.+.
T Consensus        68 ~~gIIfVVDssD~~rl~eak~~L~~ll~~~~~~P-lLIlaNKqDl~~a  114 (164)
T cd04162          68 SQGLIFVVDSADSERLPLARQELHQLLQHPPDLP-LVVLANKQDLPAA  114 (164)
T ss_pred             CCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCCCCC
T ss_conf             7589999956888899999999999970879986-9999863243369


No 201
>cd01868 Rab11_like Rab11-like.  Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=98.80  E-value=1.8e-08  Score=71.55  Aligned_cols=141  Identities=22%  Similarity=0.176  Sum_probs=80.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEEECC--CEEEEEEECCCCHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206--3789998219--9089998478730246779
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSYETD--KRFYSHIDCPGHADYVKNM   88 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~~~~--~~~i~iiD~PGH~~f~~~m   88 (392)
                      +.|+++|.-..|||+|+.+++..            ...+|-.  -||  +.....+..+  ...+.|.||||.++|-.-.
T Consensus         4 ~Kiv~iGd~~VGKTsli~r~~~~------------~f~~~~~--~Tig~~~~~k~i~~~~~~~~l~iwDtaG~e~~~~~~   69 (165)
T cd01868           4 FKIVLIGDSGVGKSNLLSRFTRN------------EFNLDSK--STIGVEFATRSIQIDGKTIKAQIWDTAGQERYRAIT   69 (165)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHC------------CCCCCCC--CCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHHH
T ss_conf             89999999997899999999729------------8999889--874478789999999999999999899972126789


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHH-HHHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             877400233145201234433210677-8888631---876023310023335612221101232100111014532210
Q gi|254780263|r   89 ITGATQADGAILVCAAEDGPKPQTREH-ILLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G~~~QT~eh-~~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                      -.-...+|+++||.|.+.-..=+..+. +..++..   .+| ++++-||+|+.+..+   ...++..++.++.    +.+
T Consensus        70 ~~~~~~a~~~ilvydit~~~Sf~~i~~w~~~i~~~~~~~~~-iilVgnK~DL~~~r~---Vs~~e~~~~a~~~----~~~  141 (165)
T cd01868          70 SAYYRGAVGALLVYDITKKQTFENVERWLKELRDHADSNIV-IMLVGNKSDLRHLRA---VPTEEAKAFAEKN----GLS  141 (165)
T ss_pred             HHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCE-EEEECCCCCHHHHCC---CCHHHHHHHHHHC----CCE
T ss_conf             98733205148986269889999999999999985557735-987023478688578---8899999999985----997


Q ss_pred             CCCCEEEEEEE
Q ss_conf             23311467641
Q gi|254780263|r  165 IIRGSALCALQ  175 (392)
Q Consensus       165 ii~~sa~~g~~  175 (392)
                      ++.+||.+|.+
T Consensus       142 ~~E~SAk~g~n  152 (165)
T cd01868         142 FIETSALDGTN  152 (165)
T ss_pred             EEEECCCCCCC
T ss_conf             99967888929


No 202
>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3). Termination of protein synthesis by the ribosome requires two release factor (RF) classes. The class II RF3 is a GTPase that removes class I RFs (RF1 or RF2) from the ribosome after release of the nascent polypeptide. RF3 in the GDP state binds to the ribosomal class I RF complex, followed by an exchange of GDP for GTP and release of the class I RF. Sequence comparison of class II release factors with elongation factors shows that prokaryotic RF3 is more similar to EF-G whereas eukaryotic eRF3 is more similar to eEF1A, implying that their precise function may differ.
Probab=98.79  E-value=2.1e-09  Score=77.41  Aligned_cols=73  Identities=21%  Similarity=0.286  Sum_probs=56.9

Q ss_pred             CCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCC-CCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEEC
Q ss_conf             3554454301487424534896799950687432125412100-1211443210013666411245432202117732
Q gi|254780263|r  217 GIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEM-FRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCA  293 (392)
Q Consensus       217 ~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~-~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~  293 (392)
                      +.+++|++++-||+||+++.|+++.....+++....++..++. .++++++|+|||+||+.    ...+++.||+||+
T Consensus        11 d~~h~grlaf~RV~SG~l~~G~~v~n~rtgK~~ri~r~~~~~a~~Re~ie~A~aGDIvav~----g~~~~~tGDTL~~   84 (85)
T cd03689          11 DPAHRDRIAFVRVCSGKFERGMKVKHVRLGKEVRLSNPQQFFAQDRETVDEAYPGDIIGLV----NPGNFQIGDTLTE   84 (85)
T ss_pred             CCCCCCEEEEEEEEEEEECCCCEEEECCCCCEEEECCHHHHHHCCCEEECEEECCCEEEEE----CCCCCEECCCCCC
T ss_conf             9100771899999872986899999712796788354453322770080349389899982----7998731465137


No 203
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily.  Rab32 and Rab38 are members of the Rab family of small GTPases.  Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=98.78  E-value=1.1e-08  Score=72.86  Aligned_cols=142  Identities=19%  Similarity=0.108  Sum_probs=81.7

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEEECC-C--EEEEEEECCCCHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206--3789998219-9--08999847873024677
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSYETD-K--RFYSHIDCPGHADYVKN   87 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~~~~-~--~~i~iiD~PGH~~f~~~   87 (392)
                      +.|+++|--.-|||+|+-++....            ..++  .--||  +.....++.+ +  ..+.|-||+|+++|-.-
T Consensus         1 fKvvllGd~gVGKTsLi~rf~~~~------------F~~~--y~~Tig~df~~k~i~~~~~~~v~l~iwDtaGqe~~~~l   66 (201)
T cd04107           1 LKVLVIGDLGVGKTSIIKRYVHGI------------FSQH--YKATIGVDFALKVIEWDPNTVVRLQLWDIAGQERFGGM   66 (201)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCC------------CCCC--CCCCCCEEEEEEEEEECCCEEEEEEEEECCCCCCCCCC
T ss_conf             979999999978999999998299------------9998--88875677899899967981999999868998322200


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHH--HH------HHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE
Q ss_conf             98774002331452012344332106778--88------86318760233100233356122211012321001110145
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHI--LL------ARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY  159 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~--~l------~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~  159 (392)
                      .-.-...+|++|||.|.+.-..=+.-..+  .+      ...-.+| ++++-||+|+....+   ...++..++.++.++
T Consensus        67 ~~~y~~~a~~~ilvydvt~~~Sf~~l~~w~~~i~~~~~~~~~~~ip-iilVgNK~DL~~~~~---v~~ee~~~~a~~~~~  142 (201)
T cd04107          67 TRVYYRGAVGAIIVFDVTRPSTFEAVLKWKADLDSKVTLPNGEPIP-CLLLANKCDLKKRLA---KDGEQMDQFCKENGF  142 (201)
T ss_pred             HHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCC-EEEEEECCCCCCCCC---CCHHHHHHHHHHCCC
T ss_conf             3755557764799982798899998999999999986213789871-899866556411256---899999999997799


Q ss_pred             EEEEECCCCEEEEEEE
Q ss_conf             3221023311467641
Q gi|254780263|r  160 SDDTPIIRGSALCALQ  175 (392)
Q Consensus       160 ~~~~pii~~sa~~g~~  175 (392)
                         ..++.+||.+|.+
T Consensus       143 ---~~~~EtSAktg~n  155 (201)
T cd04107         143 ---IGWFETSAKEGIN  155 (201)
T ss_pred             ---CEEEEECCCCCCC
T ss_conf             ---8099977999949


No 204
>cd04104 p47_IIGP_like p47 (47-kDa) family.  The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1.  They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens.  p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma).  ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis.  TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro.  IRG-47 is involved in resistance to T. gondii infection.  LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections.  IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues.  In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=98.78  E-value=5.9e-09  Score=74.57  Aligned_cols=165  Identities=18%  Similarity=0.252  Sum_probs=97.3

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEE-EEEEEEC-CCEEEEEEECCC-------CHH
Q ss_conf             7999990468988789999998764442001312686869862920637-8999821-990899984787-------302
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIAT-AHVSYET-DKRFYSHIDCPG-------HAD   83 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~-~~~~~~~-~~~~i~iiD~PG-------H~~   83 (392)
                      +|||+.|-..+||||++.+|-+. +.+..+.+.+         |.+-.. ..+.|.. +--.+++.|.||       ..+
T Consensus         2 l~iaVtGesGaGKSSfINAlRGl-~~~d~~aA~t---------Gv~eTT~~~~~Y~~p~~pnv~lwDlPG~Gt~~f~~~~   71 (197)
T cd04104           2 LNIAVTGESGAGKSSFINALRGV-GHEEEGAAPT---------GVVETTMKRTPYPHPKFPNVTLWDLPGIGSTAFPPDD   71 (197)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCC-CCCCCCCCCC---------CCCCCCCCCEECCCCCCCCCEEECCCCCCCCCCCHHH
T ss_conf             17999558998689999998688-9887775888---------8874677862047999998769728999987659899


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHH-HHHHHHCCCCCEEEEECCCCCCCC------------HHHHHHCCCCC
Q ss_conf             46779877400233145201234433210677-888863187602331002333561------------22211012321
Q gi|254780263|r   84 YVKNMITGATQADGAILVCAAEDGPKPQTREH-ILLARQIGISSIVVYMNKVDAVDD------------DELLDISEYEI  150 (392)
Q Consensus        84 f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh-~~l~~~lgi~~iIv~iNKmD~v~~------------~~~~~~i~~~i  150 (392)
                      |+..|  +....|+-|++.|.   -+.++-.. +..++.+|.+ +.++-||+|.--.            ++..+.+....
T Consensus        72 Yl~~~--~~~~yD~fiiiss~---rf~~nd~~la~~i~~~gK~-fyfVRsK~D~dl~n~~~~~p~~f~~e~~L~~IR~~c  145 (197)
T cd04104          72 YLEEM--KFSEYDFFIIISST---RFSSNDVKLAKAIQCMGKK-FYFVRTKVDRDLSNEQRSKPRSFNREQVLQEIRDNC  145 (197)
T ss_pred             HHHHC--CCCCCCEEEEEECC---CCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCHHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             99865--85545789998388---6414269999999980992-899986121400056637876659999999999999


Q ss_pred             CEEEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCC
Q ss_conf             0011101453221023311467641144456521233203443102522221
Q gi|254780263|r  151 RDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQR  202 (392)
Q Consensus       151 ~~~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~  202 (392)
                      .+.|++.+.. +.+++-+|.+        ....|+-+.|.+.+..-+|.-.|
T Consensus       146 ~~~L~~~gv~-~p~VFLvS~~--------~~~~yDFp~L~~tl~~~Lp~~kr  188 (197)
T cd04104         146 LENLQEAGVS-EPPVFLVSNF--------DPSDYDFPKLRETLLKDLPAHKR  188 (197)
T ss_pred             HHHHHHCCCC-CCCEEEEECC--------CCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             9999986999-9998999379--------82207768999999998089889


No 205
>cd04122 Rab14 Rab14 subfamily.  Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles.  Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments.  Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation.  In addition, Rab14 is believed to play a role in the regulation of phagocytosis.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GT
Probab=98.77  E-value=1.7e-08  Score=71.75  Aligned_cols=143  Identities=17%  Similarity=0.151  Sum_probs=81.9

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC--CEEEEEEECCCCHHHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789998219--908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD--KRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~--~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.|+++|.-..|||+|+.++...            ...++-..-+-++.....+..+  ...+.|.||+|+++|-.-.-.
T Consensus         3 ~KivlvGd~~VGKTsli~r~~~~------------~f~~~~~~Tig~~~~~k~i~~~~~~~~l~iwDtaG~e~~~~~~~~   70 (166)
T cd04122           3 FKYIIIGDMGVGKSCLLHQFTEK------------KFMADCPHTIGVEFGTRIIEVNGQKIKLQIWDTAGQERFRAVTRS   70 (166)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCCHH
T ss_conf             99999999995799999999129------------889999997446889999999999999999989998544425211


Q ss_pred             HHHCCCCEEEEECCCCCC-CCCHHHHHHHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             740023314520123443-32106778888631---87602331002333561222110123210011101453221023
Q gi|254780263|r   91 GATQADGAILVCAAEDGP-KPQTREHILLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~-~~QT~eh~~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
                      -...+|++|||.|.+.-. +..-.+-+..++..   ..+ ++++-||+|+.+..+   ...++..++.++.    +.+++
T Consensus        71 ~~~~a~~~ilvydvt~~~Sf~~l~~w~~~~~~~~~~~~~-iilVGNK~DL~~~r~---V~~~e~~~~a~~~----~~~~~  142 (166)
T cd04122          71 YYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTV-IFLIGNKADLEAQRD---VTYEEAKQFADEN----GLLFL  142 (166)
T ss_pred             HEECCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCE-EEECCCCCCHHHCCC---CCHHHHHHHHHHC----CCEEE
T ss_conf             143154659972587476799999999999985699975-870340157444389---9999999999986----99899


Q ss_pred             CCEEEEEEE
Q ss_conf             311467641
Q gi|254780263|r  167 RGSALCALQ  175 (392)
Q Consensus       167 ~~sa~~g~~  175 (392)
                      .+||.+|.+
T Consensus       143 E~SAk~g~n  151 (166)
T cd04122         143 ECSAKTGEN  151 (166)
T ss_pred             EECCCCCCC
T ss_conf             986587808


No 206
>cd04176 Rap2 Rap2 subgroup.  The Rap2 subgroup is part of the Rap subfamily of the Ras family.  It consists of Rap2a, Rap2b, and Rap2c.  Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton.  In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments.  In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway.  The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis.  Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation.  A number of additional effector proteins for Rap2 have been identified, incl
Probab=98.76  E-value=2.9e-08  Score=70.31  Aligned_cols=138  Identities=23%  Similarity=0.229  Sum_probs=80.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE-EEEEEEEE--CCCEEEEEEECCCCHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206-37899982--1990899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI-ATAHVSYE--TDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi-~~~~~~~~--~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      ..|+++|.-..|||+|+.++....            ..++-  --|+ +.....+.  .....+.|.||+|+++|-.-.-
T Consensus         2 ~KivllGd~~VGKTsli~r~~~~~------------f~~~y--~pTi~~~~~k~i~~~~~~~~l~iwDtaG~e~~~~~~~   67 (163)
T cd04176           2 YKVVVLGSGGVGKSALTVQFVSGT------------FIEKY--DPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRD   67 (163)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCC------------CCCCC--CCCCCCEEEEEEEECCEEEEEEEEECCCCHHHHHHHH
T ss_conf             399998999978999999997098------------99755--8852331679999888999999998988542567889


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHH-----HHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             7740023314520123443321067788-----8863---1876023310023335612221101232100111014532
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHIL-----LARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~~-----l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      .-...||+++||.|.+.-   +|-+.+.     +.+.   -++| +|++-||+|+.+..+   ...++.+++-++.    
T Consensus        68 ~~~~~a~~~ilvydit~~---~Sf~~l~~~~~~i~~~~~~~~~p-iilVgNK~DL~~~r~---V~~~e~~~~a~~~----  136 (163)
T cd04176          68 LYIKNGQGFIVVYSLVNQ---QTFQDIKPMRDQIVRVKGYEKVP-IILVGNKVDLESERE---VSSAEGRALAEEW----  136 (163)
T ss_pred             HHHCCCCEEEEEECCCCH---HHHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCCCCCCC---CCHHHHHHHHHHC----
T ss_conf             985578656897127988---99999999999999973899963-999743134001276---9999999999985----


Q ss_pred             EEECCCCEEEEEEE
Q ss_conf             21023311467641
Q gi|254780263|r  162 DTPIIRGSALCALQ  175 (392)
Q Consensus       162 ~~pii~~sa~~g~~  175 (392)
                      +.+++.+||.++.+
T Consensus       137 ~~~~~E~SAk~~~n  150 (163)
T cd04176         137 GCPFMETSAKSKTM  150 (163)
T ss_pred             CCEEEEECCCCCCC
T ss_conf             99899985687817


No 207
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes. During the process of peptide synthesis and tRNA site changes, the ribosome is moved along the mRNA a distance equal to one codon with the addition of each amino acid. In bacteria this translocation step is catalyzed by EF-G_GTP, which is hydrolyzed to provide the required energy. Thus, this action releases the uncharged tRNA from the P site and transfers the newly formed peptidyl-tRNA from the A site to the P site. Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more compl
Probab=98.75  E-value=4.4e-09  Score=75.37  Aligned_cols=78  Identities=22%  Similarity=0.236  Sum_probs=61.3

Q ss_pred             CEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCC----CCCCCCCCCCHHHHHHHCCCCCCE
Q ss_conf             0000000135544543014874245348967999506874321254121001----211443210013666411245432
Q gi|254780263|r  209 LMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMF----RKKLDEAIAGDNVGLLLRGVNRAD  284 (392)
Q Consensus       209 r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~----~~~v~~a~aGd~v~l~Lkgi~~~d  284 (392)
                      ...|+++...++.|++..+||.||+|+.||++.+...+.   ..++.+++.+    +.++++|.|||++++.  |  ..+
T Consensus         2 ~a~VFK~~~d~~~Gri~~~RV~~G~l~~g~~v~~~~~~~---~~kv~~l~~~~g~~~~~v~~~~aGdI~ai~--g--l~~   74 (83)
T cd04088           2 VALVFKTIHDPFVGKLSFVRVYSGTLKAGSTLYNSTKGK---KERVGRLLRMHGKKQEEVEEAGAGDIGAVA--G--LKD   74 (83)
T ss_pred             EEEEEEEEECCCCCEEEEEEEECCEECCCCEEEECCCCE---EEEECEEEEEECCCCEECCEECCCCEEEEE--C--CCC
T ss_conf             099997665598886999999589986797588606510---488220478856982394688899999995--8--888


Q ss_pred             EECHHEEEC
Q ss_conf             202117732
Q gi|254780263|r  285 VPRGRVVCA  293 (392)
Q Consensus       285 i~rGdvl~~  293 (392)
                      ++.||+||+
T Consensus        75 ~~~GDTl~d   83 (83)
T cd04088          75 TATGDTLCD   83 (83)
T ss_pred             CCCCCCCCC
T ss_conf             705675369


No 208
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=98.75  E-value=2.7e-08  Score=70.47  Aligned_cols=137  Identities=23%  Similarity=0.263  Sum_probs=81.6

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE-EEEECCC--EEEEEEECCCCHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789-9982199--08999847873024677987
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH-VSYETDK--RFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~-~~~~~~~--~~i~iiD~PGH~~f~~~mi~   90 (392)
                      .|+++|.-..|||+|+-+++...            ..++-  --|+.-.+ ..+..++  ..+.|.||+|+++|-.-.-.
T Consensus         2 Kiv~vGd~~vGKTsli~r~~~~~------------f~~~y--~~Ti~~~~~k~i~~~~~~~~l~iwDt~G~e~~~~~~~~   67 (164)
T smart00173        2 KLVVLGSGGVGKSALTIQFVQGH------------FVDDY--DPTIEDSYRKQIEIDGEVCLLDILDTAGQEEFSAMRDQ   67 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCC------------CCCCC--CCCEEEEEEEEEEECCEEEEEEEEECCCCCCHHHHHHH
T ss_conf             89999999978999999997297------------99877--88136789999999999999999989997103567777


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHH-----HHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEE
Q ss_conf             74002331452012344332106778-----888631---8760233100233356122211012321001110145322
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHI-----LLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDD  162 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~-----~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~  162 (392)
                      -...+|++|||.|.++   ++|-+.+     .+.+..   .+| ++++-||+|+.+..+   ...++..++.++.    +
T Consensus        68 ~~~~a~~~ilvydi~~---~~Sf~~~~~~~~~i~~~~~~~~~p-iilvgnK~DL~~~r~---V~~~e~~~~a~~~----~  136 (164)
T smart00173       68 YMRTGEGFLLVYSITD---RQSFEEIKKFREQILRVKDRDDVP-IVLVGNKCDLESERV---VSTEEGKELARQW----G  136 (164)
T ss_pred             HCCCCCEEEEEEECCC---HHHHHHHHHHHHHHHHHCCCCCCC-EEEEEECCCCHHCCC---CCHHHHHHHHHHC----C
T ss_conf             5379877999830798---899999999999999861888886-687775346301178---9999999999983----9


Q ss_pred             EECCCCEEEEEEE
Q ss_conf             1023311467641
Q gi|254780263|r  163 TPIIRGSALCALQ  175 (392)
Q Consensus       163 ~pii~~sa~~g~~  175 (392)
                      .+++.+||.+|.+
T Consensus       137 ~~~~E~SAk~g~n  149 (164)
T smart00173      137 CPFLETSAKERVN  149 (164)
T ss_pred             CEEEEECCCCCCC
T ss_conf             9899985898817


No 209
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=98.75  E-value=2.7e-08  Score=70.47  Aligned_cols=143  Identities=17%  Similarity=0.188  Sum_probs=81.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEE--EEEEEECCCE--EEEEEECCCCHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869862920637--8999821990--89998478730246779
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIAT--AHVSYETDKR--FYSHIDCPGHADYVKNM   88 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~--~~~~~~~~~~--~i~iiD~PGH~~f~~~m   88 (392)
                      +.|+++|.-..|||+|+.+++..            ...++-..-+.++.  ....+..++.  .+.|-||+|.+.|-.-.
T Consensus         1 iKivvlGd~~VGKTsLi~r~~~~------------~f~~~y~~Tig~~~~~k~i~~~~~~~~v~l~iwDtaG~e~~~~l~   68 (162)
T cd04106           1 IKVIVVGNGNVGKSSMIQRFVKG------------IFTKDYKKTIGVDFLEKQIFLRQSDEDVRLMLWDTAGQEEFDAIT   68 (162)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCH
T ss_conf             98999999998899999999849------------689876885562578878998679979999999789970134152


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHH-HHH-H-HCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEEC
Q ss_conf             8774002331452012344332106778-888-6-318760233100233356122211012321001110145322102
Q gi|254780263|r   89 ITGATQADGAILVCAAEDGPKPQTREHI-LLA-R-QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPI  165 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G~~~QT~eh~-~l~-~-~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pi  165 (392)
                      -.-...+|++|||.|.+.-..=+..+.+ ..+ . .-.+| +|++-||+|+.+...   ...++.+++.++.    +.|+
T Consensus        69 ~~~~~~a~~~ilvydvt~~~Sf~~l~~w~~~~~~~~~~~p-iilVgNK~DL~~~r~---V~~~e~~~~a~~~----~~~~  140 (162)
T cd04106          69 KAYYRGAQACILVFSTTDRESFEAIESWKEKVEAECGDIP-MVLVQTKIDLLDQAV---ITNEEAEALAKRL----QLPL  140 (162)
T ss_pred             HHHHHHHCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCC-EEEEECCHHHHHCCC---CCHHHHHHHHHHC----CCEE
T ss_conf             4561230312688406988999999999999997669962-999840544410177---8999999999986----9879


Q ss_pred             CCCEEEEEEE
Q ss_conf             3311467641
Q gi|254780263|r  166 IRGSALCALQ  175 (392)
Q Consensus       166 i~~sa~~g~~  175 (392)
                      +.+||.++.+
T Consensus       141 ~E~SAk~~~n  150 (162)
T cd04106         141 FRTSVKDDFN  150 (162)
T ss_pred             EEECCCCCCC
T ss_conf             9986888829


No 210
>cd04112 Rab26 Rab26 subfamily.  First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation.  Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=98.75  E-value=2.1e-08  Score=71.13  Aligned_cols=153  Identities=18%  Similarity=0.177  Sum_probs=86.4

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789998219908999847873024677987740
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGAT   93 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~   93 (392)
                      .|+++|....|||+|+-++....-        ++.. .+-.-|.........+......+.|.||+|+++|-.-.-.-..
T Consensus         2 KIv~vGd~~VGKTsli~r~~~~~f--------~~~~-~~~Ti~~~~~~k~~~~~~~~v~l~iwDtaG~e~~~~l~~~~~~   72 (191)
T cd04112           2 KVMLLGDSGVGKTCLLVRFKDGAF--------LNGN-FIATVGIDFRNKVVTVDGVKVKLQIWDTAGQERFRSVTHAYYR   72 (191)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCC--------CCCC-CCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHHHHHH
T ss_conf             899999499879999999995978--------9998-6776524779999999999999999979986334646477711


Q ss_pred             CCCCEEEEECCCCCCCCCHHHHH----HHHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             02331452012344332106778----88863---187602331002333561222110123210011101453221023
Q gi|254780263|r   94 QADGAILVCAAEDGPKPQTREHI----LLARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        94 ~~D~ailvVda~~G~~~QT~eh~----~l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
                      .+|++|||.|.+.-   ++-+.+    .-++.   -.+| ++++-||+|+.+..+   ...++.+++.++.    +.+++
T Consensus        73 ~a~~~ilvydit~~---~Sf~~l~~w~~~i~~~~~~~~~-iilVGNK~DL~~~r~---V~~~e~~~~a~~~----~~~f~  141 (191)
T cd04112          73 DAHALLLLYDITNK---ASFDNIRAWLTEIKEYAQEDVV-IMLLGNKADMSGERV---VKREDGERLAKEY----GVPFM  141 (191)
T ss_pred             CCCEEEEEEECCCH---HHHHHHHHHHHHHHHHCCCCCE-EEEECCCCCCCCCCC---CCHHHHHHHHHHC----CCEEE
T ss_conf             77778999727988---9999999999999986667853-898612465530267---9999999999982----99799


Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHCC
Q ss_conf             311467641144456521233203443102
Q gi|254780263|r  167 RGSALCALQGTNKELGEDSIHALMKAVDTH  196 (392)
Q Consensus       167 ~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~  196 (392)
                      .+||.++.          ++..+++.|...
T Consensus       142 EtSAkt~~----------nI~e~F~~i~~~  161 (191)
T cd04112         142 ETSAKTGL----------NVELAFTAVAKE  161 (191)
T ss_pred             EECCCCCC----------CHHHHHHHHHHH
T ss_conf             98548980----------979999999999


No 211
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=98.74  E-value=3e-08  Score=70.18  Aligned_cols=145  Identities=18%  Similarity=0.131  Sum_probs=86.0

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789998219908999847873024677987740
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGAT   93 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~   93 (392)
                      .|+++|.-..|||||+-++....        ..+.  .+..-|.........+......+.|.|++|.+.|-.-+-.-..
T Consensus         2 Ki~vvG~~~vGKTsli~r~~~~~--------f~~~--~~~tig~d~~~k~v~~~~~~~~l~i~D~~g~e~~~~~~~~~~~   71 (161)
T cd01861           2 KLVFLGDQSVGKTSIITRFMYDT--------FDNQ--YQATIGIDFLSKTMYLEDKTVRLQLWDTAGQERFRSLIPSYIR   71 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCC--------CCCC--CCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHHHHH
T ss_conf             79999979978999999993199--------9998--4897567889999999999999999979985315788898866


Q ss_pred             CCCCEEEEECCCCCCCCCHHHHHH-HHHH-C-CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCEE
Q ss_conf             023314520123443321067788-8863-1-876023310023335612221101232100111014532210233114
Q gi|254780263|r   94 QADGAILVCAAEDGPKPQTREHIL-LARQ-I-GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSA  170 (392)
Q Consensus        94 ~~D~ailvVda~~G~~~QT~eh~~-l~~~-l-gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~sa  170 (392)
                      .+|++++|.|.++-..-+..+++. .++. . .-+.++++-||+|+.+..+   ...++..++.++.    +.+++.+||
T Consensus        72 ~~~~~ilvfd~t~~~Sf~~~~~w~~~i~~~~~~~~~ivlvGnK~Dl~~~r~---v~~~e~~~~a~~~----~~~y~E~Sa  144 (161)
T cd01861          72 DSSVAVVVYDITNRQSFDNTDKWIDDVRDERGNDVIIVLVGNKTDLSDKRQ---VSTEEGEKKAKEL----NAMFIETSA  144 (161)
T ss_pred             HHCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHCCC---CCHHHHHHHHHHC----CCEEEEECC
T ss_conf             525899998479989999999999999986578984999610211022177---8999999999984----998999834


Q ss_pred             EEEEE
Q ss_conf             67641
Q gi|254780263|r  171 LCALQ  175 (392)
Q Consensus       171 ~~g~~  175 (392)
                      .++.+
T Consensus       145 k~~~n  149 (161)
T cd01861         145 KAGHN  149 (161)
T ss_pred             CCCCC
T ss_conf             77808


No 212
>cd01866 Rab2 Rab2 subfamily.  Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur
Probab=98.74  E-value=2.1e-08  Score=71.20  Aligned_cols=141  Identities=22%  Similarity=0.168  Sum_probs=82.8

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEEEC--CCEEEEEEECCCCHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206--378999821--99089998478730246779
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSYET--DKRFYSHIDCPGHADYVKNM   88 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~~~--~~~~i~iiD~PGH~~f~~~m   88 (392)
                      +.|+++|.-..|||+|+-+++..            ...++  .-.|+  +.....+..  ...++.|.||+|++.|-.-.
T Consensus         5 ~KivlvGd~~VGKTsli~r~~~~------------~f~~~--~~~Tig~~~~~k~i~~~~~~~~l~iwDt~G~e~~~~l~   70 (168)
T cd01866           5 FKYIIIGDTGVGKSCLLLQFTDK------------RFQPV--HDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSIT   70 (168)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCC------------CCCCC--CCCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCCCH
T ss_conf             89999998997889999999109------------89998--78985078899999999999999999799973346255


Q ss_pred             HHHHHCCCCEEEEECCCCCCC-CCHHHHHHHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             877400233145201234433-2106778888631---876023310023335612221101232100111014532210
Q gi|254780263|r   89 ITGATQADGAILVCAAEDGPK-PQTREHILLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G~~-~QT~eh~~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                      -.-...+|++|||.|.+.--. ..-.+.+..++..   ++| +|++-||+|+.+..+   ...++.+++.++.    +.+
T Consensus        71 ~~~~~~a~~~ilvydit~~~Sf~~l~~w~~~i~~~~~~~~~-iiLVGNK~DL~~~r~---V~~~e~~~~a~~~----~~~  142 (168)
T cd01866          71 RSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSNSNMT-IMLIGNKCDLESRRE---VSYEEGEAFAKEH----GLI  142 (168)
T ss_pred             HHHHHHHCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCHHHCCC---CCHHHHHHHHHHC----CCE
T ss_conf             88866436899934458779999999999999986799965-998434235454077---8999999999986----999


Q ss_pred             CCCCEEEEEEE
Q ss_conf             23311467641
Q gi|254780263|r  165 IIRGSALCALQ  175 (392)
Q Consensus       165 ii~~sa~~g~~  175 (392)
                      ++.+||.++.+
T Consensus       143 ~~E~SAk~~~n  153 (168)
T cd01866         143 FMETSAKTASN  153 (168)
T ss_pred             EEEECCCCCCC
T ss_conf             99976788808


No 213
>cd04117 Rab15 Rab15 subfamily.  Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to
Probab=98.73  E-value=2.1e-08  Score=71.13  Aligned_cols=140  Identities=21%  Similarity=0.209  Sum_probs=82.8

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCC--EEEEEEECCCCHHHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869862920637899982199--08999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK--RFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~--~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.|+++|....|||+|+-+++..            ....+...-+.++.....++.++  ..+.|.||+|.+.|-.-.-.
T Consensus         1 ~KIvllGd~~VGKTsli~r~~~~------------~f~~~~~~Tig~~~~~k~v~~~~~~i~l~iwDtaGqe~~~~~~~~   68 (161)
T cd04117           1 FRLLLIGDSGVGKTCLLCRFTDN------------EFHSSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQ   68 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCC------------CCCCCCCCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHHH
T ss_conf             98999994998589999999429------------989987887208988999999999999999979996023635588


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHH----HHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEE
Q ss_conf             74002331452012344332106778----888631---87602331002333561222110123210011101453221
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHI----LLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDT  163 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~----~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~  163 (392)
                      -...+|+++||.|.+.   ++|-+++    ..++..   .+| +|++-||.|+.+..+   ...++..++.++.    +.
T Consensus        69 y~r~a~~~ilvyDvt~---~~Sf~~l~~w~~~i~~~~~~~~~-~ilVgNK~Dl~~~r~---v~~~~~~~~a~~~----~~  137 (161)
T cd04117          69 YYRRAQGIFLVYDISS---ERSYQHIMKWVSDVDEYAPEGVQ-KILIGNKADEEQKRQ---VGDEQGNKLAKEY----GM  137 (161)
T ss_pred             HHHHHCEEEEECCCCC---HHHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCHHHCCC---CCHHHHHHHHHHC----CC
T ss_conf             8764168899614898---89999999999999987899864-999873278786277---9999999999986----99


Q ss_pred             ECCCCEEEEEEE
Q ss_conf             023311467641
Q gi|254780263|r  164 PIIRGSALCALQ  175 (392)
Q Consensus       164 pii~~sa~~g~~  175 (392)
                      +++.+||.+|.+
T Consensus       138 ~~~etSAk~~~n  149 (161)
T cd04117         138 DFFETSACTNSN  149 (161)
T ss_pred             EEEEECCCCCCC
T ss_conf             799967789829


No 214
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=98.72  E-value=8e-08  Score=67.57  Aligned_cols=116  Identities=20%  Similarity=0.185  Sum_probs=74.5

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC--CEEEEEEECCCCHHHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789998219--908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD--KRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~--~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.|+++|-..+|||||+.+|.+..-.            ++....+..+.........  ...+.++||+|.++|-.-|-.
T Consensus         6 ~kivv~G~~g~GKTtl~~~l~~~~~~------------~~~~~t~~~~~~~~~~~~~~~~~~~~~~Dt~gq~~~~~~~~~   73 (219)
T COG1100           6 FKIVVLGDGGVGKTTLLNRLVGDEFP------------EGYPPTIGNLDPAKTIEPYRRNIKLQLWDTAGQEEYRSLRPE   73 (219)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCC------------CCCCCCEEECCCCCEEECCCCCEEEEEEECCCHHHHHHHHHH
T ss_conf             79999999999889999999647676------------556761454043203622666002676767986999998875


Q ss_pred             HHHCCCCEEEEECCCC--CCCCCHHHHHHHHHHC---CCCCEEEEECCCCCCCCHH
Q ss_conf             7400233145201234--4332106778888631---8760233100233356122
Q gi|254780263|r   91 GATQADGAILVCAAED--GPKPQTREHILLARQI---GISSIVVYMNKVDAVDDDE  141 (392)
Q Consensus        91 g~~~~D~ailvVda~~--G~~~QT~eh~~l~~~l---gi~~iIv~iNKmD~v~~~~  141 (392)
                      -...+++++++.|...  ....-+++-...++.+   .++ ++++-||+|+-+...
T Consensus        74 y~~~~~~~l~~~d~~~~~~~~~~~~~~~~~l~~~~~~~~~-iilv~nK~Dl~~~~~  128 (219)
T COG1100          74 YYRGANGILIVYDSTLRESSDELTEEWLEELRELAPDDVP-ILLVGNKIDLFDEQS  128 (219)
T ss_pred             CCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCE-EEEECCCCCCCCCHH
T ss_conf             0438978999997620565788999999999874668867-999697610554301


No 215
>cd04110 Rab35 Rab35 subfamily.  Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells.  Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is 
Probab=98.72  E-value=4.6e-08  Score=69.06  Aligned_cols=143  Identities=15%  Similarity=0.134  Sum_probs=82.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC--CCEEEEEEECCCCHHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378999821--9908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET--DKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~--~~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.|+++|.-..|||+|+.++...            ...++-.--+.++.....+..  ....++|-||+|.+.|-.-.-.
T Consensus         7 ~KIvlvGd~~VGKTSli~r~~~~------------~F~~~~~~Tig~d~~~k~v~i~~~~v~l~iwDtaGqe~~~~l~~~   74 (199)
T cd04110           7 FKLLIIGDSGVGKSSLLLRFADN------------TFSGSYITTIGVDFKIRTVEINGERVKLQIWDTAGQERFRTITST   74 (199)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHHH
T ss_conf             79999997998889999999509------------999986897555878999999999999999989998123535266


Q ss_pred             HHHCCCCEEEEECCCCCCCC-CHHHHHHHH-HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCC
Q ss_conf             74002331452012344332-106778888-6318760233100233356122211012321001110145322102331
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKP-QTREHILLA-RQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRG  168 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~-QT~eh~~l~-~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~  168 (392)
                      -...+|++|||.|.+.-..= ....-+..+ ....-.++|++-||+|+.+... .  ..++..++.++.    +.+++.+
T Consensus        75 ~~~~a~~~ilvyDit~~~Sf~~l~~w~~~i~~~~~~~~~ilVGNK~Dl~~~r~-v--~~~e~~~~a~~~----~~~f~E~  147 (199)
T cd04110          75 YYRGTHGVIVVYDVTNGESFVNVKRWLQEIEQNCDDVCKVLVGNKNDDPERKV-V--ETEDAYKFAGQM----GISLFET  147 (199)
T ss_pred             HHHCCCCCEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHCC-C--CHHHHHHHHHHC----CCEEEEE
T ss_conf             64246542389717988999999999999997599875799988554475469-9--999999999986----9979998


Q ss_pred             EEEEEE
Q ss_conf             146764
Q gi|254780263|r  169 SALCAL  174 (392)
Q Consensus       169 sa~~g~  174 (392)
                      ||.+|.
T Consensus       148 SAktg~  153 (199)
T cd04110         148 SAKENI  153 (199)
T ss_pred             ECCCCC
T ss_conf             689992


No 216
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division.  Among the Ras superfamily, Ran is a unique small G protein.  It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily.  Ran may therefore interact with a wide range of proteins in various intracellular locations.  Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors.  Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins.  The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is
Probab=98.71  E-value=5.7e-08  Score=68.46  Aligned_cols=138  Identities=18%  Similarity=0.111  Sum_probs=79.4

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEEECC--CEEEEEEECCCCHHHHHHHH
Q ss_conf             9999904689887899999987644420013126868698629206--3789998219--90899984787302467798
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSYETD--KRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~~~~--~~~i~iiD~PGH~~f~~~mi   89 (392)
                      .|+++|.-..|||+|+-+++...            ..++  .--||  +.....+..+  ..++.|-||+|++.|-.-.-
T Consensus         2 KivlvGd~~VGKTsli~r~~~~~------------f~~~--~~~Tig~~~~~~~~~~~~~~v~l~iwDtaGqe~~~~l~~   67 (166)
T cd00877           2 KLVLVGDGGTGKTTFVKRHLTGE------------FEKK--YVATLGVEVHPLDFHTNRGKIRFNVWDTAGQEKFGGLRD   67 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCC------------CCCC--CCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHH
T ss_conf             89999999988899999998399------------9998--687325567999999999799999997578715666878


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHH--HHHHH-CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             774002331452012344332106778--88863-187602331002333561222110123210011101453221023
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHI--LLARQ-IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~--~l~~~-lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
                      .-...+|++|||.|.++-..=+.-+.+  .+-+. -.+| +|++-||+|+.+..     +..+..++.++.    +.+++
T Consensus        68 ~y~~~a~~~ilvyDvt~~~Sf~~v~~w~~~i~~~~~~~p-iilVgNK~Dl~~~~-----~~~~~~~~~~~~----~~~~~  137 (166)
T cd00877          68 GYYIGGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCGNIP-IVLCGNKVDIKDRK-----VKAKQITFHRKK----NLQYY  137 (166)
T ss_pred             HHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCC-----CCHHHHHHHHHC----CCEEE
T ss_conf             874006579984378988899999999999998689998-99999862175036-----679999999978----99899


Q ss_pred             CCEEEEEEE
Q ss_conf             311467641
Q gi|254780263|r  167 RGSALCALQ  175 (392)
Q Consensus       167 ~~sa~~g~~  175 (392)
                      .+||.++.+
T Consensus       138 EtSAk~~~n  146 (166)
T cd00877         138 EISAKSNYN  146 (166)
T ss_pred             EECCCCCCC
T ss_conf             984589909


No 217
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=98.70  E-value=3.9e-08  Score=69.51  Aligned_cols=136  Identities=22%  Similarity=0.233  Sum_probs=80.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE---EEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869862920637899---9821990899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV---SYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~---~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      ..|+++|....|||+|+-+++...            ..+|  .--|+...+.   ....+...+.|.||+|+++|-.-.-
T Consensus         2 ~KvvlvGd~~VGKTsli~r~~~~~------------F~~~--y~~Ti~~~~~k~~~i~~~~~~l~iwDtaG~e~~~~l~~   67 (162)
T cd04138           2 YKLVVVGAGGVGKSALTIQLIQNH------------FVDE--YDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRD   67 (162)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCC------------CCCC--CCCCCCCEEEEEEEECCEEEEEEEEECCCCCCCCHHHH
T ss_conf             399998999988999999998392------------8875--68855527999999999999999997998601114789


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHH----H-HHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             774002331452012344332106778----8-8863---1876023310023335612221101232100111014532
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHI----L-LARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~----~-l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      .-...+|+++||-|.+.-   +|-+++    . +.+.   -.+| ++++-||+|+.+.+    ...++.+++.++.    
T Consensus        68 ~~~~~a~~~ilvydvt~~---~Sf~~v~~w~~~i~~~~~~~~~p-iilVgNK~Dl~~r~----V~~~e~~~~a~~~----  135 (162)
T cd04138          68 QYMRTGEGFLCVFAINSR---KSFEDIHTYREQIKRVKDSDDVP-MVLVGNKCDLAART----VSSRQGQDLAKSY----  135 (162)
T ss_pred             HHHCCCCEEEEEEECCCH---HHHHHHHHHHHHHHHHCCCCCCE-EEEEEEECCHHHCC----CCHHHHHHHHHHC----
T ss_conf             871578779999617988---99998999999999854888854-99997653564555----8899999999980----


Q ss_pred             EEECCCCEEEEEE
Q ss_conf             2102331146764
Q gi|254780263|r  162 DTPIIRGSALCAL  174 (392)
Q Consensus       162 ~~pii~~sa~~g~  174 (392)
                      +.+++.+||.+|.
T Consensus       136 ~~~f~E~SAk~~~  148 (162)
T cd04138         136 GIPYIETSAKTRQ  148 (162)
T ss_pred             CCEEEEECCCCCC
T ss_conf             9989997389985


No 218
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=98.70  E-value=7.8e-08  Score=67.64  Aligned_cols=142  Identities=16%  Similarity=0.127  Sum_probs=83.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEEEC---CCEEEEEEECCCCHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206--378999821---9908999847873024677
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSYET---DKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~~~---~~~~i~iiD~PGH~~f~~~   87 (392)
                      +.|+++|--.-|||+|+.++...-.          ..  +.+.-.|+  +.....+..   +...+.|.||+|.+.|-.-
T Consensus         1 iKivllGd~gVGKTsli~r~~~~~~----------~f--~~~y~~Tig~~~~~k~~~~~~~~~i~l~iwDtaG~e~~~~l   68 (164)
T cd04101           1 LRCAVVGDPAVGKTAFVQMFHSNGA----------VF--PKNYLMTTGCDFVVKEVPVDTDNTVELFIFDSAGQELYSDM   68 (164)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCC----------CC--CCCCCCCCCEEEEEEEEEECCCCEEEEEEEECCCCCCHHHH
T ss_conf             9999999599588999999997888----------66--88888864578899999978997999999979998400678


Q ss_pred             HHHHHHCCCCEEEEECCCCCCC-CCHHHHHHHHHH--CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             9877400233145201234433-210677888863--1876023310023335612221101232100111014532210
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPK-PQTREHILLARQ--IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~-~QT~eh~~l~~~--lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                      .-.-...+|+++||.|.++-.. ....+-+..++.  -.+| +|++-||+|+.+..+   ...++.+++.++.    +.+
T Consensus        69 ~~~~~~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~p-~ilVgNK~DL~~~r~---V~~~e~~~~a~~~----~~~  140 (164)
T cd04101          69 VSNYWESPSVFILVYDVSNKASFENCSRWVNKVRTASKHMP-GVLVGNKMDLADKAE---VTDAQAQAFAQAN----QLK  140 (164)
T ss_pred             HHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCCC---CCHHHHHHHHHHC----CCE
T ss_conf             99997642689999707746689999999999997668986-899987224452455---6999999999988----998


Q ss_pred             CCCCEEEEEE
Q ss_conf             2331146764
Q gi|254780263|r  165 IIRGSALCAL  174 (392)
Q Consensus       165 ii~~sa~~g~  174 (392)
                      ++.+||.+|.
T Consensus       141 ~~E~SAk~g~  150 (164)
T cd04101         141 FFKTSALRGV  150 (164)
T ss_pred             EEEECCCCCC
T ss_conf             9998668890


No 219
>COG3596 Predicted GTPase [General function prediction only]
Probab=98.70  E-value=7.9e-08  Score=67.61  Aligned_cols=170  Identities=16%  Similarity=0.177  Sum_probs=96.9

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHC-CCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHH---
Q ss_conf             03882799999046898878999999876444200-13126868698629206378999821990899984787302---
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKE-YGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHAD---   83 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~-~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~---   83 (392)
                      -+|+++|+-+.|...+|||+|+.+|.+........ ..-.|-..+.            ...++...++|.|+||-.|   
T Consensus        35 ~~~~pvnvLi~G~TG~GKSSliNALF~~~~~~v~~vg~~t~~~~~~------------~~~~~~~~l~lwDtPG~gdg~~  102 (296)
T COG3596          35 TEKEPVNVLLMGATGAGKSSLINALFQGEVKEVSKVGVGTDITTRL------------RLSYDGENLVLWDTPGLGDGKD  102 (296)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHCCCCEEEECCCCCCCHHHH------------HHHCCCCCEEEECCCCCCCCHH
T ss_conf             0368615897437777688999999702673421046688701567------------7412665248843788553202


Q ss_pred             ----HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCC-CCEEEEECCCCCCCC--HHHHHHC--CCCCCEEE
Q ss_conf             ----46779877400233145201234433210677888863187-602331002333561--2221101--23210011
Q gi|254780263|r   84 ----YVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGI-SSIVVYMNKVDAVDD--DELLDIS--EYEIRDLL  154 (392)
Q Consensus        84 ----f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi-~~iIv~iNKmD~v~~--~~~~~~i--~~~i~~~l  154 (392)
                          +-.....=+.-.|..+++++|.+--...-.+.+.-....+. ++++++||-.|+..+  +|.+...  ...+++++
T Consensus       103 ~D~~~r~~~~d~l~~~DLvL~l~~~~draL~~d~~f~~dVi~~~~~~~~i~~VtQ~D~a~p~~~W~~~~~~p~~a~~qfi  182 (296)
T COG3596         103 KDAEHRQLYRDYLPKLDLVLWLIKADDRALGTDEDFLRDVIILGLDKRVLFVVTQADRAEPGREWDSAGHQPSPAIKQFI  182 (296)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEECCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEEHHHHHCCCCCCCCCCCCCCHHHHHHH
T ss_conf             21899999998863224799961477700147799999999860576069997366543655430002599987899999


Q ss_pred             EEE------EEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCC
Q ss_conf             101------453221023311467641144456521233203443102522
Q gi|254780263|r  155 KEH------KYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPT  199 (392)
Q Consensus       155 ~~~------~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~  199 (392)
                      ..-      -+.+--|++..+   +       ..-|++..|+.++.+.+|.
T Consensus       183 ~~k~~~~~~~~q~V~pV~~~~---~-------r~~wgl~~l~~ali~~lp~  223 (296)
T COG3596         183 EEKAEALGRLFQEVKPVVAVS---G-------RLPWGLKELVRALITALPV  223 (296)
T ss_pred             HHHHHHHHHHHHHCCCEEEEC---C-------CCCCCHHHHHHHHHHHCCC
T ss_conf             999999999876317747752---5-------4676689999999986731


No 220
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=98.69  E-value=3.4e-08  Score=69.91  Aligned_cols=141  Identities=20%  Similarity=0.176  Sum_probs=81.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEEEC--CCEEEEEEECCCCHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206--378999821--99089998478730246779
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSYET--DKRFYSHIDCPGHADYVKNM   88 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~~~--~~~~i~iiD~PGH~~f~~~m   88 (392)
                      +.|+++|.-..|||+|+.++...            ..+++.  .-|+  +.....++.  ....+.|-||+|.+.|-.-.
T Consensus         8 ~KivllGd~~VGKTsli~r~~~~------------~f~~~~--~~Tig~d~~~k~i~~~~~~v~l~iwDtaG~e~~~~l~   73 (169)
T cd04114           8 FKIVLIGNAGVGKTCLVRRFTQG------------LFPPGQ--GATIGVDFMIKTVEIKGEKIKLQIWDTAGQERFRSIT   73 (169)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHC------------CCCCCC--CCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCH
T ss_conf             89999998997999999999859------------899986--7741247899999999999999999899984445155


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCH-HHHHHHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             877400233145201234433210-6778888631---876023310023335612221101232100111014532210
Q gi|254780263|r   89 ITGATQADGAILVCAAEDGPKPQT-REHILLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G~~~QT-~eh~~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                      -.-...+|+++||.|.+.-..=+. ++-+..++..   .++ +|++-||+|+.+..+   ...++.+++.++.    +.+
T Consensus        74 ~~~~~~a~~~ilvydvt~~~Sf~~l~~w~~~i~~~~~~~~~-~ilVGNK~DL~~~r~---v~~~~~~~~a~~~----~~~  145 (169)
T cd04114          74 QSYYRSANALILTYDITCEESFRCLPEWLREIEQYANNKVI-TILVGNKIDLAERRE---VSQQRAEEFSDAQ----DMY  145 (169)
T ss_pred             HHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCE-EEEECCCCCHHHCCC---CCHHHHHHHHHHC----CCE
T ss_conf             77742366459981489888999999999999986898863-897311343454178---8999999999988----999


Q ss_pred             CCCCEEEEEEE
Q ss_conf             23311467641
Q gi|254780263|r  165 IIRGSALCALQ  175 (392)
Q Consensus       165 ii~~sa~~g~~  175 (392)
                      ++.+||.+|.+
T Consensus       146 ~~E~SAktg~n  156 (169)
T cd04114         146 YLETSAKESDN  156 (169)
T ss_pred             EEEECCCCCCC
T ss_conf             99986898808


No 221
>PTZ00132 GTP-binding nuclear protein; Provisional
Probab=98.69  E-value=5.8e-08  Score=68.45  Aligned_cols=138  Identities=18%  Similarity=0.166  Sum_probs=82.9

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEEECCC--EEEEEEECCCCHHHHH
Q ss_conf             8279999904689887899999987644420013126868698629206--37899982199--0899984787302467
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSYETDK--RFYSHIDCPGHADYVK   86 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~~~~~--~~i~iiD~PGH~~f~~   86 (392)
                      |.+.|+++|....|||+|+-+++...            ..+  ..--||  +.....+..++  ..++|-||+|++.|-.
T Consensus         5 p~~KIvllGd~~VGKTsLi~r~~~~~------------F~~--~y~pTig~d~~~~~~~~~~~~i~l~IwDTaGqe~f~s   70 (209)
T PTZ00132          5 AQFKLILVGDGGVGKTTFVKRHLTGE------------FEK--KYIATLGVEVHPLKFYTNRGKICFNVWDTAGQEKFGG   70 (209)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHCC------------CCC--CCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCC
T ss_conf             76899999999967899999997199------------699--8777602798999999999999999998999744556


Q ss_pred             HHHH-HHHCCCCEEEEECCCCCCCCCHHHHH-----HHHHH-CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE
Q ss_conf             7987-74002331452012344332106778-----88863-18760233100233356122211012321001110145
Q gi|254780263|r   87 NMIT-GATQADGAILVCAAEDGPKPQTREHI-----LLARQ-IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY  159 (392)
Q Consensus        87 ~mi~-g~~~~D~ailvVda~~G~~~QT~eh~-----~l~~~-lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~  159 (392)
                       |.. -...++++|||.|.+.   .+|-+++     .+.+. -.+| +|++=||.|+.+.+  .  ..++. ++.++.  
T Consensus        71 -l~~~yyr~a~~~ilVfDit~---~~SF~~l~~W~~ei~~~~~~ip-ivLVGNK~DL~~r~--V--~~~~~-~~a~~~--  138 (209)
T PTZ00132         71 -LRDGYYIKGQCAIIMFDVTS---RITYKNVPNWHRDITRVCENIP-IVLVGNKVDVKDRQ--V--KAKQI-TFHRKK--  138 (209)
T ss_pred             -CCCHHHCCCCEEEEEECCCC---HHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCC--C--CHHHH-HHHHHC--
T ss_conf             -65144248988999843788---7899999999999998689987-89997623224135--5--79999-999987--


Q ss_pred             EEEEECCCCEEEEEEEC
Q ss_conf             32210233114676411
Q gi|254780263|r  160 SDDTPIIRGSALCALQG  176 (392)
Q Consensus       160 ~~~~pii~~sa~~g~~~  176 (392)
                        +.+++.+||.+|.+.
T Consensus       139 --~~~f~EtSAKtg~NV  153 (209)
T PTZ00132        139 --NLQYYDISAKSNYNF  153 (209)
T ss_pred             --CCEEEEEECCCCCCH
T ss_conf             --998999726899397


No 222
>cd04177 RSR1 RSR1 subgroup.  RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi.  In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization.  The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site.  It is believed that cdc42 interacts directly with RSR1 in vivo.  In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha.  In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key featu
Probab=98.68  E-value=2.6e-08  Score=70.61  Aligned_cols=139  Identities=18%  Similarity=0.202  Sum_probs=81.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEE---EEEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378---999821990899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATA---HVSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~---~~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      ..|+++|.-..|||+|+.++....=.        +    +  .--|+...   ...+......+.|.||+|+++|-.-.-
T Consensus         2 fKivlvGd~~VGKTsli~rf~~~~f~--------~----~--y~pTi~~~~~k~i~i~~~~~~l~iwDtaG~e~~~~~~~   67 (168)
T cd04177           2 YKIVVLGAGGVGKSALTVQFVQNVFI--------E----S--YDPTIEDSYRKQVEIDGRQCDLEILDTAGTEQFTAMRE   67 (168)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCC--------C----C--CCCCCCCEEEEEEEECCEEEEEEEEECCCCCCCCCCHH
T ss_conf             19999899997799999999619389--------8----6--58833315999999999999999982788623334515


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHH-----HHHH---HCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             774002331452012344332106778-----8886---31876023310023335612221101232100111014532
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHI-----LLAR---QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~-----~l~~---~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      .-...||+++||.|.++-   +|-+.+     .+.+   .-.+| ++++-||.|+.+..+.   ..++..++.++.+   
T Consensus        68 ~~~~~a~~~ilvydvt~~---~Sf~~~~~~~~~i~~~~~~~~~p-iilvgNK~DL~~~r~v---~~~e~~~~a~~~~---  137 (168)
T cd04177          68 LYIKSGQGFLLVYSVTSE---ASLNELGELREQVLRIKDSDNVP-MVLVGNKADLEDDRQV---SREDGVSLSQQWG---  137 (168)
T ss_pred             HHHCCCCEEEEECCCCCH---HHHHHHHHHHHHHHHHCCCCCCC-EEEEEECCCHHHCCCC---CHHHHHHHHHHCC---
T ss_conf             451268667985368988---89999999999999851788874-8988731461213768---9999999999749---


Q ss_pred             EEECCCCEEEEEEE
Q ss_conf             21023311467641
Q gi|254780263|r  162 DTPIIRGSALCALQ  175 (392)
Q Consensus       162 ~~pii~~sa~~g~~  175 (392)
                      ..+++.+||.++.+
T Consensus       138 ~~~~~E~SAk~~~n  151 (168)
T cd04177         138 NVPFYETSARKRTN  151 (168)
T ss_pred             CCEEEEECCCCCCC
T ss_conf             97799962487846


No 223
>cd01874 Cdc42 Cdc42 subfamily.  Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases.  These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway.  Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth.  In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus.  Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand.  In addi
Probab=98.67  E-value=1e-07  Score=66.95  Aligned_cols=143  Identities=17%  Similarity=0.149  Sum_probs=82.7

Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-E--EECCCEEEEEEECCCCHHHHHHH
Q ss_conf             27999990468988789999998764442001312686869862920637899-9--82199089998478730246779
Q gi|254780263|r   12 SLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-S--YETDKRFYSHIDCPGHADYVKNM   88 (392)
Q Consensus        12 ~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~--~~~~~~~i~iiD~PGH~~f~~~m   88 (392)
                      ++.|+++|....|||+|+-+.+...            .+++  ..-||...|. .  ...+...+.|.||+|+++|-.-.
T Consensus         1 svKvv~lGd~~VGKTsli~r~~~~~------------f~~~--y~pti~~~~~~~~~~~~~~v~l~iwDTaG~e~~~~l~   66 (175)
T cd01874           1 TIKCVVVGDGAVGKTCLLISYTTNK------------FPSE--YVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLR   66 (175)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHCC------------CCCC--CCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCHHHH
T ss_conf             9799998999958899999996498------------9998--6786347899999999999999999899974512465


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHHH-----HH--HHCCCCCEEEEECCCCCCCCHHHHHHC---------CCCCCE
Q ss_conf             87740023314520123443321067788-----88--631876023310023335612221101---------232100
Q gi|254780263|r   89 ITGATQADGAILVCAAEDGPKPQTREHIL-----LA--RQIGISSIVVYMNKVDAVDDDELLDIS---------EYEIRD  152 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G~~~QT~eh~~-----l~--~~lgi~~iIv~iNKmD~v~~~~~~~~i---------~~~i~~  152 (392)
                      -.-...+|+++||-|.++   ++|-+++.     .+  ..-++| +|++=||+|+.+..+..+..         .++-++
T Consensus        67 ~~~~~~~~~~ilvydv~d---~~Sf~~i~~~w~~~i~~~~~~~p-~iLVGnK~DL~~~~~~~~~~~~~~~r~V~~~eg~~  142 (175)
T cd01874          67 PLSYPQTDVFLVCFSVVS---PSSFENVKEKWVPEITHHCPKTP-FLLVGTQIDLRDDPSTIEKLAKNKQKPITPETGEK  142 (175)
T ss_pred             HHHHHCCCEEEEEEECCC---HHHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             887713888899963798---78899999999999998298998-89999872033566667776440265668999999


Q ss_pred             EEEEEEEEEEEECCCCEEEEEEE
Q ss_conf             11101453221023311467641
Q gi|254780263|r  153 LLKEHKYSDDTPIIRGSALCALQ  175 (392)
Q Consensus       153 ~l~~~~~~~~~pii~~sa~~g~~  175 (392)
                      +-++.+   ..+++.+||.+|.+
T Consensus       143 lA~~~~---~~~y~EtSAk~g~n  162 (175)
T cd01874         143 LARDLK---AVKYVECSALTQKG  162 (175)
T ss_pred             HHHHCC---CCEEEECCCCCCCC
T ss_conf             999759---95999913378959


No 224
>cd01871 Rac1_like Rac1-like subfamily.  The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1.  While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively.  Rac1 stimulates the formation of actin lamellipodia and membrane ruffles.  It also plays a role in cell-matrix adhesion and cell anoikis.  In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis.  Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation.  In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis.  Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti
Probab=98.67  E-value=9.2e-08  Score=67.20  Aligned_cols=142  Identities=18%  Similarity=0.133  Sum_probs=83.1

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE---EEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869862920637899---9821990899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV---SYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~---~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      +.++++|-...|||+|+-++...            ..++|  .--|+...+.   ........+.|.||+|+++|-.-.-
T Consensus         2 iKivlvGd~~VGKTsli~r~~~~------------~f~~~--~~~Ti~~~~~~~i~~~~~~v~l~iwDtaGqe~~~~~~~   67 (174)
T cd01871           2 IKCVVVGDGAVGKTCLLISYTTN------------AFPGE--YIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRP   67 (174)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHC------------CCCCC--CCCEEEEEEEEEEEECCEEEEEEEECCCCCCCCHHHHH
T ss_conf             69999899998699999999739------------99998--68837887679999999999999986999724067889


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHH------HHH-HHCCCCCEEEEECCCCCCCCHHHHHHCC---------CCCCEE
Q ss_conf             774002331452012344332106778------888-6318760233100233356122211012---------321001
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHI------LLA-RQIGISSIVVYMNKVDAVDDDELLDISE---------YEIRDL  153 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~------~l~-~~lgi~~iIv~iNKmD~v~~~~~~~~i~---------~~i~~~  153 (392)
                      .-...+|++|||-|.++-   +|-+++      .+. ..-++| +|++=||+|+.+..+..+...         .+-..+
T Consensus        68 ~~~~~a~~~ilvydi~~~---~SF~~i~~~w~~~i~~~~~~~p-iiLVGnK~DL~~~~~~~~~~~~~~~~~vs~~eg~~~  143 (174)
T cd01871          68 LSYPQTDVFLICFSLVSP---ASFENVRAKWYPEVRHHCPNTP-IILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAM  143 (174)
T ss_pred             HHHHHCCEEEEEEECCCH---HHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             987406689999867987---8899999999999998588999-798747301310045677886514677589999999


Q ss_pred             EEEEEEEEEEECCCCEEEEEEE
Q ss_conf             1101453221023311467641
Q gi|254780263|r  154 LKEHKYSDDTPIIRGSALCALQ  175 (392)
Q Consensus       154 l~~~~~~~~~pii~~sa~~g~~  175 (392)
                      -++.   ...+++.+||.++.+
T Consensus       144 a~~~---~~~~f~EtSAk~~~n  162 (174)
T cd01871         144 AKEI---GAVKYLECSALTQKG  162 (174)
T ss_pred             HHHC---CCCEEEECCCCCCCC
T ss_conf             9875---997899918788959


No 225
>cd01864 Rab19 Rab19 subfamily.  Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=98.66  E-value=6e-08  Score=68.34  Aligned_cols=141  Identities=16%  Similarity=0.168  Sum_probs=80.8

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC--CEEEEEEECCCCHHHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789998219--908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD--KRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~--~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.|+++|.-..|||+|+.++...            ...++...-+..+.....+..+  ...+.|.||+|.++|-.-.-.
T Consensus         4 ~Kiv~lGd~~vGKTsli~r~~~~------------~f~~~~~~Ti~~~~~~k~i~~~~~~~~l~iwDtaG~e~~~~l~~~   71 (165)
T cd01864           4 FKIILIGDSNVGKTCVVQRFKSG------------TFSERQGNTIGVDFTMKTLEIEGKRVKLQIWDTAGQERFRTITQS   71 (165)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCCHH
T ss_conf             99999999995899999999649------------999987997543789999999999999999989998344535075


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHH----HHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEE
Q ss_conf             74002331452012344332106778----888631---87602331002333561222110123210011101453221
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHI----LLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDT  163 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~----~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~  163 (392)
                      -...+|++|||.|.+.-   +|-+.+    .-++..   ++| +|++=||+|+.+..+   ...++..++.++.+.   .
T Consensus        72 ~~~~a~~~ilvydit~~---~Sf~~~~~w~~~i~~~~~~~~~-iilVGNK~DL~~~r~---V~~~~~~~~a~~~~~---~  141 (165)
T cd01864          72 YYRSANGAIIAYDITRR---SSFESVPHWIEEVEKYGASNVV-LLLIGNKCDLEEQRE---VLFEEACTLAEKNGM---L  141 (165)
T ss_pred             HEECCCEEEEEECCCCH---HHHHHHHHHHHHHHHHCCCCCC-EEEEEECCCHHHHCC---CCHHHHHHHHHHCCC---C
T ss_conf             52215666997138998---9999999999999987699984-388877237686289---999999999998399---7


Q ss_pred             ECCCCEEEEEEE
Q ss_conf             023311467641
Q gi|254780263|r  164 PIIRGSALCALQ  175 (392)
Q Consensus       164 pii~~sa~~g~~  175 (392)
                      .++.+||.+|.+
T Consensus       142 ~~~E~SAk~~~n  153 (165)
T cd01864         142 AVLETSAKESQN  153 (165)
T ss_pred             EEEEECCCCCCC
T ss_conf             699978885819


No 226
>cd04120 Rab12 Rab12 subfamily.  Rab12 was first identified in canine cells, where it was localized to the Golgi complex.  The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported.  More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic
Probab=98.66  E-value=3.8e-08  Score=69.57  Aligned_cols=141  Identities=21%  Similarity=0.185  Sum_probs=81.1

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC--CCEEEEEEECCCCHHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378999821--9908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET--DKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~--~~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      |.|+++|-..-|||+|+-++...            ...++-...+-++.....+..  ....+.|-||+|++.|-.-.-.
T Consensus         1 lKIvllGd~gVGKTsLi~rf~~~------------~F~~~y~~Tig~d~~~k~i~~~~~~v~l~IWDTaGqe~f~sl~~~   68 (202)
T cd04120           1 LQVIIIGSRGVGKTSLMRRFTDD------------TFCEACKSGVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSA   68 (202)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHHH
T ss_conf             98999997997299999999549------------999987997646889999999999999999979886124523578


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHH----HHHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEE
Q ss_conf             74002331452012344332106778----88863---187602331002333561222110123210011101453221
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHI----LLARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDT  163 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~----~l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~  163 (392)
                      -...|+++|||.|.+.-   +|-+++    ..+..   -.++ ++++=||+|+.+.-+   ...++.+++.++..   ..
T Consensus        69 yyr~a~~~ilVyDit~~---~SF~~l~~W~~~i~~~~~~~~~-iiLVGNK~DL~~~R~---Vs~~e~~~~A~~~~---~~  138 (202)
T cd04120          69 YYRSAKGIILVYDITKK---ETFDDLPKWMKMIDKYASEDAE-LLLVGNKLDCETDRE---ISRQQGEKFAQQIT---GM  138 (202)
T ss_pred             HHHHHCEEEEEEECCCH---HHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCCHHHCC---CCHHHHHHHHHHCC---CC
T ss_conf             87641445899856888---9999999999999974668871-898765365053178---79999999998279---98


Q ss_pred             ECCCCEEEEEEE
Q ss_conf             023311467641
Q gi|254780263|r  164 PIIRGSALCALQ  175 (392)
Q Consensus       164 pii~~sa~~g~~  175 (392)
                      +++.+||.++.+
T Consensus       139 ~f~EtSAkt~~n  150 (202)
T cd04120         139 RFCEASAKDNFN  150 (202)
T ss_pred             EEEECCCCCCCC
T ss_conf             899925899969


No 227
>pfam00350 Dynamin_N Dynamin family.
Probab=98.66  E-value=1.2e-07  Score=66.43  Aligned_cols=62  Identities=18%  Similarity=0.144  Sum_probs=39.3

Q ss_pred             CCEEEEEEECCC-------CHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHH-HHHHCCCCCEEEEECCC
Q ss_conf             990899984787-------3024677987740023314520123443321067788-88631876023310023
Q gi|254780263|r   69 DKRFYSHIDCPG-------HADYVKNMITGATQADGAILVCAAEDGPKPQTREHIL-LARQIGISSIVVYMNKV  134 (392)
Q Consensus        69 ~~~~i~iiD~PG-------H~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~-l~~~lgi~~iIv~iNKm  134 (392)
                      ....++||||||       |++.+.+.+   ..+|+.|.|++|...+..|-.+-+. .+...+-+ .++++||.
T Consensus        99 ~~~~l~lvDtPGl~s~~~~~~~~t~~~i---~~~d~il~V~~a~~~~~~~~~~~l~~~~d~~~~r-~i~V~tk~  168 (168)
T pfam00350        99 LVPGLTLVDTPGLDSVAVGDQDLTEEYI---KPADIILAVVDANHDLSTSEALFLAREVDPNGKR-TIGVLTKD  168 (168)
T ss_pred             CCCCEEEEECCCCCCCCCCCHHHHHHHH---HHCCEEEEEEECCCCHHHHHHHHHHHHHCCCCCE-EEEEECCC
T ss_conf             8888189827986544433699999998---5386699998469516661999999973999983-89998188


No 228
>cd01892 Miro2 Miro2 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the putative GTPase domain in the C terminus of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=98.66  E-value=1.4e-07  Score=66.12  Aligned_cols=143  Identities=14%  Similarity=0.039  Sum_probs=82.7

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHH-HHHHHHCCCCCCCCHHHHHCCCEEEEE--EEEEECCCEEEEEEECCCCHHHHH
Q ss_conf             88279999904689887899999987-644420013126868698629206378--999821990899984787302467
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKY-YSEEKKEYGDIDSAPEEKLRGITIATA--HVSYETDKRFYSHIDCPGHADYVK   86 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~-~~~~~~~~~~~D~~~~E~~rGiTi~~~--~~~~~~~~~~i~iiD~PGH~~f~~   86 (392)
                      |.-+++.++|....|||+|+.++... ...            +...--+..+..  ......+...+.|-||+|++.|..
T Consensus         2 r~vfk~~VlG~~~VGKTsLi~rf~~~~f~~------------~~y~~Ti~~~~~~k~v~v~g~~~~L~i~Dt~g~e~~~~   69 (169)
T cd01892           2 RNVFLCFVLGAKGSGKSALLRAFLGRSFSL------------NAYSPTIKPRYAVNTVEVYGQEKYLILREVGEDEVAIL   69 (169)
T ss_pred             CEEEEEEEECCCCCCHHHHHHHHHCCCCCC------------CCCCCCCCCEEEEEEEEECCEEEEEEEEECCCCHHHHH
T ss_conf             508999999999988999999996499986------------66567546618999999899999999985565323556


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCHHHHHHH----H-HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             79877400233145201234433210677888----8-631876023310023335612221101232100111014532
Q gi|254780263|r   87 NMITGATQADGAILVCAAEDGPKPQTREHILL----A-RQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        87 ~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l----~-~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      -.-.-...+|+++||-|.++-   ++=+++.-    . ..-.+| ++++=||.|+.+..+.   ...+.+++.++.+.. 
T Consensus        70 l~~~~~~~ad~~ilVyDit~~---~SF~~i~~~~~~~~~~~~iP-~vlVgNK~DL~~~rqV---~~~e~~~~a~~~~~~-  141 (169)
T cd01892          70 LNDAELAACDVACLVYDSSDP---KSFSYCAEVYKKYFMLGEIP-CLFVAAKADLDEQQQR---YEVQPDEFCRKLGLP-  141 (169)
T ss_pred             HHHHHHCCCCEEEEEEECCCH---HHHHHHHHHHHHHHCCCCCC-EEEEEECCCCCCCCCC---CHHHHHHHHHHCCCC-
T ss_conf             658875469889999979987---89999999999700568981-8999886554203754---677699999983999-


Q ss_pred             EEECCCCEEEEEE
Q ss_conf             2102331146764
Q gi|254780263|r  162 DTPIIRGSALCAL  174 (392)
Q Consensus       162 ~~pii~~sa~~g~  174 (392)
                        +.+.+||.+|.
T Consensus       142 --~~~e~SAktg~  152 (169)
T cd01892         142 --PPLHFSSKLGD  152 (169)
T ss_pred             --CCEEEEEECCC
T ss_conf             --66699832798


No 229
>cd04147 Ras_dva Ras-dva subfamily.  Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date.  In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm.  Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1.  Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9.  Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=98.66  E-value=6.5e-08  Score=68.13  Aligned_cols=152  Identities=17%  Similarity=0.145  Sum_probs=84.3

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE-EEEEEEEEC--CCEEEEEEECCCCHHHHHHHHHH
Q ss_conf             999904689887899999987644420013126868698629206-378999821--99089998478730246779877
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI-ATAHVSYET--DKRFYSHIDCPGHADYVKNMITG   91 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi-~~~~~~~~~--~~~~i~iiD~PGH~~f~~~mi~g   91 (392)
                      |+++|...-|||+|+-+.+...            ..++  .--|+ +.....++.  ....+.|.||+|.+.|-.-.-.-
T Consensus         2 IvvlGd~~VGKTSLi~rf~~~~------------F~~~--y~~Ti~~~~~k~~~v~~~~v~l~i~DtaG~e~~~~l~~~~   67 (198)
T cd04147           2 LVFMGAAGVGKTALIQRFLYDT------------FEPK--YRRTVEEMHRKEYEVGGVSLTLDILDTSGSYSFPAMRKLS   67 (198)
T ss_pred             EEEECCCCCCHHHHHHHHHHCC------------CCCC--CCCCHHHEEEEEEEECCEEEEEEEEECCCCCCCHHHHHHH
T ss_conf             8999989977999999998598------------9988--8887254188999989979999999787751301455554


Q ss_pred             HHCCCCEEEEECCCCCCCCCHHHHH--HHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             4002331452012344332106778--888631---87602331002333561222110123210011101453221023
Q gi|254780263|r   92 ATQADGAILVCAAEDGPKPQTREHI--LLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        92 ~~~~D~ailvVda~~G~~~QT~eh~--~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
                      ...+|++|||-|.++--.=+.-+.+  .+.+..   .+| +|++-||+|+...++...  .++..++...   ..+.+++
T Consensus        68 ~r~a~~~ilVyDit~~~Sf~~l~~w~~~i~~~~~~~~ip-iilVGNK~Dll~~~R~V~--~~e~~~~a~~---~~~~~f~  141 (198)
T cd04147          68 IQNSDAFALVYAVDDPESFEEVERLREEILEVKEDKFVP-IVVVGNKADSLEEERQVP--AKDALSTVEL---DWNCGFV  141 (198)
T ss_pred             CCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCC-EEEEEECCCCCCCCCCCC--HHHHHHHHHH---CCCCEEE
T ss_conf             158866899961697799999999999999962888982-899987876501047848--9999999985---5997899


Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHCC
Q ss_conf             311467641144456521233203443102
Q gi|254780263|r  167 RGSALCALQGTNKELGEDSIHALMKAVDTH  196 (392)
Q Consensus       167 ~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~  196 (392)
                      .+||.+|.+          +..+++.|...
T Consensus       142 EtSAktg~n----------V~e~F~~l~r~  161 (198)
T cd04147         142 ETSAKDNEN----------VLEVFKELLRQ  161 (198)
T ss_pred             ECCCCCCCC----------HHHHHHHHHHH
T ss_conf             877999949----------89999999999


No 230
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes.  Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species.  Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria.  Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs.  No clear phenotype has been found for mutants in the yeast homologue of mtEFG2, MEF2.  There are two forms of mtEFG present in mammals (designated mtEFG1s and mtEFG2s) mtEFG1s are n
Probab=98.65  E-value=2.1e-08  Score=71.13  Aligned_cols=80  Identities=14%  Similarity=0.053  Sum_probs=59.0

Q ss_pred             EECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCC-CCCCCCCCCCCHHHHHHHCCCCCCEEECH
Q ss_conf             00000013554454301487424534896799950687432125412100-12114432100136664112454322021
Q gi|254780263|r  210 MHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEM-FRKKLDEAIAGDNVGLLLRGVNRADVPRG  288 (392)
Q Consensus       210 ~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~-~~~~v~~a~aGd~v~l~Lkgi~~~di~rG  288 (392)
                      ..|+++..++++|.+.+.||.||+|+.|+++.....+......++..++. .+++++++.|||++++.    ...+.+.|
T Consensus         3 AlVFK~~~D~~~G~ls~vRVysG~l~~g~~v~n~~~~~~ekv~~l~~~~g~~~~~v~~~~AGdI~av~----gl~~~~tG   78 (83)
T cd04092           3 ALAFKVVHDPQRGPLTFVRVYSGTLKRGSALYNTNTGKKERISRLLQPFADQYQEIPSLSAGNIGVIT----GLKQTRTG   78 (83)
T ss_pred             EEEEEEECCCCCCCEEEEEEEECEECCCCEEEECCCCCEEEEEEEEEEECCCCEECCEECCCCEEEEE----CCCCCCCC
T ss_conf             99998650798440999999707897899999688996297308889757993299789699899997----87786038


Q ss_pred             HEEEC
Q ss_conf             17732
Q gi|254780263|r  289 RVVCA  293 (392)
Q Consensus       289 dvl~~  293 (392)
                      |+||.
T Consensus        79 DTltt   83 (83)
T cd04092          79 DTLVT   83 (83)
T ss_pred             CEECC
T ss_conf             89759


No 231
>cd04132 Rho4_like Rho4-like subfamily.  Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis.  Rho4 also plays a role in cell morphogenesis.  Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules.  The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP.  In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=98.65  E-value=9.8e-08  Score=67.03  Aligned_cols=144  Identities=17%  Similarity=0.133  Sum_probs=80.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-EEEC-CC--EEEEEEECCCCHHHHHHHH
Q ss_conf             999990468988789999998764442001312686869862920637899-9821-99--0899984787302467798
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-SYET-DK--RFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~~~~-~~--~~i~iiD~PGH~~f~~~mi   89 (392)
                      .|+++|...-|||+|+-++...            ..+++  ..-|+-..+. .... ++  ..+.|.||+|+++|-.-.-
T Consensus         2 KivlvGd~~VGKTsli~r~~~~------------~F~~~--~~pTi~~~~~~~~~~~~~~~v~l~iwDtaG~e~~~~l~~   67 (187)
T cd04132           2 KIVVVGDGGCGKTCLLIVYSQG------------KFPEE--YVPTVFENYVTNIQGPNGKIIELALWDTAGQEEYDRLRP   67 (187)
T ss_pred             EEEEECCCCCCHHHHHHHHHHC------------CCCCC--CCCCEEEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHH
T ss_conf             8999994997699999999639------------89997--589664799999995499899999996999711053434


Q ss_pred             HHHHCCCCEEEEECCCCCCC-CCHHHHH-HHHHH--CCCCCEEEEECCCCCCCCHHHHHHC-CCCCCEEEEEEEEEEEEE
Q ss_conf             77400233145201234433-2106778-88863--1876023310023335612221101-232100111014532210
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPK-PQTREHI-LLARQ--IGISSIVVYMNKVDAVDDDELLDIS-EYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~-~QT~eh~-~l~~~--lgi~~iIv~iNKmD~v~~~~~~~~i-~~~i~~~l~~~~~~~~~p  164 (392)
                      .....+|++|||.|.+.-.. ..-.+++ ..++.  -.+| +|++-||.|+.+..+....+ .++...+-+..+   ..+
T Consensus        68 ~~~~~a~~~ilvydit~~~Sf~~i~~~W~~~i~~~~~~~p-iilVgnK~DL~~~~~~~~~v~~e~~~~~a~~~~---~~~  143 (187)
T cd04132          68 LSYPDVDVLLICYAVDNPTSLDNVEDKWFPEVNHFCPGTP-IMLVGLKTDLRKDKNLDRKVTPAQAESVAKKQG---AFA  143 (187)
T ss_pred             HHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCC-EEEEEECCHHHHHHCCCCCCCHHHHHHHHHHCC---CCE
T ss_conf             4530034888950368767799999999999998689999-799998722122122376578999999999859---978


Q ss_pred             CCCCEEEEEEE
Q ss_conf             23311467641
Q gi|254780263|r  165 IIRGSALCALQ  175 (392)
Q Consensus       165 ii~~sa~~g~~  175 (392)
                      ++.+||.++.+
T Consensus       144 y~EtSAk~g~n  154 (187)
T cd04132         144 YLECSAKTMEN  154 (187)
T ss_pred             EEEECCCCCCC
T ss_conf             99957688929


No 232
>cd04118 Rab24 Rab24 subfamily.  Rab24 is distinct from other Rabs in several ways.  It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments.  It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=98.64  E-value=1.1e-07  Score=66.73  Aligned_cols=142  Identities=18%  Similarity=0.133  Sum_probs=84.3

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE--EEEECCC--EEEEEEECCCCHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789--9982199--089998478730246779
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH--VSYETDK--RFYSHIDCPGHADYVKNM   88 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~--~~~~~~~--~~i~iiD~PGH~~f~~~m   88 (392)
                      +.|+++|....|||+|+-++....-        .+.     ..--|+...+  ..+..++  ..+.|.||+|.+.|-.-.
T Consensus         1 vKivlvGd~~VGKTsLi~r~~~~~f--------~~~-----~y~~tig~~~~~k~i~v~~~~v~l~iwDtaG~e~~~~l~   67 (193)
T cd04118           1 VKVVMLGKESVGKTSLVERYVHHRF--------LVG-----PYQNTIGAAFVAKRMVVGERVVTLGIWDTAGSERYEAMS   67 (193)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCC--------CCC-----CCCCCCEEEEEEEEEEECCEEEEEEEEECCCCHHHHHHH
T ss_conf             9899999699879999999985979--------989-----978763058899999999999999999199973123557


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHH----HHHH--HCCCCCEEEEECCCCCCCCHH-HHHHCCCCCCEEEEEEEEEE
Q ss_conf             8774002331452012344332106778----8886--318760233100233356122-21101232100111014532
Q gi|254780263|r   89 ITGATQADGAILVCAAEDGPKPQTREHI----LLAR--QIGISSIVVYMNKVDAVDDDE-LLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G~~~QT~eh~----~l~~--~lgi~~iIv~iNKmD~v~~~~-~~~~i~~~i~~~l~~~~~~~  161 (392)
                      -.-...+|++|||.|.++-   +|-+.+    ..++  .-.+| ++++-||+|+.+.++ .-+...++..++.++.+   
T Consensus        68 ~~y~~~a~~~ilvydit~~---~Sf~~i~~W~~~i~~~~~~~~-iilVGnK~DL~~~~~~~r~V~~~e~~~~a~~~~---  140 (193)
T cd04118          68 RIYYRGAKAAIVCYDLTDS---SSFERAKFWVKELQNLEEHCK-IYLCGTKSDLIEQDRSLRQVDFHDVQDFADEIK---  140 (193)
T ss_pred             HHHHCCCCEEEEEECCCCH---HHHHHHHHHHHHHHHHCCCCC-EEEEEECHHHHHCCCCCCCCCHHHHHHHHHHCC---
T ss_conf             9883477445788306987---999989999999997489999-799977466322016664468999999999809---


Q ss_pred             EEECCCCEEEEEEE
Q ss_conf             21023311467641
Q gi|254780263|r  162 DTPIIRGSALCALQ  175 (392)
Q Consensus       162 ~~pii~~sa~~g~~  175 (392)
                       .+++.+||.+|.+
T Consensus       141 -~~~~E~SAktg~n  153 (193)
T cd04118         141 -AQHFETSSKTGQN  153 (193)
T ss_pred             -CEEEEECCCCCCC
T ss_conf             -9699983898939


No 233
>cd04140 ARHI_like ARHI subfamily.  ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties.  ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer.  ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity.   Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity.  ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Due to
Probab=98.63  E-value=8.6e-08  Score=67.38  Aligned_cols=151  Identities=18%  Similarity=0.132  Sum_probs=85.5

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-EEECCC--EEEEEEECCCCHHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869862920637899-982199--0899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-SYETDK--RFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~~~~~~--~~i~iiD~PGH~~f~~~mi   89 (392)
                      ..|+++|.-..|||+|+-++....            ..++  .--||.-.+. .+..++  ..+.|.||+|+++|-.-.-
T Consensus         2 ~KivllGd~~VGKTsli~r~~~~~------------F~~~--y~~Ti~~~~~~~i~~~~~~~~l~iwDtaG~e~~~~l~~   67 (165)
T cd04140           2 YRVVVFGAGGVGKSSLVLRFVKGT------------FRES--YIPTIEDTYRQVISCSKNICTLQITDTTGSHQFPAMQR   67 (165)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCC------------CCCC--CCCCCCCEEEEEEEECCEEEEEEEEECCCCCCCCCCHH
T ss_conf             099998999976999999996496------------9998--68845420558999999999999998999846542324


Q ss_pred             HHHHCCCCEEEEECCCCCCC-CCHHHHHHHHHH------CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEE
Q ss_conf             77400233145201234433-210677888863------18760233100233356122211012321001110145322
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPK-PQTREHILLARQ------IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDD  162 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~-~QT~eh~~l~~~------lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~  162 (392)
                      .-...+|++|||-|.+.-.. ..-+..+..++.      -.+| ++++-||+|+.+..+   ...++.+++.++.    +
T Consensus        68 ~~~~~a~~~ilvydit~~~Sf~~~~~~~~~i~~~~~~~~~~~p-iilVgNK~Dl~~~r~---V~~~e~~~~a~~~----~  139 (165)
T cd04140          68 LSISKGHAFILVYSVTSKQSLEELKPIYELICEIKGNNIEKIP-IMLVGNKCDESHKRE---VSSNEGAACATEW----N  139 (165)
T ss_pred             HHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCCCCC-EEEEEECCCCCCCCC---CCHHHHHHHHHHC----C
T ss_conf             4506885799981389878999999999999999615888887-899864246400278---8999999999986----9


Q ss_pred             EECCCCEEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             102331146764114445652123320344310
Q gi|254780263|r  163 TPIIRGSALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       163 ~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                      .+++.+||.+|.+          +..+++.|.+
T Consensus       140 ~~~~E~SAk~~~n----------V~e~F~~l~~  162 (165)
T cd04140         140 CAFMETSAKTNHN----------VQELFQELLN  162 (165)
T ss_pred             CEEEEECCCCCCC----------HHHHHHHHHH
T ss_conf             8899974477948----------7999999981


No 234
>KOG1489 consensus
Probab=98.63  E-value=1.4e-07  Score=66.03  Aligned_cols=136  Identities=16%  Similarity=0.245  Sum_probs=77.3

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEE-EEEEECCC-----C-----
Q ss_conf             799999046898878999999876444200131268686986292063789998219908-99984787-----3-----
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRF-YSHIDCPG-----H-----   81 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~-i~iiD~PG-----H-----   81 (392)
                      -+++.+|-.+||||||+.+|+....+.+.. ..+--.+         .++.  ..++++. |++-|.||     |     
T Consensus       197 advGLVG~PNAGKSTLL~als~AKpkVa~Y-aFTTL~P---------~iG~--v~yddf~q~tVADiPGiI~GAh~nkGl  264 (366)
T KOG1489         197 ADVGLVGFPNAGKSTLLNALSRAKPKVAHY-AFTTLRP---------HIGT--VNYDDFSQITVADIPGIIEGAHMNKGL  264 (366)
T ss_pred             CCCCEECCCCCCHHHHHHHHHCCCCCCCCC-CEEEECC---------CCCE--EECCCCCEEEECCCCCCCCCCCCCCCC
T ss_conf             554321289886788987764058754554-2034446---------4112--513545146850476534454346765


Q ss_pred             -HHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHH--------HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCE
Q ss_conf             -02467798774002331452012344332106778888--------631876023310023335612221101232100
Q gi|254780263|r   82 -ADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLA--------RQIGISSIVVYMNKVDAVDDDELLDISEYEIRD  152 (392)
Q Consensus        82 -~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~--------~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~  152 (392)
                       -+|+|...|    ++.-++|||...+..----++++++        .-+.=++.+|+.||||+.+.++-+  . +++.+
T Consensus       265 G~~FLrHiER----~~~l~fVvD~s~~~~~~p~~~~~lL~~ELe~yek~L~~rp~liVaNKiD~~eae~~~--l-~~L~~  337 (366)
T KOG1489         265 GYKFLRHIER----CKGLLFVVDLSGKQLRNPWQQLQLLIEELELYEKGLADRPALIVANKIDLPEAEKNL--L-SSLAK  337 (366)
T ss_pred             CHHHHHHHHH----HCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHH--H-HHHHH
T ss_conf             4899998875----334899997787555887899999999999986542358538997446736678889--9-99998


Q ss_pred             EEEEEEEEEEEECCCCEEEEE
Q ss_conf             111014532210233114676
Q gi|254780263|r  153 LLKEHKYSDDTPIIRGSALCA  173 (392)
Q Consensus       153 ~l~~~~~~~~~pii~~sa~~g  173 (392)
                      .|..      ..++|+||.++
T Consensus       338 ~lq~------~~V~pvsA~~~  352 (366)
T KOG1489         338 RLQN------PHVVPVSAKSG  352 (366)
T ss_pred             HCCC------CCEEEEEECCC
T ss_conf             7379------81787640046


No 235
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane. The N-terminal domain of LepA shares regions of homology to translation factors. In terms of interaction with the ribosome, EF-G, EF-Tu and IF2 have all been demonstrated to interact at overlapping sites on the ribosome. Chemical protection studies demonstrate that they all include the universally conserved alpha-sarcin loop as part of their binding site. These data indicate that LepA may bind to this location on the ribosome as well.  LepA has never been observed in archaea, and eukaryl LepA is organellar. LepA is therefore a true bacterial GTPase, found only in the bacterial lineage.
Probab=98.63  E-value=2.7e-08  Score=70.53  Aligned_cols=84  Identities=19%  Similarity=0.194  Sum_probs=65.9

Q ss_pred             CCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCC-CCCEEE
Q ss_conf             1000000013554454301487424534896799950687432125412100121144321001366641124-543220
Q gi|254780263|r  208 FLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGV-NRADVP  286 (392)
Q Consensus       208 ~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi-~~~di~  286 (392)
                      ||..|.++++++++|.++..||.+|+|++||++.++..+.+....++.-+.....++++..|||. |.-+.|+ +..|++
T Consensus         1 LrALifDS~yD~y~Gvv~~vRV~~G~lk~gd~i~~~~t~~~~~v~evG~~~P~~~~~~~L~aGeV-Gyii~gik~~~d~~   79 (86)
T cd03699           1 LRALIFDSWYDPYRGVIALVRVFDGTLKKGDKIRFMSTGKEYEVEEVGIFRPEMTPTDELSAGQV-GYIIAGIKTVKDAR   79 (86)
T ss_pred             CEEEEEEEEECCCCCEEEEEEEECCEECCCCEEEHHHCCCCCEEEEEEECCCCCCCCCEECCCCC-CEEEECCCCCCCCC
T ss_conf             90899986722788789999997999917985223348996385598871799763884947840-48997342015573


Q ss_pred             CHHEEE
Q ss_conf             211773
Q gi|254780263|r  287 RGRVVC  292 (392)
Q Consensus       287 rGdvl~  292 (392)
                      .||+|+
T Consensus        80 vGDTit   85 (86)
T cd03699          80 VGDTIT   85 (86)
T ss_pred             CCCEEE
T ss_conf             447875


No 236
>cd01875 RhoG RhoG subfamily.  RhoG is a GTPase with high sequence similarity to members of the Rac subfamily, including the regions involved in effector recognition and binding.  However, RhoG does not bind to known Rac1 and Cdc42 effectors, including proteins containing a Cdc42/Rac interacting binding (CRIB) motif.  Instead, RhoG interacts directly with Elmo, an upstream regulator of Rac1, in a GTP-dependent manner and forms a ternary complex with Dock180 to induce activation of Rac1.  The RhoG-Elmo-Dock180 pathway is required for activation of Rac1 and cell spreading mediated by integrin, as well as for neurite outgrowth induced by nerve growth factor.  Thus RhoG activates Rac1 through Elmo and Dock180 to control cell morphology.  RhoG has also been shown to play a role in caveolar trafficking and has a novel role in signaling the neutrophil respiratory burst stimulated by G protein-coupled receptor (GPCR) agonists.  Most Rho proteins contain a lipid modification site at the C-termin
Probab=98.62  E-value=1.8e-07  Score=65.39  Aligned_cols=154  Identities=17%  Similarity=0.140  Sum_probs=85.4

Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE---EEECCCEEEEEEECCCCHHHHHHH
Q ss_conf             27999990468988789999998764442001312686869862920637899---982199089998478730246779
Q gi|254780263|r   12 SLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV---SYETDKRFYSHIDCPGHADYVKNM   88 (392)
Q Consensus        12 ~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~---~~~~~~~~i~iiD~PGH~~f~~~m   88 (392)
                      ++.|+++|.-..|||+|+-++....            ..+|-  --|+...+.   ..+.....+.|.||+|+++|-.-.
T Consensus         3 ~~KivlvGd~~VGKTsli~r~~~~~------------F~~~y--~pti~~~~~~~~~i~~~~v~l~iwDtaG~e~~~~~~   68 (191)
T cd01875           3 SIKCVVVGDGAVGKTCLLICYTTNA------------FPKEY--IPTVFDNYSAQTAVDGRTVSLNLWDTAGQEEYDRLR   68 (191)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHCC------------CCCCC--CCCCCEEEEEEEEECCEEEEEEEEECCCCCCHHHHH
T ss_conf             1899999999989999999997299------------99864--662100046789999999999998588870035677


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHH------HHHHH-CCCCCEEEEECCCCCCCCHHHHHHCCC---------CCCE
Q ss_conf             8774002331452012344332106778------88863-187602331002333561222110123---------2100
Q gi|254780263|r   89 ITGATQADGAILVCAAEDGPKPQTREHI------LLARQ-IGISSIVVYMNKVDAVDDDELLDISEY---------EIRD  152 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G~~~QT~eh~------~l~~~-lgi~~iIv~iNKmD~v~~~~~~~~i~~---------~i~~  152 (392)
                      -.....+|++|||.|-+.-   +|-+++      .+... -++| ++++=||.|+.++.+......+         +-..
T Consensus        69 ~~~~~~a~~~ilvfdvt~~---~Sf~~v~~~w~~ei~~~~~~~p-iiLvGnK~DL~~~~~~~~~~~e~~~~~vs~eeg~~  144 (191)
T cd01875          69 TLSYPQTNVFIICFSIASP---SSYENVRHKWHPEVCHHCPNVP-ILLVGTKKDLRNDADTLKKLKEQGQAPITPQQGGA  144 (191)
T ss_pred             HHHHCCCCEEEEEEECCCH---HHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             8774478689999857977---8899999999999997096997-89998880102345778887764137556999999


Q ss_pred             EEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCC
Q ss_conf             11101453221023311467641144456521233203443102
Q gi|254780263|r  153 LLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTH  196 (392)
Q Consensus       153 ~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~  196 (392)
                      +-++.+   ..+++.+||.++.          ++..+++.+...
T Consensus       145 ~a~~~~---~~~y~EtSAkt~~----------nV~e~F~~l~k~  175 (191)
T cd01875         145 LAKQIH---AVKYLECSALNQD----------GVKEVFAEAVRA  175 (191)
T ss_pred             HHHHHC---CCEEEECCCCCCC----------CHHHHHHHHHHH
T ss_conf             999809---9889990689896----------989999999999


No 237
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=98.62  E-value=6.4e-08  Score=68.18  Aligned_cols=144  Identities=17%  Similarity=0.129  Sum_probs=81.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC--CEEEEEEECCCCHHHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789998219--908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD--KRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~--~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      +.|+++|.-..|||+|+.++...            ...++-..-+.++........+  ...+.|.||+|.++|-.-.-.
T Consensus         2 ~KivllGd~~VGKTsli~r~~~~------------~f~~~y~~Tig~~~~~k~i~~~~~~i~l~iwDtaGqe~~~~l~~~   69 (165)
T cd01865           2 FKLLIIGNSSVGKTSFLFRYADD------------SFTSAFVSTVGIDFKVKTVFRNDKRVKLQIWDTAGQERYRTITTA   69 (165)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHHH
T ss_conf             89999999996889999999249------------889976887637879999999999999999969998345544154


Q ss_pred             HHHCCCCEEEEECCCCCCC-CCHHHHHHHHHHC--CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCC
Q ss_conf             7400233145201234433-2106778888631--876023310023335612221101232100111014532210233
Q gi|254780263|r   91 GATQADGAILVCAAEDGPK-PQTREHILLARQI--GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIR  167 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~-~QT~eh~~l~~~l--gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~  167 (392)
                      -...+|+++||.|.+.-.. ....+-+..++..  .-++++++-||.|+.+..+   ...++.+++.++.    +.+++.
T Consensus        70 y~~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~~~iilvgNK~DL~~~r~---v~~~~~~~~a~~~----~~~~~E  142 (165)
T cd01865          70 YYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERV---VSSERGRQLADQL----GFEFFE  142 (165)
T ss_pred             HHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCCC---CCHHHHHHHHHHC----CCEEEE
T ss_conf             411354489985178879999999999999986898725999602423555188---9999999999986----997999


Q ss_pred             CEEEEEEE
Q ss_conf             11467641
Q gi|254780263|r  168 GSALCALQ  175 (392)
Q Consensus       168 ~sa~~g~~  175 (392)
                      +||.++.+
T Consensus       143 ~SAk~~~n  150 (165)
T cd01865         143 ASAKENIN  150 (165)
T ss_pred             ECCCCCCC
T ss_conf             76898908


No 238
>cd04142 RRP22 RRP22 subfamily.  RRP22 (Ras-related protein on chromosome 22) subfamily consists of proteins that inhibit cell growth and promote caspase-independent cell death.  Unlike most Ras proteins, RRP22 is down-regulated in many human tumor cells due to promoter methylation.  RRP22 localizes to the nucleolus in a GTP-dependent manner, suggesting a novel function in modulating transport of nucleolar components.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Like most Ras family proteins, RRP22 is farnesylated.
Probab=98.61  E-value=1.2e-07  Score=66.50  Aligned_cols=142  Identities=18%  Similarity=0.157  Sum_probs=81.5

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHH--HCCCEEEEEEEEEECCCEEEEEEECCCCHHHHH----
Q ss_conf             79999904689887899999987644420013126868698--629206378999821990899984787302467----
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEK--LRGITIATAHVSYETDKRFYSHIDCPGHADYVK----   86 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~--~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~----   86 (392)
                      +.|+++|...-|||+|+-+.+..            ...++-  .-|...-..........+.+.|.||||...|-.    
T Consensus         1 iKivvlG~~gVGKTsli~rf~~~------------~F~~~y~pTig~~~~~k~v~~dg~~~~l~IwDtag~~~~~~tagq   68 (198)
T cd04142           1 VRVAVLGAPGVGKTAIVRQFLAQ------------EFPEEYIPTEHRRLYRPAVVLSGRVYDLHILDVPNMQRYPGTAGQ   68 (198)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCCCH
T ss_conf             98999997998999999999719------------888874784661678999999999999999958773045556521


Q ss_pred             ----HHHHHHHCCCCEEEEECCCCCCCCCHHHHHH-----HH--HHC--CCCCEEEEECCCCCCCCHHHHHHCCCCCCEE
Q ss_conf             ----7987740023314520123443321067788-----88--631--8760233100233356122211012321001
Q gi|254780263|r   87 ----NMITGATQADGAILVCAAEDGPKPQTREHIL-----LA--RQI--GISSIVVYMNKVDAVDDDELLDISEYEIRDL  153 (392)
Q Consensus        87 ----~mi~g~~~~D~ailvVda~~G~~~QT~eh~~-----l~--~~l--gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~  153 (392)
                          ..-+++..+|+++||-|.+.-   +|-+++.     +.  +..  .-+++|++=||.|+.+..+.   ..++...+
T Consensus        69 e~~~~r~~~ir~a~~~ilVydvt~~---~SF~~v~~~~~~i~~~~~~~~~~~piiLVGNK~DL~~~R~v---~~~~~~~~  142 (198)
T cd04142          69 EWMDPRFRGLRNSRAFILVYDICSP---DSFHYVKLLRQQILETRPAGNKEPPIVVVGNKRDQQRHRFA---PRHVLSVL  142 (198)
T ss_pred             HHHHHHHHHCCCCCEEEEEEECCCH---HHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCC---CHHHHHHH
T ss_conf             2355564401468889999988677---88899999999999985147999828998345431003568---89999999


Q ss_pred             EEEEEEEEEEECCCCEEEEEEE
Q ss_conf             1101453221023311467641
Q gi|254780263|r  154 LKEHKYSDDTPIIRGSALCALQ  175 (392)
Q Consensus       154 l~~~~~~~~~pii~~sa~~g~~  175 (392)
                      .++ .+  +.+++.+||.++.+
T Consensus       143 a~~-~~--~~~f~EtSAK~~~n  161 (198)
T cd04142         143 VRK-SW--KCGYLECSAKYNWH  161 (198)
T ss_pred             HHH-CC--CCEEEECCCCCCCC
T ss_conf             985-19--97699887889969


No 239
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily.  Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation.  It is expressed ubiquitously, with elevated levels in muscle and brain.  Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth.  TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell.  TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb.  The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb.  Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le
Probab=98.61  E-value=7.7e-08  Score=67.68  Aligned_cols=140  Identities=19%  Similarity=0.217  Sum_probs=79.6

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE---EEEECCCEEEEEEECCCCHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789---998219908999847873024677987
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH---VSYETDKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~---~~~~~~~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      .|+++|.-..|||+|+.+++...            ..++-.  -|+...+   .......+.+.|.||+|+++|..-.-.
T Consensus         3 KIvlvGd~~VGKTsli~r~~~~~------------f~~~y~--~Ti~~~~~k~i~~~~~~~~l~iwDtaG~e~~~~~~~~   68 (180)
T cd04137           3 KIAVLGSRSVGKSSLTVQFVEGH------------FVESYY--PTIENTFSKIIRYKGQDYHLEIVDTAGQDEYSILPQK   68 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCC------------CCCCCC--CCCCCCCCEEEEECCEEEEEEEEECCCCCCCCHHHHH
T ss_conf             89999989988999999997097------------899858--8124411379999999999999989987010066799


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHH--HHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEEC
Q ss_conf             74002331452012344332106778--888631---8760233100233356122211012321001110145322102
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHI--LLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPI  165 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~--~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pi  165 (392)
                      -...+|++|||.|.+.-..=+..+.+  .+.+..   .+| ++++-||+|+.+..+   ...++.+++.++.+    .++
T Consensus        69 ~~~~a~~~ilvydvt~~~Sf~~~~~~~~~~~~~~~~~~~p-iilVgNK~DL~~~r~---V~~~e~~~~a~~~~----~~f  140 (180)
T cd04137          69 YSIGIHGYILVYSVTSRKSFEVVKVIYDKILDMLGKESVP-IVLVGNKSDLHTQRQ---VSTEEGKELAESWG----AAF  140 (180)
T ss_pred             HHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEEEECCCCHHHCC---CCHHHHHHHHHHCC----CEE
T ss_conf             9863557899974388788999999999999975888886-797765346244078---89999999999839----989


Q ss_pred             CCCEEEEEEE
Q ss_conf             3311467641
Q gi|254780263|r  166 IRGSALCALQ  175 (392)
Q Consensus       166 i~~sa~~g~~  175 (392)
                      +.+||.+|.+
T Consensus       141 ~EtSAk~g~n  150 (180)
T cd04137         141 LESSARENEN  150 (180)
T ss_pred             EEECCCCCCC
T ss_conf             9977688919


No 240
>PRK13768 GTPase; Provisional
Probab=98.61  E-value=2e-07  Score=65.09  Aligned_cols=114  Identities=19%  Similarity=0.298  Sum_probs=71.3

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCC--C---------------------------------------------
Q ss_conf             99999046898878999999876444200131--2---------------------------------------------
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGD--I---------------------------------------------   46 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~--~---------------------------------------------   46 (392)
                      -+.++|-..+||||++.++.+.+...++....  +                                             
T Consensus         4 ~~~ViGpaGSGKsT~~~~l~~~l~~~~r~~~vvNLDPA~e~~pY~~~iDIRd~i~~~dVM~~~~LGPNGali~~~e~l~~   83 (253)
T PRK13768          4 IVFFLGTAGSGKTTLVGALSDWLEEQGYDVAIVNLDPAVEYLPYKPDIDVREYVSAREIMRKYGLGPNGALIASVDLLLT   83 (253)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHHCCHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             89998999998899999999999976997599978986658999988637861789999988198964689999999999


Q ss_pred             --CCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC------CHHHHHHHHHHHHC--CCCEEEEECCCCCCCCCHH---
Q ss_conf             --6868698629206378999821990899984787------30246779877400--2331452012344332106---
Q gi|254780263|r   47 --DSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG------HADYVKNMITGATQ--ADGAILVCAAEDGPKPQTR---  113 (392)
Q Consensus        47 --D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG------H~~f~~~mi~g~~~--~D~ailvVda~~G~~~QT~---  113 (392)
                        |+..+|.+             ..+..|-|+||||      |.+..+..+..++.  --+++.++|+.--..|.+-   
T Consensus        84 ~~d~l~~~i~-------------~~~~dY~i~D~PGQiElft~~~~~~~i~~~L~~~~~~~~v~l~D~~~~~~~~~fiS~  150 (253)
T PRK13768         84 KAEEIKEEIE-------------RLDADYVLVDTPGQMELFAFRESGRYLVEKLSSGSKSLSVYLIDAVLAKDPSDFVSL  150 (253)
T ss_pred             HHHHHHHHHH-------------HCCCCEEEEECCCCEEEEECCHHHHHHHHHHHCCCCEEEEEEECHHHHCCHHHHHHH
T ss_conf             8999999985-------------158875998268744322234079999999863686289998450563788799999


Q ss_pred             --HHHHHHHHCCCCCEEEEECCCCCCCCHH
Q ss_conf             --7788886318760233100233356122
Q gi|254780263|r  114 --EHILLARQIGISSIVVYMNKVDAVDDDE  141 (392)
Q Consensus       114 --eh~~l~~~lgi~~iIv~iNKmD~v~~~~  141 (392)
                        -.+.....+++|++. ++||+|+++.+.
T Consensus       151 ~L~a~s~m~~l~lP~in-VlsK~Dll~~~~  179 (253)
T PRK13768        151 LLLALSVQLRLGLPQIP-VLNKIDLLSEEE  179 (253)
T ss_pred             HHHHHHHHHHCCCCEEE-EEEHHHCCCHHH
T ss_conf             99999999973999799-867686278377


No 241
>cd04126 Rab20 Rab20 subfamily.  Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells.  It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells.  Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron.  It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo
Probab=98.61  E-value=1.4e-07  Score=66.12  Aligned_cols=108  Identities=19%  Similarity=0.150  Sum_probs=69.5

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378999821990899984787302467798774
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGA   92 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~   92 (392)
                      |.|+++|.-.-|||+|+-+....            ..+ |  .--||-..+..-.+..+.+.|-||+|+++|-.=.-.-.
T Consensus         1 lKivllGd~~VGKTsl~~rf~~~------------~F~-~--~~~Tig~~~~~k~~~~~~l~IwDTaGqE~f~sl~~~y~   65 (220)
T cd04126           1 LKVVLLGDMNVGKTSLLHRYMER------------RFK-D--TVSTVGGAFYLKQWGPYNISIWDTAGREQFHGLGSMYC   65 (220)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHC------------CCC-C--CCCCCCEEEEEEECCEEEEEEEECCCCCCCCCCHHHHH
T ss_conf             98999999998899999999729------------899-9--88871368999876478899994798622433268885


Q ss_pred             HCCCCEEEEECCCCCCCCCHHHHH-----HHHHHC--CCCCEEEEECCCCCCCC
Q ss_conf             002331452012344332106778-----888631--87602331002333561
Q gi|254780263|r   93 TQADGAILVCAAEDGPKPQTREHI-----LLARQI--GISSIVVYMNKVDAVDD  139 (392)
Q Consensus        93 ~~~D~ailvVda~~G~~~QT~eh~-----~l~~~l--gi~~iIv~iNKmD~v~~  139 (392)
                      ..||++|||.|.+.   .+|-+++     .+....  .++ +|++=||+|+++.
T Consensus        66 r~a~~~ilvyDit~---~~Sf~~l~~~~~~~~~~~~~~~~-~ilVGNK~DL~~~  115 (220)
T cd04126          66 RGAAAVILTYDVSN---VQSLEELEDRFLGLTDTANEDCL-FAVVGNKLDLTEE  115 (220)
T ss_pred             CCCCEEEEEEECCC---HHHHHHHHHHHHHHHHHCCCCCE-EEEEEECHHCCCC
T ss_conf             67988999997989---89999999999999984799980-8999887121364


No 242
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily.  Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics.   These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains.  Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42.  Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells.  Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42.  This ternary complex is proposed to have physiological function in processes such as tumorigenesis.  Activated Ric is likely to sign
Probab=98.60  E-value=7.9e-08  Score=67.61  Aligned_cols=152  Identities=20%  Similarity=0.256  Sum_probs=87.4

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE---EEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789---99821990899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH---VSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~---~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      ..|+++|.-.-|||+|+-+++...            ..++-  --||...+   ...+.+...+.|.||+|++.|-.-.-
T Consensus         3 ~Kiv~lGd~~VGKTsli~r~~~~~------------f~~~~--~pTi~~~~~~~i~i~~~~~~l~iwDtaGqe~~~~l~~   68 (172)
T cd04141           3 YKIVMLGAGGVGKSAVTMQFISHS------------FPDYH--DPTIEDAYKQQARIDNEPALLDILDTAGQAEFTAMRD   68 (172)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCC------------CCCCC--CCCCCCCEEEEEEECCEEEEEEEEECCCCCCCCCCHH
T ss_conf             699999999977999999997098------------99875--8842220369999999999999997888513574515


Q ss_pred             HHHHCCCCEEEEECCCCCCC-CCHHHHHHHH---H-HCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             77400233145201234433-2106778888---6-31876023310023335612221101232100111014532210
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPK-PQTREHILLA---R-QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~-~QT~eh~~l~---~-~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                      .-...+|++|||.|.++-.. ..-.+-...+   + .-.+| ++++-||+|+.+..+   ...++..++-++.    +.+
T Consensus        69 ~~~r~a~~~ilvydvt~~~Sf~~~~~w~~~i~~~~~~~~~p-iilvGNK~DL~~~r~---Vs~~e~~~~a~~~----~~~  140 (172)
T cd04141          69 QYMRCGEGFIICYSVTDRHSFQEASEFKKLITRVRLTEDIP-LVLVGNKVDLESQRQ---VTTEEGRNLAREF----NCP  140 (172)
T ss_pred             HHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEEEECCCHHHHCC---CCHHHHHHHHHHC----CCE
T ss_conf             56427865688731688889999999999999972889986-899850456676188---8999999999985----997


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCC
Q ss_conf             23311467641144456521233203443102
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTH  196 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~  196 (392)
                      ++.+||.++.+          +..+++.|...
T Consensus       141 f~EtSAk~~~n----------V~e~F~~l~~~  162 (172)
T cd04141         141 FFETSAALRHY----------IDDAFHGLVRE  162 (172)
T ss_pred             EEEECCCCCCC----------HHHHHHHHHHH
T ss_conf             99974788828----------89999999999


No 243
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=98.59  E-value=1.8e-07  Score=65.46  Aligned_cols=140  Identities=21%  Similarity=0.167  Sum_probs=79.9

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE-EEEECCC--EEEEEEECCCCHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789-9982199--08999847873024677987
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH-VSYETDK--RFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~-~~~~~~~--~~i~iiD~PGH~~f~~~mi~   90 (392)
                      .|+++|.-..|||+|+-++...            ..+++  .--|+...+ ..+..++  ..+.|.||+|+++|-.-.-.
T Consensus         3 Ki~liGd~~VGKTsli~r~~~~------------~F~~~--y~pTi~~~~~~~i~~~~~~v~l~iwDtaG~e~~~~~~~~   68 (175)
T cd01870           3 KLVIVGDGACGKTCLLIVFSKD------------QFPEV--YVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPL   68 (175)
T ss_pred             EEEEECCCCCCHHHHHHHHHCC------------CCCCC--CCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHHH
T ss_conf             9999998996699999999709------------89998--478436899999999999999999977766132324044


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHH-----HHHHH--CCCCCEEEEECCCCCCCCHHHHHH---------CCCCCCEEE
Q ss_conf             74002331452012344332106778-----88863--187602331002333561222110---------123210011
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHI-----LLARQ--IGISSIVVYMNKVDAVDDDELLDI---------SEYEIRDLL  154 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~-----~l~~~--lgi~~iIv~iNKmD~v~~~~~~~~---------i~~~i~~~l  154 (392)
                      -...+|++|||-|.++-   +|-+++     ..++.  -++| +|++-||+|+.+..+....         ..++-.++.
T Consensus        69 ~~~~a~~~ilvydi~~~---~Sf~~~~~~w~~~i~~~~~~~p-iilVgnK~DL~~~~~~~~~~~~~~~~~V~~~eg~~~a  144 (175)
T cd01870          69 SYPDTDVILMCFSIDSP---DSLENIPEKWTPEVKHFCPNVP-IILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMA  144 (175)
T ss_pred             HHCCCCEEEEEEECCCH---HHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCHHHHHHHHHHCCCCCCHHHHHHHH
T ss_conf             31488789999865987---9999999999999997298998-9999872433433234566654025566899999999


Q ss_pred             EEEEEEEEEECCCCEEEEEE
Q ss_conf             10145322102331146764
Q gi|254780263|r  155 KEHKYSDDTPIIRGSALCAL  174 (392)
Q Consensus       155 ~~~~~~~~~pii~~sa~~g~  174 (392)
                      ++.+   ..+++.+||.++.
T Consensus       145 ~~~~---~~~f~EtSAk~~~  161 (175)
T cd01870         145 NKIG---AFGYMECSAKTKE  161 (175)
T ss_pred             HHCC---CCEEEEECCCCCC
T ss_conf             9749---9789997689997


No 244
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases. Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Probab=98.59  E-value=1.1e-07  Score=66.63  Aligned_cols=152  Identities=18%  Similarity=0.150  Sum_probs=81.8

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE---EEEECCCEEEEEEECCCCHHHHHHHH-H
Q ss_conf             9999046898878999999876444200131268686986292063789---99821990899984787302467798-7
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH---VSYETDKRFYSHIDCPGHADYVKNMI-T   90 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~---~~~~~~~~~i~iiD~PGH~~f~~~mi-~   90 (392)
                      |+++|--..|||+|+-+....            ..+++-  --|+...+   ..+......+.|.||+|+++|- +|. .
T Consensus         1 ivllGd~~VGKTsli~r~~~~------------~f~~~y--~~Ti~~~~~~~~~~~~~~~~l~i~DtaG~e~~~-~l~~~   65 (174)
T smart00174        1 LVVVGDGAVGKTCLLISYTTN------------AFPEDY--VPTVFENYSADVEVDGKPVELGLWDTAGQEDYD-RLRPL   65 (174)
T ss_pred             EEEECCCCCCHHHHHHHHHHC------------CCCCCC--CCCEEEEEEEEEEECCEEEEEEEEECCCCCCCC-CCCHH
T ss_conf             599897897599999999539------------899985--785057899999999999999999489870345-45001


Q ss_pred             HHHCCCCEEEEECCCCC-CCCCHHHHH-HHHH--HCCCCCEEEEECCCCCCCCHHHHHHC---------CCCCCEEEEEE
Q ss_conf             74002331452012344-332106778-8886--31876023310023335612221101---------23210011101
Q gi|254780263|r   91 GATQADGAILVCAAEDG-PKPQTREHI-LLAR--QIGISSIVVYMNKVDAVDDDELLDIS---------EYEIRDLLKEH  157 (392)
Q Consensus        91 g~~~~D~ailvVda~~G-~~~QT~eh~-~l~~--~lgi~~iIv~iNKmD~v~~~~~~~~i---------~~~i~~~l~~~  157 (392)
                      ....+|++|||-|.++- -+..-++.+ ..++  .-.+| +|++-||+|+.+........         .++.+.+-++.
T Consensus        66 ~~~~a~~~ilvydvt~~~Sf~~~~~~w~~~i~~~~~~~p-iilVgnK~DL~~~~~~~~~~~~~~~~~Vs~~~~~~~a~~~  144 (174)
T smart00174       66 SYPDTDVFLICFSVDSPASFENVKEKWYPEVKHFCPNTP-IILVGTKLDLREDKSTLRELSKQKQEPVTYEQGEALAKRI  144 (174)
T ss_pred             HCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHC
T ss_conf             104886899997589878999999989999998688986-9999875425012333545533146500299999999983


Q ss_pred             EEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             45322102331146764114445652123320344310
Q gi|254780263|r  158 KYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       158 ~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                      +   ..+++.+||.+|.          ++..+++.+..
T Consensus       145 ~---~~~y~EtSAk~g~----------nV~e~F~~l~r  169 (174)
T smart00174      145 G---AVKYLECSALTQE----------GVREVFEEAIR  169 (174)
T ss_pred             C---CCEEEEECCCCCC----------CHHHHHHHHHH
T ss_conf             9---9789996458894----------98999999999


No 245
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=98.58  E-value=1.6e-07  Score=65.74  Aligned_cols=141  Identities=16%  Similarity=0.201  Sum_probs=81.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-EEEC--CCEEEEEEECCCCHHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869862920637899-9821--990899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-SYET--DKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~~~~--~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      ..|+++|.-..|||+|+.+++...            ..++  .--|+...+. .+..  +...+.|.||+|++.|-.-.-
T Consensus         2 fKIvllGd~~VGKTsli~r~~~~~------------f~~~--y~pTi~~~~~k~i~~~~~~~~l~iwDtaG~e~~~~l~~   67 (164)
T cd04175           2 YKLVVLGSGGVGKSALTVQFVQGI------------FVEK--YDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRD   67 (164)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCC------------CCCC--CCCCEEEEEEEEEEECCEEEEEEECCCCCCHHHHHHHH
T ss_conf             299998999975999999997092------------8865--68840468999999999999998514775432456788


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHH--HHHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             774002331452012344332106778--88863---1876023310023335612221101232100111014532210
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHI--LLARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~--~l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                      .-...||++|||-|.+.-..=+..+.+  .+.+.   -.+| +|++-||+|+.+..+   ...++.+++.++.    +.+
T Consensus        68 ~y~~~a~~~ilvydvt~~~Sf~~~~~~~~~i~~~~~~~~~p-iilvgNK~DL~~~r~---V~~~~~~~~a~~~----~~~  139 (164)
T cd04175          68 LYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTEDVP-MILVGNKCDLEDERV---VGKEQGQNLARQW----GCA  139 (164)
T ss_pred             HHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCE-EEEEECCCCCHHCCC---CCHHHHHHHHHHC----CCE
T ss_conf             87357868999960787778999999999999862899963-998521457222068---9999999999985----999


Q ss_pred             CCCCEEEEEEE
Q ss_conf             23311467641
Q gi|254780263|r  165 IIRGSALCALQ  175 (392)
Q Consensus       165 ii~~sa~~g~~  175 (392)
                      ++.+||.+|.+
T Consensus       140 ~~E~SAk~~~n  150 (164)
T cd04175         140 FLETSAKAKIN  150 (164)
T ss_pred             EEEECCCCCCC
T ss_conf             99966898817


No 246
>cd04130 Wrch_1 Wrch-1 subfamily.  Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42.  Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation.  Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function.  The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells.  Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes.  The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases.  Most Rho proteins contain a lipid modification site at the C-terminus, 
Probab=98.57  E-value=1.7e-07  Score=65.56  Aligned_cols=145  Identities=19%  Similarity=0.123  Sum_probs=80.1

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-EEE--CCCEEEEEEECCCCHHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869862920637899-982--1990899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-SYE--TDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~~~--~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      |.|+++|....|||+|+-++...            ..++|-  --|+...+. .+.  .....+.|.||+|+++|-.-.-
T Consensus         1 iKvvlvGd~~VGKTsli~r~~~~------------~F~~~y--~pT~~~~~~~~i~~~~~~v~l~iwDtaG~e~~~~l~~   66 (173)
T cd04130           1 LKCVLVGDGAVGKTSLIVSYTTN------------GYPTEY--VPTAFDNFSVVVLVDGKPVRLQLCDTAGQDEFDKLRP   66 (173)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHC------------CCCCCC--CCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCHHHH
T ss_conf             98999998997889999999619------------999985--7835899999999999999999998998734434567


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCH-HHHHH-HHH--HCCCCCEEEEECCCCCCCCHHHHH---------HCCCCCCEEEEE
Q ss_conf             77400233145201234433210-67788-886--318760233100233356122211---------012321001110
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQT-REHIL-LAR--QIGISSIVVYMNKVDAVDDDELLD---------ISEYEIRDLLKE  156 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT-~eh~~-l~~--~lgi~~iIv~iNKmD~v~~~~~~~---------~i~~~i~~~l~~  156 (392)
                      .....+|++|||-|.+.-..=+- ++++. .++  .-++| +|++=||.|+.+......         ...++-+++-++
T Consensus        67 ~~~~~a~~~ilvydv~~~~Sf~~l~~~w~~~i~~~~~~~p-iilvGnK~DL~~~~~~~~~~~~~~~r~Vs~~e~~~~a~~  145 (173)
T cd04130          67 LCYPDTDVFLLCFSVVNPSSFQNISEKWIPEIRKHNPKAP-IILVGTQADLRTDVNVLIQLARYGEKPVSQSRAKALAEK  145 (173)
T ss_pred             HHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCC-EEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             6613787899999659878899999999999996098998-899988701100133554443325755789999999998


Q ss_pred             EEEEEEEECCCCEEEEEEE
Q ss_conf             1453221023311467641
Q gi|254780263|r  157 HKYSDDTPIIRGSALCALQ  175 (392)
Q Consensus       157 ~~~~~~~pii~~sa~~g~~  175 (392)
                      .+   ..+++.+||.++.+
T Consensus       146 ~~---~~~y~EtSAkt~~n  161 (173)
T cd04130         146 IG---ACEYIECSALTQKN  161 (173)
T ss_pred             CC---CCEEEEECCCCCCC
T ss_conf             49---96899968688969


No 247
>cd04133 Rop_like Rop subfamily.  The Rop (Rho-related protein from plants) subfamily plays a role in diverse cellular processes, including cytoskeletal organization, pollen and vegetative cell growth, hormone responses, stress responses, and pathogen resistance.  Rops are able to regulate several downstream pathways to amplify a specific signal by acting as master switches early in the signaling cascade.  They transmit a variety of extracellular and intracellular signals.  Rops are involved in establishing cell polarity in root-hair development, root-hair elongation, pollen-tube growth, cell-shape formation, responses to hormones such as abscisic acid (ABA) and auxin, responses to abiotic stresses such as oxygen deprivation, and disease resistance and disease susceptibility.  An individual Rop can have a unique function or an overlapping function shared with other Rop proteins; in addition, a given Rop-regulated function can be controlled by one or multiple Rop proteins.  For example, 
Probab=98.56  E-value=2.4e-07  Score=64.61  Aligned_cols=155  Identities=21%  Similarity=0.194  Sum_probs=84.4

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE---EEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789---99821990899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH---VSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~---~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      +.++++|.-.-|||+|+-+....            ..+++-  --|+...|   .........+.|.||+|+++|-.-.-
T Consensus         2 iKivllGd~~VGKTsL~~rf~~~------------~F~~~~--~pTi~~~~~~~i~v~~~~~~l~iwDTaG~e~~~~l~~   67 (176)
T cd04133           2 IKCVTVGDGAVGKTCMLICYTSN------------KFPTDY--IPTVFDNFSANVSVDGNTVNLGLWDTAGQEDYNRLRP   67 (176)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHC------------CCCCCC--CCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCHHHH
T ss_conf             79999899997799999999659------------899986--7853589999999999899999997999765424689


Q ss_pred             HHHHCCCCEEEEECCCCC-CCCCHHHH-HHHHHH--CCCCCEEEEECCCCCCCCHHHH-H------HCCCCCCEEEEEEE
Q ss_conf             774002331452012344-33210677-888863--1876023310023335612221-1------01232100111014
Q gi|254780263|r   90 TGATQADGAILVCAAEDG-PKPQTREH-ILLARQ--IGISSIVVYMNKVDAVDDDELL-D------ISEYEIRDLLKEHK  158 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G-~~~QT~eh-~~l~~~--lgi~~iIv~iNKmD~v~~~~~~-~------~i~~~i~~~l~~~~  158 (392)
                      .-...+|+++||-|-..- -+..-.++ +..++.  -++| +|++-||+|+.+..+.. +      ....+-.++-++.+
T Consensus        68 ~~y~~a~~~ilvydi~~~~Sf~~~~~~w~~~~~~~~~~~p-iilvGnK~DL~~~r~~~~~~~~~~~Vs~~e~~~~a~~~~  146 (176)
T cd04133          68 LSYRGADVFVLAFSLISRASYENVLKKWVPELRHYAPNVP-IVLVGTKLDLRDDKQYLADHPGASPITTAQGEELRKQIG  146 (176)
T ss_pred             HHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCC-EEEEEECHHHHHCHHHHHHCCCCCCCCHHHHHHHHHHCC
T ss_conf             8726787579999789878999999999999998684998-899998632021222333302467777999999999779


Q ss_pred             EEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             5322102331146764114445652123320344310
Q gi|254780263|r  159 YSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       159 ~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                      .   ..++.+||.++.+          +..+++.+..
T Consensus       147 ~---~~y~EtSAk~~~n----------V~e~F~~~~~  170 (176)
T cd04133         147 A---AAYIECSSKTQQN----------VKAVFDAAIK  170 (176)
T ss_pred             C---CEEEEECCCCCCC----------HHHHHHHHHH
T ss_conf             9---7899947898809----------8999999999


No 248
>cd04144 Ras2 Ras2 subfamily.  The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis.  In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family.  Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=98.55  E-value=2.3e-07  Score=64.72  Aligned_cols=136  Identities=23%  Similarity=0.244  Sum_probs=80.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-EEEC--CCEEEEEEECCCCHHHHHHHHHH
Q ss_conf             99990468988789999998764442001312686869862920637899-9821--99089998478730246779877
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-SYET--DKRFYSHIDCPGHADYVKNMITG   91 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~~~~--~~~~i~iiD~PGH~~f~~~mi~g   91 (392)
                      |+++|...-|||+|+-++...            ...++  ---||...+. .+..  ....+.|.||+|++.|..-.-.-
T Consensus         2 ivviGd~gVGKTsli~r~~~~------------~F~~~--y~pTi~~~~~k~~~~~~~~~~l~iwDtaG~e~~~~l~~~~   67 (190)
T cd04144           2 LVVLGDGGVGKTALTIQLCLN------------HFVET--YDPTIEDSYRKQVVVDGQPCMLEVLDTAGQEEYTALRDQW   67 (190)
T ss_pred             EEEECCCCCCHHHHHHHHHHC------------CCCCC--CCCCCCEEEEEEEEECCEEEEEEEEECCCCCCHHHHHHHH
T ss_conf             899998998789999999629------------79988--6997247889999999999999999899973116788998


Q ss_pred             HHCCCCEEEEECCCCCCCCCHHHHHH-----H--HHH--C-CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             40023314520123443321067788-----8--863--1-876023310023335612221101232100111014532
Q gi|254780263|r   92 ATQADGAILVCAAEDGPKPQTREHIL-----L--ARQ--I-GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        92 ~~~~D~ailvVda~~G~~~QT~eh~~-----l--~~~--l-gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      ...+|++|||.|.++-   +|-+++.     +  .+.  . .+| ++++=||+|+.+..+   ...++.+++..+.    
T Consensus        68 ~r~a~~~ilVydvtd~---~SF~~l~~w~~~i~~~~~~~~~~~p-iiLVGNK~Dl~~~r~---V~~~e~~~~a~~~----  136 (190)
T cd04144          68 IREGEGFILVYSITSR---STFERVERFREQIQRVKDESAADVP-IMIVGNKCDKVYERE---VSTEEGAALARRL----  136 (190)
T ss_pred             HCCCCEEEEEEECCCH---HHHHHHHHHHHHHHHHHHCCCCCCE-EEECCCCCCHHHCCC---CCHHHHHHHHHHC----
T ss_conf             2367658999727977---8999999999999998533799952-895145535033057---8999999999980----


Q ss_pred             EEECCCCEEEEEEE
Q ss_conf             21023311467641
Q gi|254780263|r  162 DTPIIRGSALCALQ  175 (392)
Q Consensus       162 ~~pii~~sa~~g~~  175 (392)
                      +.+++.+||.++.+
T Consensus       137 ~~~~~E~SAk~~~n  150 (190)
T cd04144         137 GCEFIEASAKTNVN  150 (190)
T ss_pred             CCEEEEECCCCCCC
T ss_conf             99899973588809


No 249
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=98.52  E-value=3.2e-07  Score=63.81  Aligned_cols=138  Identities=20%  Similarity=0.234  Sum_probs=80.7

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEE-EEEEEEECC--CEEEEEEECCCCHHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063-789998219--90899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA-TAHVSYETD--KRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~-~~~~~~~~~--~~~i~iiD~PGH~~f~~~mi   89 (392)
                      ..|+++|....|||+|+-+++...            ..++  .--|+. .-...+..+  ...+.|.||+|+++|-.-.-
T Consensus         2 fKivllGd~~VGKTsli~r~~~~~------------f~~~--y~~Ti~~~~~k~i~~~~~~~~l~iwDtaG~e~~~~~~~   67 (163)
T cd04136           2 YKVVVLGSGGVGKSALTVQFVQGI------------FVEK--YDPTIEDSYRKQIEVDGQQCMLEILDTAGTEQFTAMRD   67 (163)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCC------------CCCC--CCCCCCCEEEEEEEECCEEEEEEECCCCCCHHHHHHHH
T ss_conf             199998999988999999997195------------9886--69954206999999999999998645765445556789


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHH-----HHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             7740023314520123443321067788-----8863---1876023310023335612221101232100111014532
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHIL-----LARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~~-----l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      .-...||+++||.|.++   ++|-+++.     +.+.   -.+| ++++-||+|+.+..+   ...++..++.++.    
T Consensus        68 ~y~~~a~~~ilvydvt~---~~Sf~~l~~~~~~i~~~~~~~~~p-iilVGnK~Dl~~~r~---v~~~~~~~~a~~~----  136 (163)
T cd04136          68 LYIKNGQGFVLVYSITS---QSSFNDLQDLREQILRVKDTENVP-MVLVGNKCDLEDERV---VSREEGQALARQW----  136 (163)
T ss_pred             HHHCCCCEEEEEECCCC---HHHHHHHHHHHHHHHHHCCCCCCC-EEEEECCCCHHHHCC---CCHHHHHHHHHHC----
T ss_conf             88346876999704898---899999999999999861888886-787623547264078---9999999999984----


Q ss_pred             EEECCCCEEEEEEE
Q ss_conf             21023311467641
Q gi|254780263|r  162 DTPIIRGSALCALQ  175 (392)
Q Consensus       162 ~~pii~~sa~~g~~  175 (392)
                      +.+++.+||.++.+
T Consensus       137 ~~~~~E~SAk~~~n  150 (163)
T cd04136         137 GCPFYETSAKSKIN  150 (163)
T ss_pred             CCEEEEECCCCCCC
T ss_conf             99899974487805


No 250
>pfam03029 ATP_bind_1 Conserved hypothetical ATP binding protein. Members of this family are found in a range of archaea and eukaryotes and have hypothesized ATP binding activity.
Probab=98.52  E-value=3.5e-07  Score=63.63  Aligned_cols=109  Identities=22%  Similarity=0.281  Sum_probs=64.9

Q ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHCCCC-------------------------------------------------CC
Q ss_conf             99046898878999999876444200131-------------------------------------------------26
Q gi|254780263|r   17 TIGHVDHGKTTLTAAITKYYSEEKKEYGD-------------------------------------------------ID   47 (392)
Q Consensus        17 ~iGhvd~GKSTL~~~L~~~~~~~~~~~~~-------------------------------------------------~D   47 (392)
                      |+|-..+||||+++++.+.+...++....                                                 +|
T Consensus         1 ViGpaGSGKTT~~~~l~~~l~~~~r~~~vvNLDPA~e~~pY~~~iDIrd~i~~~dvM~~~~LGPNGali~~me~l~~~~d   80 (234)
T pfam03029         1 VVGGAGSGKTTFVGALSEILPLRGRSVYVVNLDPAAENLPYEADIDIRELITVADVMEDYGLGPNGALTVAMDFGRITLD   80 (234)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHHCCHHHHHHHCCCCCCHHHHHHHHHHHHHHH
T ss_conf             98989898899999999999977997599978986658999877717874679999998298973899999999999999


Q ss_pred             CCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC------CHHHHHHHHHHHHC-CCCEEEEECCCCCCCCCHHHH-----
Q ss_conf             868698629206378999821990899984787------30246779877400-233145201234433210677-----
Q gi|254780263|r   48 SAPEEKLRGITIATAHVSYETDKRFYSHIDCPG------HADYVKNMITGATQ-ADGAILVCAAEDGPKPQTREH-----  115 (392)
Q Consensus        48 ~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG------H~~f~~~mi~g~~~-~D~ailvVda~~G~~~QT~eh-----  115 (392)
                      |..++.             + ....|-++||||      |.+-++..+..++. .=+++.++|+.--..+.+--.     
T Consensus        81 ~l~~~l-------------~-~~~~y~l~DtPGQiElf~~~~~~~~i~~~L~~~~~~~v~l~D~~~~~d~~~fis~~L~a  146 (234)
T pfam03029        81 WLLEEL-------------E-YEDDYYLFDTPGQIELFTHWDSLARGVEALEASRLGAVYLVDTRRLTDPIDFFSGLLYA  146 (234)
T ss_pred             HHHHHH-------------C-CCCCEEEEECCCCEEEEECCHHHHHHHHHHHCCCEEEEEEECHHHHCCHHHHHHHHHHH
T ss_conf             999985-------------2-55776998369835765400269999999712873899984257746888899999999


Q ss_pred             HHHHHHCCCCCEEEEECCCCCCCCH
Q ss_conf             8888631876023310023335612
Q gi|254780263|r  116 ILLARQIGISSIVVYMNKVDAVDDD  140 (392)
Q Consensus       116 ~~l~~~lgi~~iIv~iNKmD~v~~~  140 (392)
                      +.....+++|++ .++||+|+++.+
T Consensus       147 ~s~m~~l~lP~v-nvlsK~Dl~~~~  170 (234)
T pfam03029       147 LSIMLRLGLPFV-VALNKFDLLSLE  170 (234)
T ss_pred             HHHHHHCCCCEE-EEECCHHCCCCH
T ss_conf             999997489944-310004135424


No 251
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes.  Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species.  Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria.  Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs.  Mutants in yeast mtEFG1 have impaired mitochondrial protein synthesis, respiratory defects and a tendency to lose mitochondrial DNA. There are two forms of mtEFG present in mammals 
Probab=98.51  E-value=6.5e-08  Score=68.14  Aligned_cols=76  Identities=20%  Similarity=0.204  Sum_probs=53.6

Q ss_pred             CCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCC-CCCCCCCCCCCHHHHHHHCCCCCCEEECHHE
Q ss_conf             000013554454301487424534896799950687432125412100-1211443210013666411245432202117
Q gi|254780263|r  212 IEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEM-FRKKLDEAIAGDNVGLLLRGVNRADVPRGRV  290 (392)
Q Consensus       212 I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~-~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdv  290 (392)
                      ++.+...++ |.+.+-||+||+|+.|++++....+.+....++..++. .++++++|.|||++++.  |+   +...||+
T Consensus         5 vFK~~~d~~-G~lsf~RVysG~l~~g~~v~n~~~~~~eri~~l~~~~~~~~~~v~~a~aGDIvav~--gl---~~~tGDT   78 (81)
T cd04091           5 AFKLEEGRF-GQLTYMRIYQGKLKKGDTIYNVRTGKKVRVPRLVRMHSNEMEEVEEAGAGDICAIF--GI---DCASGDT   78 (81)
T ss_pred             EEEEECCCC-CCEEEEEEEEEEECCCCEEEECCCCCEEEEEEEEEEECCCCEECCEECCCCEEEEE--CC---CCCCCCC
T ss_conf             998761899-88999999672887999999786891687202289978985076568799899998--99---9674776


Q ss_pred             EEC
Q ss_conf             732
Q gi|254780263|r  291 VCA  293 (392)
Q Consensus       291 l~~  293 (392)
                      ||+
T Consensus        79 L~d   81 (81)
T cd04091          79 FTD   81 (81)
T ss_pred             CCC
T ss_conf             359


No 252
>pfam05049 IIGP Interferon-inducible GTPase (IIGP). Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence. IIGP is predominantly associated with the Golgi apparatus and also localizes to the endoplasmic reticulum and exerts a distinct role in IFN-induced intracellular membrane trafficking or processing.
Probab=98.50  E-value=1.2e-07  Score=66.43  Aligned_cols=169  Identities=18%  Similarity=0.281  Sum_probs=99.8

Q ss_pred             HCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEE-EEEEEECCC-EEEEEEECCCC---
Q ss_conf             1038827999990468988789999998764442001312686869862920637-899982199-08999847873---
Q gi|254780263|r    7 VRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIAT-AHVSYETDK-RFYSHIDCPGH---   81 (392)
Q Consensus         7 ~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~-~~~~~~~~~-~~i~iiD~PGH---   81 (392)
                      .-++..+|||+.|--.+||||++.+|-+ .+.+..+.+.+         |.+-.. ....|..++ -+++|-|.||-   
T Consensus        30 ~~~~~~lnIavtGesG~GkSsfINalRg-~g~e~~~aA~t---------GvvetT~~~~~Y~hp~~pnV~lwDLPG~gt~   99 (375)
T pfam05049        30 EISSAPLKIAVTGDSGNGKSSFINALRG-IGHEEDGSAPT---------GVVETTMKRTPYSHPHFPNVVLWDLPGLGAT   99 (375)
T ss_pred             HHHCCCEEEEEECCCCCCHHHHHHHHHC-CCCCCCCCCCC---------CCEEECCCCCCCCCCCCCCEEEECCCCCCCC
T ss_conf             5443824799854899867899998747-89877776876---------8766326755678999998079628999989


Q ss_pred             ----HHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHH---HHCCCCCEEEEECCCCC------------CCCHHH
Q ss_conf             ----02467798774002331452012344332106778888---63187602331002333------------561222
Q gi|254780263|r   82 ----ADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLA---RQIGISSIVVYMNKVDA------------VDDDEL  142 (392)
Q Consensus        82 ----~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~---~~lgi~~iIv~iNKmD~------------v~~~~~  142 (392)
                          .+|+..|  .....|.-|++.+.+-     +.-|+.+|   +.+| +++-++=+|+|.            .+.++.
T Consensus       100 ~f~~~~Yl~~~--~f~~yDfFiiiss~rf-----~~n~v~LAk~i~~mg-K~fyfVrtKvD~Dl~~e~~~kp~~F~~e~~  171 (375)
T pfam05049       100 NFTVETYLEEM--KFSEYDFFIIISSERF-----SLNDVKLAKAIQRMG-KRFYFVRTKLDSDLSNEQKGKPQTFPKEKV  171 (375)
T ss_pred             CCCHHHHHHHC--CCCCCCEEEEEECCCC-----CHHHHHHHHHHHHHC-CCEEEEEEECCCCCHHHHHCCCCCCCHHHH
T ss_conf             98989999874--8564778999967754-----320189999999838-947999862367606576258999998999


Q ss_pred             HHHCCCCCCEEEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCC
Q ss_conf             110123210011101453221023311467641144456521233203443102522221
Q gi|254780263|r  143 LDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQR  202 (392)
Q Consensus       143 ~~~i~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~  202 (392)
                      .+.|.+.+.+-|.+.+.. +.|++-+|        |-....|+-+.|.+.+..-+|.-.|
T Consensus       172 Lq~IR~~c~~~L~k~gv~-eP~VFLvS--------nfdl~~yDFp~L~~TL~~eLP~hKR  222 (375)
T pfam05049       172 LQNIQDNCRNNLQKEGVK-EPPIFLVS--------NLDPSHYDFPKLRDTLLKDLPIIKR  222 (375)
T ss_pred             HHHHHHHHHHHHHHCCCC-CCCEEEEE--------CCCHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             999999999999875888-99789981--------7881326818999999987368678


No 253
>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea. eIF2 is a G protein that delivers the methionyl initiator tRNA to the small ribosomal subunit and releases it upon GTP hydrolysis after the recognition of the initiation codon. eIF2 is composed three subunits, alpha, beta and gamma. Subunit gamma shows strongest conservation, and it confers both tRNA binding and GTP/GDP binding.
Probab=98.48  E-value=8.4e-08  Score=67.44  Aligned_cols=91  Identities=25%  Similarity=0.379  Sum_probs=68.7

Q ss_pred             CCCCCCEECCCCCCCCC--------CCCCEEEEEEECCCCCCCEEEEEECC---------CCCCCEEEECCCCCCCCCCC
Q ss_conf             00011000000013554--------45430148742453489679995068---------74321254121001211443
Q gi|254780263|r  204 LDAPFLMHIEGSCGIEG--------RGTVVTGCIKRGRIKAGSDVEIIGMG---------GKKLKVKCTDVEMFRKKLDE  266 (392)
Q Consensus       204 ~~~p~r~~I~~vf~i~g--------~G~Vv~GrV~sG~l~~Gd~i~i~p~~---------~~~~~~kv~si~~~~~~v~~  266 (392)
                      .++|.+|.|.+.|.+.-        .|-|+.|.+.+|.|++||++.|.|.-         .....++|.||+..+.++++
T Consensus         2 ~~~~P~m~V~RSFDvNkPGt~~~~L~GGViGGSl~~G~lkvgDeIEIrPG~~~~~~~~~~~~Pi~t~I~sl~a~~~~l~~   81 (113)
T cd03688           2 FTSPPRMIVIRSFDVNKPGTEVDDLKGGVAGGSLLQGVLKVGDEIEIRPGIVVKDEGKIKCRPIFTKIVSLKAENNDLQE   81 (113)
T ss_pred             CCCCCEEEEEEEEECCCCCCCHHHCCEEEEEEEEEEEEEECCCEEEECCCEEEEECCEEEEEEEEEEEEEEEECCEEEEE
T ss_conf             98995499998864268999878853008989987879957999997489898739979999899999999929842428


Q ss_pred             CCCCHHHHHHHC---CCCCCEEECHHEEECC
Q ss_conf             210013666411---2454322021177326
Q gi|254780263|r  267 AIAGDNVGLLLR---GVNRADVPRGRVVCAP  294 (392)
Q Consensus       267 a~aGd~v~l~Lk---gi~~~di~rGdvl~~~  294 (392)
                      |.||-.+|+..+   .+.+.|--.|.|+..+
T Consensus        82 a~PGGLigvgT~LDPsltk~D~L~G~V~G~~  112 (113)
T cd03688          82 AVPGGLIGVGTKLDPTLTKADRLVGQVVGEP  112 (113)
T ss_pred             ECCCCEEEECCCCCCHHCCCCCCEEEECCCC
T ss_conf             8378578971664813513654247761468


No 254
>cd04135 Tc10 TC10 subfamily.  TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro.  Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration.  TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins.  GTP-bound TC10 in vitro can bind numerous potential effectors.  Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes.  TC10 mRNAs are highly expressed in three types of mouse muscle tissues:  leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns.  TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti
Probab=98.46  E-value=4.2e-07  Score=63.13  Aligned_cols=144  Identities=19%  Similarity=0.153  Sum_probs=80.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-E--EECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869862920637899-9--821990899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-S--YETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~--~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      +.|+++|.-..|||+|+-++....            .++|  .--|+.-.+. .  ...+...+.|.||+|+++|-.-.-
T Consensus         1 ~Kiv~vGd~~VGKTsli~rf~~~~------------f~~~--y~pTi~~~~~~~i~v~~~~~~l~i~DTaG~e~~~~~~~   66 (174)
T cd04135           1 LKCVVVGDGAVGKTCLLMSYANDA------------FPEE--YVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRP   66 (174)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCC------------CCCC--CCCEEEEEEEEEEEECCEEEEEEEEECCCCCCCHHHHH
T ss_conf             989999989985999999996298------------9988--68857520227999999999999997976403155659


Q ss_pred             HHHHCCCCEEEEECCCC-CCCCCHHHHH-HHHHH--CCCCCEEEEECCCCCCCCHHHHH---------HCCCCCCEEEEE
Q ss_conf             77400233145201234-4332106778-88863--18760233100233356122211---------012321001110
Q gi|254780263|r   90 TGATQADGAILVCAAED-GPKPQTREHI-LLARQ--IGISSIVVYMNKVDAVDDDELLD---------ISEYEIRDLLKE  156 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~-G~~~QT~eh~-~l~~~--lgi~~iIv~iNKmD~v~~~~~~~---------~i~~~i~~~l~~  156 (392)
                      .....+|+++||-|.++ --+...++.+ ..++.  -.+| +|++=||+|+.+......         ...++-.++-++
T Consensus        67 ~~~~~a~~~ilvydi~~~~Sf~~~~~~w~~~~~~~~~~~p-iilvgnK~DL~~~~~~~~~~~~~~~r~Vs~eeg~~~A~~  145 (174)
T cd04135          67 LSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVP-YLLVGTQIDLRDDPKTLARLNDMKEKPVTVEQGQKLAKE  145 (174)
T ss_pred             HHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCC-EEEEEECHHHCCCHHHHHHHCCCCCCCCCHHHHHHHHHH
T ss_conf             9855787678984379778899999999999998684998-899968523004434554530045766399999999997


Q ss_pred             EEEEEEEECCCCEEEEEE
Q ss_conf             145322102331146764
Q gi|254780263|r  157 HKYSDDTPIIRGSALCAL  174 (392)
Q Consensus       157 ~~~~~~~pii~~sa~~g~  174 (392)
                      .+.   .+++.+||.++.
T Consensus       146 ~g~---~~f~E~SAkt~~  160 (174)
T cd04135         146 IGA---HCYVECSALTQK  160 (174)
T ss_pred             CCC---CEEEEECCCCCC
T ss_conf             799---899990548794


No 255
>cd04134 Rho3 Rho3 subfamily.  Rho3 is a member of the Rho family found only in fungi.  Rho3 is believed to regulate cell polarity by interacting with the diaphanous/formin family protein For3 to control both the actin cytoskeleton and microtubules.  Rho3 is also believed to have a direct role in exocytosis that is independent of its role in regulating actin polarity.  The function in exocytosis may be two-pronged: first, in the transport of post-Golgi vesicles from the mother cell to the bud, mediated by myosin (Myo2); second, in the docking and fusion of vesicles to the plasma membrane, mediated by an exocyst (Exo70) protein.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=98.46  E-value=7.3e-07  Score=61.64  Aligned_cols=147  Identities=14%  Similarity=0.072  Sum_probs=79.2

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-EE--ECCCEEEEEEECCCCHHHHHHHHH
Q ss_conf             999990468988789999998764442001312686869862920637899-98--219908999847873024677987
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-SY--ETDKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~~--~~~~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      .|+++|...-|||+|+-++...            ..+++  .--||...+. ..  .-....+.|.||+|+++|-.-.-.
T Consensus         2 KivlvGd~~VGKTsli~r~~~~------------~F~~~--y~~Ti~~~~~~~~~v~~~~v~l~iwDTaGqe~~~~i~~~   67 (189)
T cd04134           2 KVVVLGDGACGKTSLLNVFTRG------------YFPQV--YEPTVFENYVHDIFVDGLHIELSLWDTAGQEEFDRLRSL   67 (189)
T ss_pred             EEEEECCCCCCHHHHHHHHHCC------------CCCCC--CCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCHHHHH
T ss_conf             8999997997699999999709------------99998--688378999999999999999999847785000035567


Q ss_pred             HHHCCCCEEEEECCCCCC-CCC--HHHHHHHHHH-CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEE---EEEE---
Q ss_conf             740023314520123443-321--0677888863-18760233100233356122211012321001110---1453---
Q gi|254780263|r   91 GATQADGAILVCAAEDGP-KPQ--TREHILLARQ-IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKE---HKYS---  160 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~-~~Q--T~eh~~l~~~-lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~---~~~~---  160 (392)
                      -...+|+++||.|.+.-. +..  ++..-.+-.. -++| +|++-||+|+.+..+..+.........+..   ..+.   
T Consensus        68 ~y~~a~~~ilvydi~~~~Sf~~v~~~w~~~i~~~~~~~p-iiLVgnK~DL~~~~~~~~~~~~~~~~~is~~eg~~~Ak~~  146 (189)
T cd04134          68 SYADTDVIMLCFSVDSPDSLENVESKWLGEIREHCPGVK-LVLVALKCDLREARNERDDLQRYGKHTISYEEGLAVAKRI  146 (189)
T ss_pred             HHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCC-EEEEEECHHCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHH
T ss_conf             643786459999789878999999999999997497997-8999988004653235677766304665899999999982


Q ss_pred             EEEECCCCEEEEEEE
Q ss_conf             221023311467641
Q gi|254780263|r  161 DDTPIIRGSALCALQ  175 (392)
Q Consensus       161 ~~~pii~~sa~~g~~  175 (392)
                      ...+++.+||.++.+
T Consensus       147 ~~~~y~EtSAkt~~n  161 (189)
T cd04134         147 NALRYLECSAKLNRG  161 (189)
T ss_pred             CCCEEEEECCCCCCC
T ss_conf             997899968067949


No 256
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily.  RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively.  RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis.  Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression.  In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo.  RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors.  Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm.  Both are believed to have tu
Probab=98.46  E-value=3.8e-07  Score=63.39  Aligned_cols=149  Identities=18%  Similarity=0.226  Sum_probs=85.1

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEE---EEEEECCCEEEEEEECCCCHHHHHHHH-H
Q ss_conf             999904689887899999987644420013126868698629206378---999821990899984787302467798-7
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATA---HVSYETDKRFYSHIDCPGHADYVKNMI-T   90 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~---~~~~~~~~~~i~iiD~PGH~~f~~~mi-~   90 (392)
                      |+++|.-.-|||+|+.++....-.     ...+         -|+...   ....+.+...+.|.||+|.+.|...+. +
T Consensus         2 iv~vGd~~VGKTsli~rf~~~~f~-----~~y~---------~T~~~~~~~~~~v~~~~~~l~iwDtaG~e~~~~~~~~~   67 (165)
T cd04146           2 IAVLGASGVGKSALVVRFLTKRFI-----GEYD---------PNLESLYSRQVTIDGEQVSLEILDTAGQQQADTEQLER   67 (165)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCC-----CCCC---------CCCCCEEEEEEEECCEEEEEEEEECCCCCCCCHHHHHH
T ss_conf             999998997789999999749899-----8759---------95563057999999999999999289850122012554


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHH----HHHHHHHH--CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             74002331452012344332106----77888863--1876023310023335612221101232100111014532210
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTR----EHILLARQ--IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~----eh~~l~~~--lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                      =...||++|||-|.+.-..=+.-    +.+.-.+.  -.+| +|++=||+|+.+.-+   ...++.+++.++.    +.+
T Consensus        68 ~~~~a~~~ilvydit~~~Sf~~~~~~~~~i~~~~~~~~~~p-iilVGNK~DL~~~r~---Vs~ee~~~~a~~~----~~~  139 (165)
T cd04146          68 SIRWADGFVLVYSITDRSSFDEISQLKQLIREIKKRDREIP-VILVGNKADLLHYRQ---VSTEEGEKLASEL----GCL  139 (165)
T ss_pred             HCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCE-EEEECCCCCCCCCCC---CCHHHHHHHHHHC----CCE
T ss_conf             30458789999865888999999999999999846699953-998445545210367---7999999999981----998


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHH
Q ss_conf             233114676411444565212332034431
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVD  194 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~  194 (392)
                      ++.+||.++.+         ++..+++.+.
T Consensus       140 f~E~SAk~~~~---------~V~~~F~~l~  160 (165)
T cd04146         140 FFEVSAAEDYD---------GVHSVFHELC  160 (165)
T ss_pred             EEEEECCCCCC---------CHHHHHHHHH
T ss_conf             99975208782---------6999999999


No 257
>cd04111 Rab39 Rab39 subfamily.  Found in eukaryotes, Rab39 is mainly found in epithelial cell lines, but is distributed widely in various human tissues and cell lines.  It is believed to be a novel Rab protein involved in regulating Golgi-associated vesicular transport during cellular endocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.   Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=98.45  E-value=3.6e-07  Score=63.54  Aligned_cols=140  Identities=19%  Similarity=0.164  Sum_probs=83.1

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEEECC---CEEEEEEECCCCHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206--3789998219---908999847873024677
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSYETD---KRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~~~~---~~~i~iiD~PGH~~f~~~   87 (392)
                      ..|+++|--.-|||+|+-+++..            ...++-  --||  +.....++.+   ...+.|.||+|.+.|-.-
T Consensus         3 fKivllGd~~VGKTsL~~rf~~~------------~F~~~~--~~Tig~df~~k~i~i~dg~~v~l~IwDTaGqe~~~si   68 (211)
T cd04111           3 FRLIVIGDSTVGKSSLLKRFTEG------------RFAEVS--DPTVGVDFFSRLIEIEPGVRIKLQLWDTAGQERFRSI   68 (211)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHC------------CCCCCC--CCCCCEEEEEEEEEECCCCEEEEEEEECCCCCCCCCC
T ss_conf             99999999996199999999819------------999986--8720168899899977995999999979886345644


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHH-----HHHHCC--CCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEE
Q ss_conf             987740023314520123443321067788-----886318--7602331002333561222110123210011101453
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHIL-----LARQIG--ISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYS  160 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~-----l~~~lg--i~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~  160 (392)
                      .-.-...++++|||.|.+.-   +|-+++.     +....+  -+.++++=||.|+.+.-+   ...++.+++-++.   
T Consensus        69 ~~~yyr~a~g~ilVyDvt~~---~SF~~l~~W~~ei~~~~~~~~~~iiLVGNK~DL~~~R~---Vs~ee~~~~A~~~---  139 (211)
T cd04111          69 TRSYYRNSVGVLLVFDITNR---ESFEHVHDWLEEARSHIQPHRPVFILVGHKCDLESQRQ---VTREEAEKLAKDL---  139 (211)
T ss_pred             HHHHHHHCCEEEEEECCCCH---HHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHCC---CCHHHHHHHHHHH---
T ss_conf             28774212446897147777---99999999999999974988853898874231285678---8999999999983---


Q ss_pred             EEEECCCCEEEEEEEC
Q ss_conf             2210233114676411
Q gi|254780263|r  161 DDTPIIRGSALCALQG  176 (392)
Q Consensus       161 ~~~pii~~sa~~g~~~  176 (392)
                       +.+++.+||.+|.+.
T Consensus       140 -~~~f~EtSAK~g~nV  154 (211)
T cd04111         140 -GMKYIETSARTGDNV  154 (211)
T ss_pred             -CCEEEEECCCCCCCH
T ss_conf             -997999759998198


No 258
>pfam08477 Miro Miro-like protein. Mitochondrial Rho proteins (Miro-1 and Miro-2), are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (pfam00036), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis.
Probab=98.41  E-value=2.8e-06  Score=58.01  Aligned_cols=111  Identities=22%  Similarity=0.271  Sum_probs=69.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHHC
Q ss_conf             99990468988789999998764442001312686869862920637899982199089998478730246779877400
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQ   94 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~~   94 (392)
                      |+++|.-..|||||+.++....-...        ... -..+.+..........+...+.|.|++|+..|-.---.-.+.
T Consensus         2 ivvvG~~~vGKTSLi~r~~~~~f~~~--------~~~-~~~~~~~~~~~~~~~~~~~~l~i~Dt~g~~~~~~~~~~~~~~   72 (118)
T pfam08477         2 VVVIGDKGSGKSSLLSQLVGGEFPPE--------IPE-EIQGDTLAVDTLEVDGDTELLHIWDFGGREELKFEHIIFMKT   72 (118)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCCCC--------CCC-CCCCCEEEEEEEEECCCEEEEEEEECCCCHHHHHHHHHHCCC
T ss_conf             99999899789999999983988876--------667-877776888999999928999999899967776666542258


Q ss_pred             CCCEEEEECCCCCCCCCHHHH----HHHHHH--CCCCCEEEEECCCC
Q ss_conf             233145201234433210677----888863--18760233100233
Q gi|254780263|r   95 ADGAILVCAAEDGPKPQTREH----ILLARQ--IGISSIVVYMNKVD  135 (392)
Q Consensus        95 ~D~ailvVda~~G~~~QT~eh----~~l~~~--lgi~~iIv~iNKmD  135 (392)
                      +|+++||.|.+.-..=+.-+.    +.-++.  ..+| +|++=||.|
T Consensus        73 ~d~~ilvydit~~~Sf~~~~~~~~~i~~~~~~~~~~p-iilVGnK~D  118 (118)
T pfam08477        73 ADAILLVYDLTDRESLNRVSRLIAWLPHLRKLGKKIP-VILVGNKFD  118 (118)
T ss_pred             CCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCC-EEEEEECCC
T ss_conf             7467899979987899999999999999982099998-899996859


No 259
>pfam03308 ArgK ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems.
Probab=98.41  E-value=5.6e-07  Score=62.32  Aligned_cols=171  Identities=18%  Similarity=0.142  Sum_probs=94.1

Q ss_pred             HCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCC---------------CCCHHH---HHCCCEEEEEEE----
Q ss_conf             1038827999990468988789999998764442001312---------------686869---862920637899----
Q gi|254780263|r    7 VRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDI---------------DSAPEE---KLRGITIATAHV----   64 (392)
Q Consensus         7 ~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~---------------D~~~~E---~~rGiTi~~~~~----   64 (392)
                      .+......|++-|-..+|||||+++|...+.+.+..-+.+               |+...+   +..+.=|-+..+    
T Consensus        24 ~~~g~a~~iGiTG~PGaGKStli~~l~~~~~~~g~~vaVlAvDPSS~~sgGaiLGDr~RM~~~~~~~~vfiRs~~srg~l  103 (267)
T pfam03308        24 PLTGRAHRVGITGVPGAGKSTLIEALGMELRRRGHRVAVLAVDPSSPFTGGSILGDRTRMQRLAVDPGAFIRSSPSRGAL  103 (267)
T ss_pred             HHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHHHHHHHCCCCCEEEEECCCCCCC
T ss_conf             43599559987689988799999999999996898689999789998888630010777765058998588645778888


Q ss_pred             ------------EEECCCEEEEEEECCCCHHHHHHH-HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEE
Q ss_conf             ------------982199089998478730246779-8774002331452012344332106778888631876023310
Q gi|254780263|r   65 ------------SYETDKRFYSHIDCPGHADYVKNM-ITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYM  131 (392)
Q Consensus        65 ------------~~~~~~~~i~iiD~PGH~~f~~~m-i~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~i  131 (392)
                                  -++.-++-+.||-|-|=    +.- +.-+..+|..+||.-...|-+=|.    ..+-.+-+.-++ +|
T Consensus       104 GGls~~t~~~i~lleaaGfD~IivETVGV----GQsE~~v~~~aD~~llv~~Pg~GDeiQ~----iKaGImEiaDi~-vV  174 (267)
T pfam03308       104 GGLSRATREAILLLDAAGFDVIIIETVGV----GQSEVDIANMADTFVLVTIPGGGDDLQG----IKAGLMEIADIY-VV  174 (267)
T ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCC----CCCCHHHHHHCCEEEEEECCCCCHHHHH----HHHHHHHHCCEE-EE
T ss_conf             87147699999999977999999924777----7530355541576899955887608889----875376535489-99


Q ss_pred             CCCCCCCCHHHHHHCCCCCCEEEEE--EEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHH
Q ss_conf             0233356122211012321001110--145322102331146764114445652123320344
Q gi|254780263|r  132 NKVDAVDDDELLDISEYEIRDLLKE--HKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKA  192 (392)
Q Consensus       132 NKmD~v~~~~~~~~i~~~i~~~l~~--~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~  192 (392)
                      ||.|+-+.+.....++.-+ .++..  .+|  ..|++.+|+.++   ......|..+..+.+.
T Consensus       175 NKaD~~~A~~~~~~l~~~l-~l~~~~~~~W--~p~Vl~tSA~~g---~Gi~el~~~I~~~~~~  231 (267)
T pfam03308       175 NKADLPGAERTARELRSAL-HLLTPKEAGW--RPPVLTTSAVTG---EGIDELWDAIEEHREF  231 (267)
T ss_pred             ECCCHHHHHHHHHHHHHHH-HCCCCCCCCC--CCCEEEEECCCC---CCHHHHHHHHHHHHHH
T ss_conf             6676476999999999998-5179877899--999899874788---9999999999999999


No 260
>cd04109 Rab28 Rab28 subfamily.  First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA).  In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos.  Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus.  The two human isoforms are presumbly the result of alternative splicing.  Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs 
Probab=98.40  E-value=1.3e-06  Score=60.13  Aligned_cols=136  Identities=17%  Similarity=0.085  Sum_probs=79.0

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEEEC--C-CEEEEEEECCCCHHHHHHH
Q ss_conf             9999904689887899999987644420013126868698629206--378999821--9-9089998478730246779
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSYET--D-KRFYSHIDCPGHADYVKNM   88 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~~~--~-~~~i~iiD~PGH~~f~~~m   88 (392)
                      .|+++|--.-|||+|+.++....            ..++  .--||  +.....+..  + ...+.|.||+|++.|-. |
T Consensus         2 KvvllGd~~VGKTSli~rf~~~~------------F~~~--y~~TiG~d~~~k~i~i~~~~~v~l~iwDtaGqe~~~~-~   66 (215)
T cd04109           2 KIVVLGDGAVGKTSLCRRFAKEG------------FGKS--YKQTIGLDFFSKRVTLPGNLNVTLQVWDIGGQSIGGK-M   66 (215)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCC------------CCCC--CCCCCCEEEEEEEEEECCCCEEEEEEEECCCCCCHHH-H
T ss_conf             79999999970999999997498------------9887--7886557889999998799469999996998500237-8


Q ss_pred             HHH-HHCCCCEEEEECCCCCCCCCHHHHHH----HH----HHCC-CCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEE
Q ss_conf             877-40023314520123443321067788----88----6318-76023310023335612221101232100111014
Q gi|254780263|r   89 ITG-ATQADGAILVCAAEDGPKPQTREHIL----LA----RQIG-ISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHK  158 (392)
Q Consensus        89 i~g-~~~~D~ailvVda~~G~~~QT~eh~~----l~----~~lg-i~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~  158 (392)
                      ... ...+|+++||-|-+.=   +|-+++.    .+    .... -|.++++=||.|+..  +| +...++-+++.++. 
T Consensus        67 ~~~y~~~a~~~ilVYDitn~---~SF~~l~~W~~~i~~~~~~~~~~~~iiLVGNK~DL~~--~R-~Vs~ee~~~~A~~~-  139 (215)
T cd04109          67 LDKYIYGAHAVFLVYDVTNS---QSFENLEDWYSMVRKVLKSSETQPLVVLVGNKTDLEH--NR-TVKDDKHARFAQAN-  139 (215)
T ss_pred             HHHHHHHHCCEEEECCCCCH---HHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHH--HC-CCCHHHHHHHHHHC-
T ss_conf             99999751513774147867---8999899999999998504577852999975454286--47-76999999999982-


Q ss_pred             EEEEEECCCCEEEEEE
Q ss_conf             5322102331146764
Q gi|254780263|r  159 YSDDTPIIRGSALCAL  174 (392)
Q Consensus       159 ~~~~~pii~~sa~~g~  174 (392)
                         +.+++.+||.+|.
T Consensus       140 ---g~~f~E~SAktg~  152 (215)
T cd04109         140 ---GMESCLVSAKTGD  152 (215)
T ss_pred             ---CCEEEEEECCCCC
T ss_conf             ---9989998389994


No 261
>pfam04670 Gtr1_RagA Gtr1/RagA G protein conserved region. GTR1 was first identified in S. cerevisiae as a suppressor of a mutation in RCC1. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1. Included in this family is the human Rag C, a novel protein that has been shown to interact with RagA/B.
Probab=98.40  E-value=1.4e-06  Score=59.80  Aligned_cols=133  Identities=21%  Similarity=0.298  Sum_probs=85.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC-CCEEEEEEECCCCHHHHHHHH----
Q ss_conf             999904689887899999987644420013126868698629206378999821-990899984787302467798----
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET-DKRFYSHIDCPGHADYVKNMI----   89 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~-~~~~i~iiD~PGH~~f~~~mi----   89 (392)
                      +-.+|--.+|||+.-..+-..+...       |+    +.-|-|+++-...... .+-.+++.|+||+.+|+.+..    
T Consensus         2 iLLMG~~~sGKTSi~~vIF~~~~p~-------dT----~~L~~T~~ve~~~v~~~~~l~l~iwD~pGq~~f~e~~~~~~~   70 (230)
T pfam04670         2 VLLMGLRGSGKSSMRSIIFSNYSPR-------DT----LRLGATIDVEQSHVRFLGNLTLNLWDCPGQDDFMENYLTRQK   70 (230)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCCHH-------HH----CCCCCCCCEEEEEEECCCCCEEEEEECCCCHHHHHHHCCCCH
T ss_conf             7875689998777699986799821-------41----202577776778774168736899976983535441200223


Q ss_pred             -HHHHCCCCEEEEECCCCCCCCC--HH--HHHHHHHHC--CCCCEEEEECCCCCCCCHHH---HHHCCCCCCEEEEEEEE
Q ss_conf             -7740023314520123443321--06--778888631--87602331002333561222---11012321001110145
Q gi|254780263|r   90 -TGATQADGAILVCAAEDGPKPQ--TR--EHILLARQI--GISSIVVYMNKVDAVDDDEL---LDISEYEIRDLLKEHKY  159 (392)
Q Consensus        90 -~g~~~~D~ailvVda~~G~~~Q--T~--eh~~l~~~l--gi~~iIv~iNKmD~v~~~~~---~~~i~~~i~~~l~~~~~  159 (392)
                       .-.+.+.+-|.|+|+.......  ++  +.+..+...  +++ +-|+|.|||++.++++   +..+++++.+.+...+.
T Consensus        71 e~if~~v~~lIyV~D~q~~~~~~~l~~~~~~l~~~~~~sp~~~-v~vfiHK~D~l~~d~r~~~~~~~~~~i~~~~~~~~~  149 (230)
T pfam04670        71 EHIFSNVGVLIYVFDVESREYEEDLATLVKIIEALYQYSPNAK-VFVLIHKMDLLSEDERKEIFEDRKEEIIEEIEDFGI  149 (230)
T ss_pred             HHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCCE-EEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             5476447889999968886099999999999999998399988-999996035888667899999999999998765688


No 262
>COG0536 Obg Predicted GTPase [General function prediction only]
Probab=98.37  E-value=2.1e-06  Score=58.81  Aligned_cols=140  Identities=19%  Similarity=0.194  Sum_probs=81.5

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC-----------
Q ss_conf             799999046898878999999876444200131268686986292063789998219908999847873-----------
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH-----------   81 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH-----------   81 (392)
                      -.++.+|-..+|||||+.+++....+.+..   ..++       +.=+++.... ..+..+.+-|.||-           
T Consensus       160 ADVGLVG~PNaGKSTlls~vS~AkPKIadY---pFTT-------L~PnLGvV~~-~~~~sfv~ADIPGLIEGAs~G~GLG  228 (369)
T COG0536         160 ADVGLVGLPNAGKSTLLSAVSAAKPKIADY---PFTT-------LVPNLGVVRV-DGGESFVVADIPGLIEGASEGVGLG  228 (369)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHCCCCCCCC---CCCC-------CCCCCCEEEE-CCCCEEEEECCCCCCCCCCCCCCCC
T ss_conf             011412589885798998886068854488---6530-------2475307996-4886079934753235644688763


Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCC--CCCC----CHHHHHHHH--HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEE
Q ss_conf             0246779877400233145201234--4332----106778888--6318760233100233356122211012321001
Q gi|254780263|r   82 ADYVKNMITGATQADGAILVCAAED--GPKP----QTREHILLA--RQIGISSIVVYMNKVDAVDDDELLDISEYEIRDL  153 (392)
Q Consensus        82 ~~f~~~mi~g~~~~D~ailvVda~~--G~~~----QT~eh~~l~--~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~  153 (392)
                      -+|+|...|-    -.-+.|||.+.  +..|    ++.++=.-+  ..|--++.+|+.||||++.+++.++..+..+.+.
T Consensus       229 ~~FLrHIERt----~vL~hviD~s~~~~~dp~~~~~~i~~EL~~Y~~~L~~K~~ivv~NKiD~~~~~e~~~~~~~~l~~~  304 (369)
T COG0536         229 LRFLRHIERT----RVLLHVIDLSPIDGRDPIEDYQTIRNELEKYSPKLAEKPRIVVLNKIDLPLDEEELEELKKALAEA  304 (369)
T ss_pred             HHHHHHHHHH----HEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHH
T ss_conf             8888788865----154799856765677989999999999998577753585699985557766789999999999874


Q ss_pred             EEEEEEEEEEECCCCEEEEE
Q ss_conf             11014532210233114676
Q gi|254780263|r  154 LKEHKYSDDTPIIRGSALCA  173 (392)
Q Consensus       154 l~~~~~~~~~pii~~sa~~g  173 (392)
                         .++.   +..++|++++
T Consensus       305 ---~~~~---~~~~ISa~t~  318 (369)
T COG0536         305 ---LGWE---VFYLISALTR  318 (369)
T ss_pred             ---CCCC---CCEEEEHHCC
T ss_conf             ---0887---6315543102


No 263
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O). This domain has homology to domain II of the elongation factors EF-G and EF-2. Tet(M) and Tet(O) catalyze the release of tetracycline (Tc) from the ribosome in a GTP-dependent manner thereby mediating Tc resistance.  Tcs are broad-spectrum antibiotics.  Typical Tcs bind to the ribosome and inhibit the elongation phase of protein synthesis, by inhibiting the occupation of site A by aminoacyl-tRNA.
Probab=98.36  E-value=2.7e-07  Score=64.32  Aligned_cols=81  Identities=16%  Similarity=0.146  Sum_probs=62.4

Q ss_pred             CCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCC----CCCCCCCCCCHHHHHHHCCC
Q ss_conf             00110000000135544543014874245348967999506874321254121001----21144321001366641124
Q gi|254780263|r  205 DAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMF----RKKLDEAIAGDNVGLLLRGV  280 (392)
Q Consensus       205 ~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~----~~~v~~a~aGd~v~l~Lkgi  280 (392)
                      +.||...|+.+-..+..|++...||.||+|+.++.+.+ +.+.   ..|+.+|+.+    ..+++++.|||++++.    
T Consensus         1 e~~l~a~VFKi~~d~~~grl~yvRv~sG~l~~~~~v~~-~~~~---~eki~~l~~~~~~~~~~v~~~~AGdI~av~----   72 (85)
T cd03690           1 ESELSGTVFKIERDDKGERLAYLRLYSGTLRLRDSVRV-NREE---KIKITELRVFNNGEVVTADTVTAGDIAILT----   72 (85)
T ss_pred             CCCCEEEEEEEEECCCCCEEEEEEEEEEEECCCCEEEC-CCCC---EEEECEEEEEECCCEEECCEECCCCEEEEE----
T ss_conf             99734999988877999859999983409828988965-8996---040234899908995697789899999998----


Q ss_pred             CCCEEECHHEEEC
Q ss_conf             5432202117732
Q gi|254780263|r  281 NRADVPRGRVVCA  293 (392)
Q Consensus       281 ~~~di~rGdvl~~  293 (392)
                      ...+++.||+|.+
T Consensus        73 gl~~~~~GDtlgd   85 (85)
T cd03690          73 GLKGLRVGDVLGD   85 (85)
T ss_pred             CCCCCCCCCCCCC
T ss_conf             9998837772278


No 264
>cd04148 RGK RGK subfamily.  The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues.   RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function.  Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells.  RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton.  Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ra
Probab=98.36  E-value=1.3e-06  Score=60.07  Aligned_cols=152  Identities=18%  Similarity=0.146  Sum_probs=87.2

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEE--EECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             9999904689887899999987644420013126868698629206--378999--821990899984787302467798
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVS--YETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~--~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
                      .|+++|.-.-|||+|+.+.+...-.         ..    ...-|+  +.....  ...+...+.+.||+|.+.|.....
T Consensus         2 KVvllGd~gVGKTSLi~rf~~~~f~---------~~----~y~~t~~~d~~~k~v~vd~~~~~l~i~Dt~g~e~~~~~~~   68 (221)
T cd04148           2 RVVMLGSPGVGKSSLASQFTSGEYD---------DH----AYDASGDDDTYERTVSVDGEESTLVVIDHWEQEMWTEDSC   68 (221)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCC---------CC----CCCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHH
T ss_conf             7999998997099999999819869---------86----6787442488999999999998999998987312666656


Q ss_pred             HHHHCCCCEEEEECCCCC-CCCCHHHHHHHHH----HCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             774002331452012344-3321067788886----31876023310023335612221101232100111014532210
Q gi|254780263|r   90 TGATQADGAILVCAAEDG-PKPQTREHILLAR----QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G-~~~QT~eh~~l~~----~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
                       -...+|+++||-|.++= -+....+-+..++    .-.+| +|++=||+|+...-+   ...+|-+++-.+.    +.+
T Consensus        69 -~~~~ada~ilVYdvtdr~SF~~~~~~~~~l~~~~~~~~~p-iILVGNK~DL~~~R~---Vs~eEg~~~A~~~----~~~  139 (221)
T cd04148          69 -MQYQGDAFVVVYSVTDRSSFERASELRIQLRRNRQLEDRP-IILVGNKSDLARSRE---VSVQEGRACAVVF----DCK  139 (221)
T ss_pred             -HHHCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCE-EEEEEECCCHHHHCC---CCHHHHHHHHHHC----CCE
T ss_conf             -5306868999996466778888999999999864899951-999853566686389---9999999999985----998


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCC
Q ss_conf             233114676411444565212332034431025
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTHI  197 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~  197 (392)
                      ++.+||.++.          ++..+++.+...+
T Consensus       140 F~EtSAk~~~----------NV~elF~~lvrqI  162 (221)
T cd04148         140 FIETSAGLQH----------NVDELLEGIVRQI  162 (221)
T ss_pred             EEECCCCCCC----------CHHHHHHHHHHHH
T ss_conf             9994579994----------9899999999999


No 265
>KOG0073 consensus
Probab=98.35  E-value=3.7e-06  Score=57.27  Aligned_cols=144  Identities=22%  Similarity=0.314  Sum_probs=90.6

Q ss_pred             HHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHH-
Q ss_conf             4210388279999904689887899999987644420013126868698629206378999821990899984787302-
Q gi|254780263|r    5 RYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHAD-   83 (392)
Q Consensus         5 ~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~-   83 (392)
                      .+.|++ .++|-++|-=+|||||++.+|++..         .|..  .-.+|.-|    ...+++++.+++-|..|... 
T Consensus        10 ~k~ker-E~riLiLGLdNsGKTti~~kl~~~~---------~~~i--~pt~gf~I----ktl~~~~~~L~iwDvGGq~~l   73 (185)
T KOG0073          10 QKLKER-EVRILILGLDNSGKTTIVKKLLGED---------TDTI--SPTLGFQI----KTLEYKGYTLNIWDVGGQKTL   73 (185)
T ss_pred             HHHHHH-EEEEEEEECCCCCCHHHHHHHCCCC---------CCCC--CCCCCEEE----EEEEECCEEEEEEECCCCCHH
T ss_conf             886523-4479999127898244898853898---------2232--87211355----787742428999974885336


Q ss_pred             --HHHHHHHHHHCCCCEEEEECCCCC-CCCCHHHHHHHH----HHCCCCCEEEEECCCCCCCCHHH--HHHCCCCCCEEE
Q ss_conf             --467798774002331452012344-332106778888----63187602331002333561222--110123210011
Q gi|254780263|r   84 --YVKNMITGATQADGAILVCAAEDG-PKPQTREHILLA----RQIGISSIVVYMNKVDAVDDDEL--LDISEYEIRDLL  154 (392)
Q Consensus        84 --f~~~mi~g~~~~D~ailvVda~~G-~~~QT~eh~~l~----~~lgi~~iIv~iNKmD~v~~~~~--~~~i~~~i~~~l  154 (392)
                        |.+|-.   ..+|+.|.|||+.+- -+.+++.++.-+    +..|-+ ++|.-||.|+...=..  ...+ .++.+++
T Consensus        74 r~~W~nYf---estdglIwvvDssD~~r~~e~~~~L~~lL~eerlaG~~-~Lvlank~dl~~~l~~~~i~~~-~~L~~l~  148 (185)
T KOG0073          74 RSYWKNYF---ESTDGLIWVVDSSDRMRMQECKQELTELLVEERLAGAP-LLVLANKQDLPGALSLEEISKA-LDLEELA  148 (185)
T ss_pred             HHHHHHHH---HCCCEEEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCCHHHHHHH-HCHHHHC
T ss_conf             87887766---50472899997720888999999999997565434884-3999734768552478788876-4778761


Q ss_pred             EEEEEEEEEECCCCEEEEE
Q ss_conf             1014532210233114676
Q gi|254780263|r  155 KEHKYSDDTPIIRGSALCA  173 (392)
Q Consensus       155 ~~~~~~~~~pii~~sa~~g  173 (392)
                      +..    .++++.+|+++|
T Consensus       149 ks~----~~~l~~cs~~tg  163 (185)
T KOG0073         149 KSH----HWRLVKCSAVTG  163 (185)
T ss_pred             CCC----CCEEEEEECCCC
T ss_conf             336----722899854545


No 266
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily.  Rnd1/Rho6 is a member of the novel Rho subfamily Rnd, together with Rnd2/Rho7 and Rnd3/RhoE/Rho8.  Rnd1/Rho6 binds GTP but does not hydrolyze it to GDP, indicating that it is constitutively active.  In rat, Rnd1/Rho6 is highly expressed in the cerebral cortex and hippocampus during synapse formation, and plays a role in spine formation.  Rnd1/Rho6 is also expressed in the liver and in endothelial cells, and is upregulated in uterine myometrial cells during pregnancy.  Like Rnd3/RhoE/Rho8, Rnd1/Rho6 is believed to function as an antagonist to RhoA.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=98.30  E-value=3.3e-06  Score=57.53  Aligned_cols=141  Identities=21%  Similarity=0.174  Sum_probs=80.2

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-EEECCC--EEEEEEECCCCHHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869862920637899-982199--0899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-SYETDK--RFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~~~~~~--~~i~iiD~PGH~~f~~~mi   89 (392)
                      ..++++|.-.-|||+|+-++...            ..+++  .--|+--.|. .++.++  ..+.|-||.|+++|-.-.-
T Consensus        14 ~KiVlVGD~~VGKTsLl~~~~~~------------~F~~~--y~pTv~~~~~~~i~v~~~~v~L~lWDTAGqE~y~~lr~   79 (232)
T cd04174          14 CKLVLVGDVQCGKTAMLQVLAKD------------CYPET--YVPTVFENYTAGLETEEQRVELSLWDTSGSPYYDNVRP   79 (232)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHC------------CCCCC--CCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCHHHH
T ss_conf             89999998998999999999739------------89998--58836888899999999999999983899701003679


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHH------HHHHH-CCCCCEEEEECCCCCCCCHHHH-HHCC--------CCCCEE
Q ss_conf             774002331452012344332106778------88863-1876023310023335612221-1012--------321001
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHI------LLARQ-IGISSIVVYMNKVDAVDDDELL-DISE--------YEIRDL  153 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~------~l~~~-lgi~~iIv~iNKmD~v~~~~~~-~~i~--------~~i~~~  153 (392)
                      .--..+|++|||-|.+.   ++|-+++      .+-.. -++| +|++=||.|+-++.... ++..        ++-..+
T Consensus        80 ~yY~~a~~~ll~Fdvt~---~~Sfe~~~~~Wi~Ei~~~~p~~p-iiLVGnK~DLr~d~~~l~~L~~~~~~pVt~eeg~~~  155 (232)
T cd04174          80 LCYSDSDAVLLCFDISR---PETVDSALKKWKAEIMDYCPSTR-ILLIGCKTDLRTDLSTLMELSNQKQAPISYEQGCAL  155 (232)
T ss_pred             HHHCCCCEEEEEEECCC---HHHHHHHHHHHHHHHHHHCCCCC-EEEEEECHHCCCCHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             97406878999996898---79999899999999998689997-899987602154757788997568887579999999


Q ss_pred             EEEEEEEEEEECCCCEEEEEE
Q ss_conf             110145322102331146764
Q gi|254780263|r  154 LKEHKYSDDTPIIRGSALCAL  174 (392)
Q Consensus       154 l~~~~~~~~~pii~~sa~~g~  174 (392)
                      .++.+.   ..++.+||.+|-
T Consensus       156 Ak~iga---~~Y~E~SA~tge  173 (232)
T cd04174         156 AKQLGA---EVYLECSAFTSE  173 (232)
T ss_pred             HHHCCC---CEEEECCCCCCC
T ss_conf             997499---789987568666


No 267
>cd04131 Rnd Rnd subfamily.  The Rnd subfamily contains Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8.  These novel Rho family proteins have substantial structural differences compared to other Rho members, including N- and C-terminal extensions relative to other Rhos.  Rnd3/RhoE is farnesylated at the C-terminal prenylation site, unlike most other Rho proteins that are geranylgeranylated.  In addition, Rnd members are unable to hydrolyze GTP and are resistant to GAP activity.  They are believed to exist only in the GTP-bound conformation, and are antagonists of RhoA activity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=98.30  E-value=4.2e-06  Score=56.91  Aligned_cols=142  Identities=19%  Similarity=0.157  Sum_probs=79.4

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE-EEEECCC--EEEEEEECCCCHHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789-9982199--0899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH-VSYETDK--RFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~-~~~~~~~--~~i~iiD~PGH~~f~~~mi   89 (392)
                      +.|+++|.-.-|||+|+-++...            ..+++  .--|+-..+ ..+..++  ..+.|-||+|.++|-.-.-
T Consensus         2 ~KivlvGd~~VGKTsLi~r~~~~------------~F~~~--y~pTi~~~~~~~~~v~~~~v~l~iwDTaGqe~~~~l~~   67 (178)
T cd04131           2 CKIVVVGDVQCGKTALLQVFAKD------------CYPET--YVPTVFENYTASFEIDEQRIELSLWDTSGSPYYDNVRP   67 (178)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCC------------CCCCC--CCCCEEEEEEEEEEECCEEEEEEEEECCCCHHHCCHHH
T ss_conf             09999999997789999999639------------99998--57856888899999999999999996898742110366


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHH----HH-HHHH--CCCCCEEEEECCCCCCCCHH-HHH--------HCCCCCCEE
Q ss_conf             77400233145201234433210677----88-8863--18760233100233356122-211--------012321001
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREH----IL-LARQ--IGISSIVVYMNKVDAVDDDE-LLD--------ISEYEIRDL  153 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh----~~-l~~~--lgi~~iIv~iNKmD~v~~~~-~~~--------~i~~~i~~~  153 (392)
                      .....+|++|||-|.+.-   .|-++    +. -++.  -.+| +|++=||.|+-++.. ..+        ...++-.++
T Consensus        68 ~~y~~a~~~ilvydit~~---~Sf~~v~~~W~~ei~~~~~~~~-iiLVGnK~DLr~~~~~~~~~~~~~~~~Vs~eeg~~~  143 (178)
T cd04131          68 LCYPDSDAVLICFDISRP---ETLDSVLKKWRGEIQEFCPNTK-VLLVGCKTDLRTDLSTLMELSHQRQAPVSYEQGCAI  143 (178)
T ss_pred             HHHCCCCEEEEEEECCCH---HHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             773468789999737987---8899999999999998687998-899998543664445566776446777689999999


Q ss_pred             EEEEEEEEEEECCCCEEEEEEE
Q ss_conf             1101453221023311467641
Q gi|254780263|r  154 LKEHKYSDDTPIIRGSALCALQ  175 (392)
Q Consensus       154 l~~~~~~~~~pii~~sa~~g~~  175 (392)
                      -++.+   -.+++.+||.+|-+
T Consensus       144 A~~~g---a~~y~EtSAktg~n  162 (178)
T cd04131         144 AKQLG---AEIYLECSAFTSEK  162 (178)
T ss_pred             HHHCC---CCEEEECCCCCCCC
T ss_conf             99749---98999978486873


No 268
>cd04129 Rho2 Rho2 subfamily.  Rho2 is a fungal GTPase that plays a role in cell morphogenesis, control of cell wall integrity, control of growth polarity, and maintenance of growth direction.  Rho2 activates the protein kinase C homolog Pck2, and Pck2 controls Mok1, the major (1-3) alpha-D-glucan synthase.  Together with Rho1 (RhoA), Rho2 regulates the construction of the cell wall.  Unlike Rho1, Rho2 is not an essential protein, but its overexpression is lethal.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for proper intracellular localization via membrane attachment.  As with other Rho family GTPases, the GDP/GTP cycling is regulated by GEFs (guanine nucleotide exchange factors), GAPs (GTPase-activating proteins) and GDIs (guanine nucleotide dissociation inhibitors).
Probab=98.29  E-value=1.3e-06  Score=60.10  Aligned_cols=152  Identities=19%  Similarity=0.173  Sum_probs=83.3

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-EEECCC--EEEEEEECCCCHHHHHHHHH
Q ss_conf             999990468988789999998764442001312686869862920637899-982199--08999847873024677987
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-SYETDK--RFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~~~~~~--~~i~iiD~PGH~~f~~~mi~   90 (392)
                      .|+++|--..|||+|+-++...            ..+++  .--|+...|. .+..++  ..+.|.||+|+++|-.-.-.
T Consensus         3 KivllGd~~VGKTsLi~r~~~~------------~f~~~--y~pTi~~~~~~~i~v~~~~v~l~iwDTaG~e~~~~~~~~   68 (187)
T cd04129           3 KLVIVGDGACGKTSLLSVFTLG------------EFPEE--YHPTVFENYVTDCRVDGKPVQLALWDTAGQEEYERLRPL   68 (187)
T ss_pred             EEEEECCCCCCHHHHHHHHHHC------------CCCCC--CCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCCCCCC
T ss_conf             9999998997689999999829------------89998--788667898999999999999999978887034546041


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHH-----HHHHHC--CCCCEEEEECCCCCCCCHHH----H-H-HC-CCCCCEEEEE
Q ss_conf             74002331452012344332106778-----888631--87602331002333561222----1-1-01-2321001110
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHI-----LLARQI--GISSIVVYMNKVDAVDDDEL----L-D-IS-EYEIRDLLKE  156 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~-----~l~~~l--gi~~iIv~iNKmD~v~~~~~----~-~-~i-~~~i~~~l~~  156 (392)
                      -...+|++|||-|.+.-   +|-+++     ..++..  .+| +|++-||+|+-+....    . + .+ .++-..+-++
T Consensus        69 ~~~~a~~~ilvydi~~~---~Sf~~~~~~w~~~~~~~~~~~p-iilVGnK~DL~~~~~~~~~~~~~r~V~~~~g~~~a~~  144 (187)
T cd04129          69 SYSKAHVILIGFAVDTP---DSLENVRTKWIEEVRRYCPNVP-VILVGLKKDLRQDAVAKEEYRTQRFVPIQQGKRVAKE  144 (187)
T ss_pred             EECCCCEEEEECCCCCH---HHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCCCCCCCHHHCCCCCHHHHHHHHHH
T ss_conf             23388589997026986---6799999999999998587998-8999886001134112111223155789999999998


Q ss_pred             EEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCC
Q ss_conf             1453221023311467641144456521233203443102
Q gi|254780263|r  157 HKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTH  196 (392)
Q Consensus       157 ~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~  196 (392)
                      .+.   .+++.+||.++.          ++..+++.+...
T Consensus       145 ~~~---~~y~EtSAk~~~----------nV~e~F~~~~r~  171 (187)
T cd04129         145 IGA---KKYMECSALTGE----------GVDDVFEAATRA  171 (187)
T ss_pred             CCC---CEEEEECCCCCC----------CHHHHHHHHHHH
T ss_conf             499---789996889997----------989999999999


No 269
>COG1163 DRG Predicted GTPase [General function prediction only]
Probab=98.29  E-value=1.5e-06  Score=59.69  Aligned_cols=85  Identities=24%  Similarity=0.234  Sum_probs=59.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC---HHH----H
Q ss_conf             799999046898878999999876444200131268686986292063789998219908999847873---024----6
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH---ADY----V   85 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH---~~f----~   85 (392)
                      ..++++|-...|||||+..||...++.+..    ..+        |...--..+++++..|-|+|+||-   +..    .
T Consensus        64 a~v~lVGfPsvGKStLL~~LTnt~seva~y----~FT--------Tl~~vPG~l~Y~ga~IQild~Pgii~gas~g~grG  131 (365)
T COG1163          64 ATVALVGFPSVGKSTLLNKLTNTKSEVADY----PFT--------TLEPVPGMLEYKGAQIQLLDLPGIIEGASSGRGRG  131 (365)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCCCCCC----CCE--------ECCCCCCEEEECCCEEEEECCCCCCCCCCCCCCCC
T ss_conf             389997688745899998876887643456----741--------02445744754781699972763125765688876


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCC
Q ss_conf             779877400233145201234433
Q gi|254780263|r   86 KNMITGATQADGAILVCAAEDGPK  109 (392)
Q Consensus        86 ~~mi~g~~~~D~ailvVda~~G~~  109 (392)
                      +.++..+..||..++|+|+.+...
T Consensus       132 ~~vls~~R~ADlIiiVld~~~~~~  155 (365)
T COG1163         132 RQVLSVARNADLIIIVLDVFEDPH  155 (365)
T ss_pred             CEEEEEECCCCEEEEEEECCCCHH
T ss_conf             465465215888999971688824


No 270
>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p. During the process of peptide synthesis and tRNA site changes, the ribosome is moved along the mRNA a distance equal to one codon with the addition of each amino acid. This translocation step is catalyzed by EF-2_GTP, which is hydrolyzed to provide the required energy. Thus, this action releases the uncharged tRNA from the P site and transfers the newly formed peptidyl-tRNA from the A site to the P site. Yeast Snu114p is essential for cell viability and for splicing in vivo. U5-116 kD binds GTP.  Experiments suggest that GTP binding and probably GTP hydrolysis is important for the function of the U5-116 kD/Snu114p.
Probab=98.24  E-value=1e-06  Score=60.76  Aligned_cols=69  Identities=23%  Similarity=0.390  Sum_probs=51.6

Q ss_pred             CCCCCEEEEEEECCCCCCCEEEEEECC------CCCCCEEEECCCCC----CCCCCCCCCCHHHHHHHCCCCCCEEECHH
Q ss_conf             445430148742453489679995068------74321254121001----21144321001366641124543220211
Q gi|254780263|r  220 GRGTVVTGCIKRGRIKAGSDVEIIGMG------GKKLKVKCTDVEMF----RKKLDEAIAGDNVGLLLRGVNRADVPRGR  289 (392)
Q Consensus       220 g~G~Vv~GrV~sG~l~~Gd~i~i~p~~------~~~~~~kv~si~~~----~~~v~~a~aGd~v~l~Lkgi~~~di~rGd  289 (392)
                      ..+-+.+|||.||+|+.||+++++.++      ....+.+|.+++.+    +.++++|.||++|++  .|++  +++.|.
T Consensus        14 ~~~fia~gRV~SGtl~~G~~V~vlgp~y~~~~~~~~~~~~I~~l~~~~G~~~~~v~~~~AGnIv~i--~Gld--~~~~g~   89 (93)
T cd03700          14 KGGFIAFGRVFSGTIRKGQKVRVLGPNYSPEDEEDLSKKTIQRLYLMMGRYREPVDEVPAGNIVLI--VGLD--QLKSGT   89 (93)
T ss_pred             CCEEEEEEEEEECEEECCCEEEEECCCCCCCCCCEEEEEEEEEEEEEECCCEEECCEECCCCEEEE--ECCC--CCEEEE
T ss_conf             978999999986668089999997887888877613388986999995688999098889999999--7765--443775


Q ss_pred             EEE
Q ss_conf             773
Q gi|254780263|r  290 VVC  292 (392)
Q Consensus       290 vl~  292 (392)
                      +.+
T Consensus        90 ~~t   92 (93)
T cd03700          90 TAT   92 (93)
T ss_pred             EEE
T ss_conf             983


No 271
>cd04102 RabL3 RabL3 (Rab-like3) subfamily.  RabL3s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL3 lacks a prenylation site at the C-terminus.  The specific function of RabL3 remains unknown.
Probab=98.24  E-value=1.4e-05  Score=53.64  Aligned_cols=113  Identities=19%  Similarity=0.269  Sum_probs=70.1

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC-----CCEEEEEEECCCCHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378999821-----9908999847873024677
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET-----DKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~-----~~~~i~iiD~PGH~~f~~~   87 (392)
                      +.|+++|.-.-|||+|+.++....-        ..+  ....-|.+++.....+..     ..+.+.|-||.|.+.| ++
T Consensus         1 vKIlllGDsgVGKTSL~~~~~~~~f--------~~~--~~~TiG~~v~~k~~~~~~~~~~~k~~~l~lWDtaGqery-~s   69 (202)
T cd04102           1 VRVLVVGDSGVGKSSLVHLICKNQV--------LGR--PSWTVGCSVDVKHHTYKEGTPEEKTFFVELWDVGGSESV-KS   69 (202)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC--------CCC--CCCCEEEEEEEEEEEECCCCCCCCEEEEEEEECCCCHHH-HH
T ss_conf             9899999999899999999983988--------888--888503678999999337876783899999989987757-76


Q ss_pred             HHHH-HHCCCCEEEEECCCCCCCCCHHHHH-----HH---------------------HHHCCCCCEEEEECCCCCCCCH
Q ss_conf             9877-4002331452012344332106778-----88---------------------8631876023310023335612
Q gi|254780263|r   88 MITG-ATQADGAILVCAAEDGPKPQTREHI-----LL---------------------ARQIGISSIVVYMNKVDAVDDD  140 (392)
Q Consensus        88 mi~g-~~~~D~ailvVda~~G~~~QT~eh~-----~l---------------------~~~lgi~~iIv~iNKmD~v~~~  140 (392)
                      |... -..+|++|||-|.+.-   +|-+++     .+                     .....|| ++|+=||.|++...
T Consensus        70 l~~~yYr~a~gvILVyDvTnr---~SF~nL~~Wl~Eil~~~~~~~~~~~~~~~~~~~~~~~~~vP-ilvVGtK~D~~~~r  145 (202)
T cd04102          70 TRAVFYNQVNGIILVHDLTNR---KSSQNLQRWSLEALNKDTFPTGLLVTNGDYDSEQFGGNQIP-LLVIGTKLDQIPEK  145 (202)
T ss_pred             HHHHHHCCCCEEEEEEECCCH---HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCC-EEEEEECHHHCCCC
T ss_conf             789975889899999989498---99986999999997536766654556665553334678975-89997606524343


No 272
>cd04143 Rhes_like Rhes_like subfamily.  This subfamily includes Rhes (Ras homolog enriched in striatum) and Dexras1/AGS1 (activator of G-protein signaling 1).  These proteins are homologous, but exhibit significant differences in tissue distribution and subcellular localization.  Rhes is found primarily in the striatum of the brain, but is also expressed in other areas of the brain, such as the cerebral cortex, hippocampus, inferior colliculus, and cerebellum.  Rhes expression is controlled by thyroid hormones.  In rat PC12 cells, Rhes is farnesylated and localizes to the plasma membrane.  Rhes binds and activates PI3K, and plays a role in coupling serpentine membrane receptors with heterotrimeric G-protein signaling.  Rhes has recently been shown to be reduced under conditions of dopamine supersensitivity and may play a role in determining dopamine receptor sensitivity.  Dexras1/AGS1 is a dexamethasone-induced Ras protein that is expressed primarily in the brain, with low expression l
Probab=98.24  E-value=2.7e-06  Score=58.11  Aligned_cols=155  Identities=19%  Similarity=0.171  Sum_probs=86.4

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE-EEEE--EEEECCCEEEEEEECCCCHHHHHHHHH
Q ss_conf             9999904689887899999987644420013126868698629206-3789--998219908999847873024677987
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI-ATAH--VSYETDKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi-~~~~--~~~~~~~~~i~iiD~PGH~~f~~~mi~   90 (392)
                      .|+++|.-.-|||+|+.+++...=.+              +---|| +...  ..+..+...+.|.||.|.+.|-.-.-.
T Consensus         2 KIvvlGdsgVGKTSLi~Rf~~~~F~~--------------~y~pTi~d~~~k~i~i~g~~v~L~IwDTaGqe~f~sl~~~   67 (247)
T cd04143           2 RMVVLGASKVGKTAIVSRFLGGRFEE--------------QYTPTIEDFHRKLYSIRGEVYQLDILDTSGNHPFPAMRRL   67 (247)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCC--------------CCCCCHHHEEEEEEEECCEEEEEEEEECCCCCCCCCCHHH
T ss_conf             79999989978999999996496899--------------8788835318899999999999999967665368744201


Q ss_pred             HHHCCCCEEEEECCCCCCC-C---CHHHHHHHH---------HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEE
Q ss_conf             7400233145201234433-2---106778888---------63187602331002333561222110123210011101
Q gi|254780263|r   91 GATQADGAILVCAAEDGPK-P---QTREHILLA---------RQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEH  157 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~-~---QT~eh~~l~---------~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~  157 (392)
                      -...+|++|||-|.+.-.. .   +-.+.+.-.         ..-.+| +|++=||.|+-+.  |. ...+|..+++.. 
T Consensus        68 y~~~a~~~IlVYDITnr~SFe~v~~w~~~I~e~k~~~~~~~~~~~~vp-iiLVGNK~DL~~~--R~-Vs~eEa~~~~A~-  142 (247)
T cd04143          68 SILTGDVFILVFSLDNRESFEEVCRLREQILETKSCLKNKTKENVKIP-MVICGNKADRDFP--RE-VQRDEVEQLVGG-  142 (247)
T ss_pred             HHHCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC-EEEEEECCCCHHC--CC-CCHHHHHHHHHH-
T ss_conf             312177899999799878999899999999986400100135788875-8998665543201--78-799999999997-


Q ss_pred             EEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCC
Q ss_conf             453221023311467641144456521233203443102522
Q gi|254780263|r  158 KYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPT  199 (392)
Q Consensus       158 ~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~  199 (392)
                        .....++.+||.++.          ++..++..|......
T Consensus       143 --~~~~~f~EtSAKt~~----------NV~E~F~~L~~~~~l  172 (247)
T cd04143         143 --DENCAYFEVSAKKNS----------NLDEMFRALFSLAKL  172 (247)
T ss_pred             --HCCCEEEECCCCCCC----------CHHHHHHHHHHHCCC
T ss_conf             --689879988789994----------989999999985499


No 273
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran is involved in the active transport of proteins through nuclear pores.
Probab=98.22  E-value=2.2e-06  Score=58.71  Aligned_cols=131  Identities=21%  Similarity=0.198  Sum_probs=75.6

Q ss_pred             EECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEEECCC--EEEEEEECCCCHHHHHHHHHH-H
Q ss_conf             904689887899999987644420013126868698629206--37899982199--089998478730246779877-4
Q gi|254780263|r   18 IGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSYETDK--RFYSHIDCPGHADYVKNMITG-A   92 (392)
Q Consensus        18 iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~~~~~--~~i~iiD~PGH~~f~~~mi~g-~   92 (392)
                      +|.-.-|||||+-+.....            .  +...--||  +.....+..++  .++.|-||+|.+.|-. |..+ .
T Consensus         1 vGD~gVGKTsli~R~~~~~------------F--~~~y~pTiGvd~~~~~~~~~~~~i~l~iWDTAGqE~f~s-l~~~yy   65 (200)
T smart00176        1 VGDGGTGKTTFVKRHLTGE------------F--EKKYVATLGVEVHPLVFHTNRGPIRFNVWDTAGQEKFGG-LRDGYY   65 (200)
T ss_pred             CCCCCCCHHHHHHHHHCCC------------C--CCCCCCCEEEEEEEEEEEECCEEEEEEEEECCCCCCCCC-CCHHHC
T ss_conf             9898878999999994099------------9--999788714898999999899899999998988700011-026550


Q ss_pred             HCCCCEEEEECCCCCCCCCHHHHH-----HHHHH-CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             002331452012344332106778-----88863-187602331002333561222110123210011101453221023
Q gi|254780263|r   93 TQADGAILVCAAEDGPKPQTREHI-----LLARQ-IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        93 ~~~D~ailvVda~~G~~~QT~eh~-----~l~~~-lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
                      ..++++|||.|.+.-   +|-+++     .+.+. -.+| +|+|=||+|+.+. +    +..+-..+-++.    +.+++
T Consensus        66 r~a~~~IlvfDvt~~---~SF~~l~~W~~~l~~~~~~ip-iiLvGNK~DL~~r-~----V~~e~~~~a~~~----~~~y~  132 (200)
T smart00176       66 IQGQCAIIMFDVTAR---VTYKNVPNWHRDLVRVCENIP-IVLCGNKVDVKDR-K----VKAKSITFHRKK----NLQYY  132 (200)
T ss_pred             CCCCEEEEEEECCCH---HHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCC-C----CCHHHHHHHHHC----CCCEE
T ss_conf             578788999635877---899989999999998579998-8999988757404-3----659999999987----99789


Q ss_pred             CCEEEEEEEC
Q ss_conf             3114676411
Q gi|254780263|r  167 RGSALCALQG  176 (392)
Q Consensus       167 ~~sa~~g~~~  176 (392)
                      .+||.++.+.
T Consensus       133 EtSAKt~~Nv  142 (200)
T smart00176      133 DISAKSNYNF  142 (200)
T ss_pred             EEECCCCCCH
T ss_conf             8300469697


No 274
>KOG0092 consensus
Probab=98.17  E-value=8.1e-06  Score=55.16  Aligned_cols=158  Identities=20%  Similarity=0.277  Sum_probs=94.4

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEE--EECCC--EEEEEEECCCCHHH--
Q ss_conf             8279999904689887899999987644420013126868698629206378999--82199--08999847873024--
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVS--YETDK--RFYSHIDCPGHADY--   84 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~--~~~~~--~~i~iiD~PGH~~f--   84 (392)
                      ..+.++++|-...|||+|+-|...            |...+-  +--||-.+|..  ....+  .++-|=||.|.+.|  
T Consensus         4 ~~~KvvLLG~~~VGKSSlV~Rfvk------------~~F~e~--~e~TIGaaF~tktv~~~~~~ikfeIWDTAGQERy~s   69 (200)
T KOG0092           4 REFKVVLLGDSGVGKSSLVLRFVK------------DQFHEN--IEPTIGAAFLTKTVTVDDNTIKFEIWDTAGQERYHS   69 (200)
T ss_pred             CEEEEEEECCCCCCCHHHHHHHHH------------CCCCCC--CCCCCCEEEEEEEEEECCCEEEEEEEECCCCCCCCC
T ss_conf             257999986787770241122232------------756632--345400078999998489578999987677300335


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCC-CCCCHHHHHHHHHHCCCCCEEE--EECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             67798774002331452012344-3321067788886318760233--10023335612221101232100111014532
Q gi|254780263|r   85 VKNMITGATQADGAILVCAAEDG-PKPQTREHILLARQIGISSIVV--YMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        85 ~~~mi~g~~~~D~ailvVda~~G-~~~QT~eh~~l~~~lgi~~iIv--~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
                      +..|.  -+.|++||+|-|.+.- -+.+-++-+.-++...-|++++  +=||+|+.+.-+   .-.++.+.+-..    .
T Consensus        70 lapMY--yRgA~AAivvYDit~~~SF~~aK~WvkeL~~~~~~~~vialvGNK~DL~~~R~---V~~~ea~~yAe~----~  140 (200)
T KOG0092          70 LAPMY--YRGANAAIVVYDITDEESFEKAKNWVKELQRQASPNIVIALVGNKADLLERRE---VEFEEAQAYAES----Q  140 (200)
T ss_pred             CCCCE--ECCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCC---CCHHHHHHHHHH----C
T ss_conf             56101--04776799998556678999999999999862798759998325165410345---468888989985----4


Q ss_pred             EEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCC
Q ss_conf             2102331146764114445652123320344310252222
Q gi|254780263|r  162 DTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQ  201 (392)
Q Consensus       162 ~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~  201 (392)
                      ..+++..||.+|.          ++..++..|...+|...
T Consensus       141 gll~~ETSAKTg~----------Nv~~if~~Ia~~lp~~~  170 (200)
T KOG0092         141 GLLFFETSAKTGE----------NVNEIFQAIAEKLPCSD  170 (200)
T ss_pred             CCEEEEEECCCCC----------CHHHHHHHHHHHCCCCC
T ss_conf             9879998525565----------89999999997566766


No 275
>pfam04548 AIG1 AIG1 family. Arabidopsis protein AIG1 appears to be involved in plant resistance to bacteria.
Probab=98.16  E-value=2.1e-05  Score=52.59  Aligned_cols=117  Identities=23%  Similarity=0.317  Sum_probs=73.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCH-------HHH
Q ss_conf             7999990468988789999998764442001312686869862920637899982199089998478730-------246
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHA-------DYV   85 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~-------~f~   85 (392)
                      |+|+.+|-..+|||+....|++...-...       .   -....|-......-.++++++++|||||--       +..
T Consensus         1 LrivLlGktG~GKSstgNtILG~~~F~s~-------~---~~~~vT~~c~~~~~~~~gr~v~ViDTPgl~~~~~~~~~~~   70 (200)
T pfam04548         1 LRIVLVGKTGNGKSATGNSILGRKAFESK-------L---RAQGVTKTCQLVSRTWDGRIINVIDTPGLFDLSVSNDFIS   70 (200)
T ss_pred             CEEEEECCCCCCHHHHHHHHCCCCCCCCC-------C---CCCCCCEEEEEEEEEECCEEEEEEECCCCCCCCCCHHHHH
T ss_conf             98999799998436557661797533578-------9---8888741368999998996899997866357677869999


Q ss_pred             HHHHHHHH----CCCCEEEEECCCCCCCCCHHHHHH-HHHHCC---CCCEEEEECCCCCCCCH
Q ss_conf             77987740----023314520123443321067788-886318---76023310023335612
Q gi|254780263|r   86 KNMITGAT----QADGAILVCAAEDGPKPQTREHIL-LARQIG---ISSIVVYMNKVDAVDDD  140 (392)
Q Consensus        86 ~~mi~g~~----~~D~ailvVda~~G~~~QT~eh~~-l~~~lg---i~~iIv~iNKmD~v~~~  140 (392)
                      +++.+.++    .+|+.|||++... ...+-++.+. +...+|   .++.||..+.-|....+
T Consensus        71 ~ei~~~~~l~~pGpHa~LLVi~~~r-fT~ee~~~v~~i~~~FGe~~~~~tIVLFT~~D~L~~~  132 (200)
T pfam04548        71 KEIIRCLLLAEPGPHAVLLVLSLGR-FTEEEEQALRTLQELFGSKILDYMIVVFTRKDDLEDD  132 (200)
T ss_pred             HHHHHHHHHCCCCCCEEEEEEECCC-CCHHHHHHHHHHHHHHHHHHHHHEEEEEECHHHCCCC
T ss_conf             9999999855899857999986688-8889999999999997578680099999780214999


No 276
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily.  Rnd3/RhoE/Rho8 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd2/Rho7.  Rnd3/RhoE is known to bind the serine-threonine kinase ROCK I.  Unphosphorylated Rnd3/RhoE associates primarily with membranes, but ROCK I-phosphorylated Rnd3/RhoE localizes in the cytosol.  Phosphorylation of Rnd3/RhoE correlates with its activity in disrupting RhoA-induced stress fibers and inhibiting Ras-induced fibroblast transformation.  In cells that lack stress fibers, such as macrophages and monocytes, Rnd3/RhoE induces a redistribution of actin, causing morphological changes in the cell.  In addition, Rnd3/RhoE has been shown to inhibit cell cycle progression in G1 phase at a point upstream of the pRb family pocket protein checkpoint.  Rnd3/RhoE has also been shown to inhibit Ras- and Raf-induced fibroblast transformation.  In mammary epithelial tumor cells, Rnd3/RhoE regulates the assembly of the apical junction complex and tight
Probab=98.16  E-value=1.1e-05  Score=54.28  Aligned_cols=145  Identities=18%  Similarity=0.138  Sum_probs=78.8

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE-EEEECCC--EEEEEEECCCCHHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789-9982199--0899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH-VSYETDK--RFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~-~~~~~~~--~~i~iiD~PGH~~f~~~mi   89 (392)
                      +.|+++|.-.-|||+|+-++...            ..+++  .--||-..+ ..++.++  ..+.|-||+|+++|-.-.-
T Consensus         6 ~KivlvGd~~VGKTsLi~r~~~~------------~F~~~--y~pTi~~~~~~~~~i~~~~v~l~iwDTaGqe~f~~l~~   71 (182)
T cd04172           6 CKIVVVGDSQCGKTALLHVFAKD------------CFPEN--YVPTVFENYTASFEIDTQRIELSLWDTSGSPYYDNVRP   71 (182)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHC------------CCCCC--CCCEEEEEEEEEEEECCEEEEEEEEECCCCHHCCCCCH
T ss_conf             89999999998999999999839------------99998--68735322689999999999999996898620122125


Q ss_pred             HHHHCCCCEEEEECCCCCCC-CCHHHHHH-HHHH--CCCCCEEEEECCCCCCCCHH-HHHH-------C-CCCCCEEEEE
Q ss_conf             77400233145201234433-21067788-8863--18760233100233356122-2110-------1-2321001110
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPK-PQTREHIL-LARQ--IGISSIVVYMNKVDAVDDDE-LLDI-------S-EYEIRDLLKE  156 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~-~QT~eh~~-l~~~--lgi~~iIv~iNKmD~v~~~~-~~~~-------i-~~~i~~~l~~  156 (392)
                      .....+|+++||-|-++-.. ..-.+.+. .++.  -.+| +|++=||.|+-++.. ..+.       + .++-.++-++
T Consensus        72 ~~y~~~~~~ilvydit~~~Sf~~v~~~W~~ei~~~~~~~~-iiLVGnK~DLr~~~~~~~~l~~~~~~~Vs~eeg~~~A~~  150 (182)
T cd04172          72 LSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTK-MLLVGCKSDLRTDLTTLVELSNHRQTPVSYDQGANMAKQ  150 (182)
T ss_pred             HHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             5512787899996489778899999999999998687998-899961710124414566776456778699999999997


Q ss_pred             EEEEEEEECCCCEEEEEEE
Q ss_conf             1453221023311467641
Q gi|254780263|r  157 HKYSDDTPIIRGSALCALQ  175 (392)
Q Consensus       157 ~~~~~~~pii~~sa~~g~~  175 (392)
                      .+   ..+++.+||..+.+
T Consensus       151 ~g---~~~y~EtSAk~~~n  166 (182)
T cd04172         151 IG---AATYIECSALQSEN  166 (182)
T ss_pred             CC---CCEEEECCCCCCCC
T ss_conf             69---97999917078995


No 277
>TIGR01425 SRP54_euk signal recognition particle protein SRP54; InterPro: IPR006325    The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , . SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor . In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane.    This entry represents the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species.; GO: 0005525 GTP binding, 0008312 7S RNA binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0048500 signal recognition particle.
Probab=98.13  E-value=1.2e-05  Score=54.00  Aligned_cols=126  Identities=21%  Similarity=0.284  Sum_probs=82.9

Q ss_pred             HHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCC----CCCC------CHH--HHHC----CCE-----EEE--
Q ss_conf             4210388279999904689887899999987644420013----1268------686--9862----920-----637--
Q gi|254780263|r    5 RYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYG----DIDS------APE--EKLR----GIT-----IAT--   61 (392)
Q Consensus         5 ~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~----~~D~------~~~--E~~r----GiT-----i~~--   61 (392)
                      +..|.|+++ |.++|==.|||||.+-.|-.++.+.+..-+    ++.|      ++.  -|++    |+-     +.+  
T Consensus       115 ~p~Kgk~~V-iMfVGLQGaGKTTtctKLA~YYk~rGfK~~lvCADTFRAGAFdQLkqNA~kA~iPFYGsy~E~DPVkiA~  193 (453)
T TIGR01425       115 TPKKGKSSV-IMFVGLQGAGKTTTCTKLAYYYKRRGFKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYLESDPVKIAS  193 (453)
T ss_pred             ECCCCCCEE-EEEEECCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCEEEEC
T ss_conf             115688215-8886214887156687877776326643256517754232489998747644897120104898707800


Q ss_pred             -EEEEEECCCEEEEEEECCC-CH---HHHHHH--HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHC--CCCCEEEEEC
Q ss_conf             -8999821990899984787-30---246779--8774002331452012344332106778888631--8760233100
Q gi|254780263|r   62 -AHVSYETDKRFYSHIDCPG-HA---DYVKNM--ITGATQADGAILVCAAEDGPKPQTREHILLARQI--GISSIVVYMN  132 (392)
Q Consensus        62 -~~~~~~~~~~~i~iiD~PG-H~---~f~~~m--i~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~l--gi~~iIv~iN  132 (392)
                       |...|.-++.-|.||||=| |+   ..-.+|  ++-|-++|..|.|-|++-|   |.-|  ..|+++  .+..-=|.||
T Consensus       194 EGv~~Fk~E~~diIivDTSGRHkQe~~LF~Em~qv~~Ai~Pd~iifVMDGsIG---QAA~--~QAkAFK~~~~vGSvIiT  268 (453)
T TIGR01425       194 EGVEKFKKEKFDIIIVDTSGRHKQEEELFEEMVQVAEAIKPDSIIFVMDGSIG---QAAF--SQAKAFKDSVEVGSVIIT  268 (453)
T ss_pred             CCHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCHH---HHHH--HHHHHHHHCCCCEEEEEE
T ss_conf             20113221278479983798732258888998768633499836998066166---7889--999986300350038875


Q ss_pred             CCCC
Q ss_conf             2333
Q gi|254780263|r  133 KVDA  136 (392)
Q Consensus       133 KmD~  136 (392)
                      |||-
T Consensus       269 KLDG  272 (453)
T TIGR01425       269 KLDG  272 (453)
T ss_pred             CCCC
T ss_conf             1567


No 278
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily.  Rnd2/Rho7 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd3/RhoE/Rho8.  Rnd2/Rho7 is transiently expressed in radially migrating cells in the brain while they are within the subventricular zone of the hippocampus and cerebral cortex.  These migrating cells typically develop into pyramidal neurons.  Cells that exogenously expressed Rnd2/Rho7 failed to migrate to upper layers of the brain, suggesting that Rnd2/Rho7 plays a role in the radial migration and morphological changes of developing pyramidal neurons, and that Rnd2/Rho7 degradation is necessary for proper cellular migration.  The Rnd2/Rho7 GEF Rapostlin is found primarily in the brain and together with Rnd2/Rho7 induces dendrite branching.  Unlike Rnd1/Rho6 and Rnd3/RhoE/Rho8, which are RhoA antagonists, Rnd2/Rho7 binds the GEF Pragmin and significantly stimulates RhoA activity and Rho-A mediated cell contraction.  Rnd2/Rho7 is also found to be expressed in sperma
Probab=98.12  E-value=1.5e-05  Score=53.44  Aligned_cols=143  Identities=17%  Similarity=0.165  Sum_probs=80.7

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-EEECCC--EEEEEEECCCCHHHHHHHH
Q ss_conf             7999990468988789999998764442001312686869862920637899-982199--0899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-SYETDK--RFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~~~~~~--~~i~iiD~PGH~~f~~~mi   89 (392)
                      ..++++|.-.-|||+|+-++...            ..+++-  --||-..|. .++.++  ..+.|-||.|.++|-.-.-
T Consensus         2 ~KiVlvGD~~VGKTsLl~~f~~~------------~F~~~y--~pTi~~~~~~~~~vd~~~v~L~iWDTAGqE~y~~lr~   67 (222)
T cd04173           2 CKIVVVGDAECGKTALLQVFAKD------------AYPGSY--VPTVFENYTASFEIDKRRIELNMWDTSGSSYYDNVRP   67 (222)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCC------------CCCCCC--CCCEEEEEEEEEEECCEEEEEEEECCCCCCHHHHHHH
T ss_conf             09999898998989999999639------------999984--7845877899999999999999976888503455678


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHH----H-HHHH--CCCCCEEEEECCCCCCCCHHH-HHHCCC--------CCCEE
Q ss_conf             774002331452012344332106778----8-8863--187602331002333561222-110123--------21001
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHI----L-LARQ--IGISSIVVYMNKVDAVDDDEL-LDISEY--------EIRDL  153 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~----~-l~~~--lgi~~iIv~iNKmD~v~~~~~-~~~i~~--------~i~~~  153 (392)
                      .--..+|++|||.|-+.-   +|-+++    . .++.  -.+| +|++=||.|+-++... -++.+.        |-..+
T Consensus        68 ~yyr~a~~~llvfdit~~---~SF~~v~~~W~~ei~~~~p~~p-iiLVGnK~DLR~d~~~~~el~~~~~~pVt~eeg~~l  143 (222)
T cd04173          68 LAYPDSDAVLICFDISRP---ETLDSVLKKWQGETQEFCPNAK-VVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGTVL  143 (222)
T ss_pred             HHCCCCCEEEEEEECCCH---HHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             750369899999838977---8899999999999998589997-899958742456878899998557888789999999


Q ss_pred             EEEEEEEEEEECCCCEEEEEEEC
Q ss_conf             11014532210233114676411
Q gi|254780263|r  154 LKEHKYSDDTPIIRGSALCALQG  176 (392)
Q Consensus       154 l~~~~~~~~~pii~~sa~~g~~~  176 (392)
                      -++.+   -.+++.+||.++.++
T Consensus       144 A~~~g---a~~y~EcSAk~~~n~  163 (222)
T cd04173         144 AKQVG---AVSYVECSSRSSERS  163 (222)
T ss_pred             HHHCC---CCEEEECCCCCCCCC
T ss_conf             99769---988998884868749


No 279
>pfam00448 SRP54 SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins.
Probab=98.11  E-value=4.4e-05  Score=50.58  Aligned_cols=123  Identities=20%  Similarity=0.313  Sum_probs=70.8

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCC--CCCC---HHHH------HCCCEEEEEEE-------------EE
Q ss_conf             82799999046898878999999876444200131--2686---8698------62920637899-------------98
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGD--IDSA---PEEK------LRGITIATAHV-------------SY   66 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~--~D~~---~~E~------~rGiTi~~~~~-------------~~   66 (392)
                      |++ |+++|--..||||.+..|-..+.++++.-+-  +|+.   ..|+      .-|+..-....             .+
T Consensus         1 P~v-i~lvGptGvGKTTTiaKLAa~~~~~~~~V~lit~Dt~R~gA~eQL~~ya~~l~v~~~~~~~~~d~~~~~~~~l~~~   79 (196)
T pfam00448         1 PNV-ILLVGLQGSGKTTTIAKLAAYLKKQGKKVLLVAADTFRAAAIEQLKQLAERLGVPVFGSGTGSDPAAVAFDAVEKA   79 (196)
T ss_pred             CEE-EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHH
T ss_conf             969-9998999998899999999999977992899975877688999999999863981781487778789999999998


Q ss_pred             ECCCEEEEEEECCC--CHH--HHHHH--HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             21990899984787--302--46779--8774002331452012344332106778888631876023310023335
Q gi|254780263|r   67 ETDKRFYSHIDCPG--HAD--YVKNM--ITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAV  137 (392)
Q Consensus        67 ~~~~~~i~iiD~PG--H~~--f~~~m--i~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v  137 (392)
                      ..+++.+-||||||  |.|  .+.+|  +......+-.+||+||..|.... .+....-+.+++..+|  ++|+|..
T Consensus        80 ~~~~~D~IlIDTaGr~~~d~~~~~el~~~~~~~~~~~~~LVl~a~~~~~~~-~~~~~f~~~~~~~~~I--~TKlDet  153 (196)
T pfam00448        80 KAENYDVVLVDTAGRLQNDKNLMDELKKIKRVIAPDEVLLVLDATTGQNAL-NQAKAFNEAVGITGVI--LTKLDGD  153 (196)
T ss_pred             HHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHH-HHHHHHHHHCCCCCEE--EEEECCC
T ss_conf             846899999989998747677899999998522873028998567782137-8999876004776268--8840578


No 280
>PRK05306 infB translation initiation factor IF-2; Validated
Probab=98.10  E-value=2.2e-05  Score=52.45  Aligned_cols=82  Identities=17%  Similarity=0.317  Sum_probs=71.4

Q ss_pred             CEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECH
Q ss_conf             00000001355445430148742453489679995068743212541210012114432100136664112454322021
Q gi|254780263|r  209 LMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRG  288 (392)
Q Consensus       209 r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rG  288 (392)
                      +.-|..+|+++..|+|+.-+|..|.++.+..+.++-.+.--...++.||..|...|.++..|.-||+.|.|  ..|+..|
T Consensus       748 ~a~v~~~f~~~k~g~iagc~v~~g~i~~~~~~r~~r~~~~~~~g~~~sl~~~k~~v~ev~~g~ecgi~~~~--~~~~~~g  825 (839)
T PRK05306        748 QAEVREVFKVSKVGTIAGCMVTEGKVKRNAKVRVLRDGVVIYEGELESLKRFKDDVKEVRAGYECGIGLEN--YNDIKEG  825 (839)
T ss_pred             EEEEEEEEECCCCCEEEEEEEEECEEECCCCEEEEECCEEEEEEEEHHHHHHHHCCCHHCCCCCCEEEECC--CCCCCCC
T ss_conf             99974579758873688899871889649927998799899962636641102031232389425267337--3577669


Q ss_pred             HEEE
Q ss_conf             1773
Q gi|254780263|r  289 RVVC  292 (392)
Q Consensus       289 dvl~  292 (392)
                      |+|-
T Consensus       826 d~ie  829 (839)
T PRK05306        826 DIIE  829 (839)
T ss_pred             CEEE
T ss_conf             8899


No 281
>KOG2486 consensus
Probab=98.09  E-value=5.4e-05  Score=50.04  Aligned_cols=149  Identities=19%  Similarity=0.207  Sum_probs=95.7

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHH-HCCCEEEEEEEEEECCCEEEEEEECCCC----------
Q ss_conf             79999904689887899999987644420013126868698-6292063789998219908999847873----------
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEK-LRGITIATAHVSYETDKRFYSHIDCPGH----------   81 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~-~rGiTi~~~~~~~~~~~~~i~iiD~PGH----------   81 (392)
                      ..+++.|.-.-|||+|+.-+++.....       |   .++ ..|.|..+-+   ..-+.++.++|.||.          
T Consensus       137 pe~~~~g~SNVGKSSLln~~~r~k~~~-------~---t~k~K~g~Tq~in~---f~v~~~~~~vDlPG~~~a~y~~~~~  203 (320)
T KOG2486         137 PELAFYGRSNVGKSSLLNDLVRVKNIA-------D---TSKSKNGKTQAINH---FHVGKSWYEVDLPGYGRAGYGFELP  203 (320)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHH-------H---HCCCCCCCCEEEEE---EECCCEEEEEECCCCCCCCCCCCCC
T ss_conf             526662477622788876543214556-------4---03788765113200---1205548998468865456785574


Q ss_pred             H---HHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHH-HHCCCCCCE---EE
Q ss_conf             0---2467798774002331452012344332106778888631876023310023335612221-101232100---11
Q gi|254780263|r   82 A---DYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELL-DISEYEIRD---LL  154 (392)
Q Consensus        82 ~---~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~-~~i~~~i~~---~l  154 (392)
                      +   +|++....--.+.=.+.|+|||+.++++---+.+..+...+|| +.++.||||....-.++ ......++.   .+
T Consensus       204 ~d~~~~t~~Y~leR~nLv~~FLLvd~sv~i~~~D~~~i~~~ge~~VP-~t~vfTK~DK~k~~~~~~kKp~~~i~~~f~~l  282 (320)
T KOG2486         204 ADWDKFTKSYLLERENLVRVFLLVDASVPIQPTDNPEIAWLGENNVP-MTSVFTKCDKQKKVKRTGKKPGLNIKINFQGL  282 (320)
T ss_pred             CHHHHHHHHHHHHHHHHHEEEEEEECCCCCCCCCHHHHHHHHHCCCC-EEEEEEHHHHHHHCCCCCCCCCCCCEEEHHHC
T ss_conf             14767578888726533115666303678899876999887524997-38863024455530223557540012102001


Q ss_pred             EEEEEEEEEECCCCEEEEEEE
Q ss_conf             101453221023311467641
Q gi|254780263|r  155 KEHKYSDDTPIIRGSALCALQ  175 (392)
Q Consensus       155 ~~~~~~~~~pii~~sa~~g~~  175 (392)
                      .+.-+....|.|..|+.+.+.
T Consensus       283 ~~~~f~~~~Pw~~~Ssvt~~G  303 (320)
T KOG2486         283 IRGVFLVDLPWIYVSSVTSLG  303 (320)
T ss_pred             CCCCEECCCCCEEEECCCCCC
T ss_conf             500041158701320434257


No 282
>cd01849 YlqF_related_GTPase YlqF-related GTPases.  These proteins are found in bacteria, eukaryotes, and archaea.  They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.
Probab=98.09  E-value=5.1e-06  Score=56.39  Aligned_cols=46  Identities=17%  Similarity=0.133  Sum_probs=35.1

Q ss_pred             CCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHH
Q ss_conf             3314520123443321067788886318760233100233356122
Q gi|254780263|r   96 DGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDE  141 (392)
Q Consensus        96 D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~  141 (392)
                      |..+.|+||+.|....-.+-..+++..+-+++|+++||+|+++.+.
T Consensus         1 D~il~VvDaR~pl~~~~~~~~~~l~~~~~K~~ilvlNK~Dl~~~~~   46 (155)
T cd01849           1 DVILEVLDARDPLGTRSPDIERVLIKEKGKKLILVLNKADLVPKEV   46 (155)
T ss_pred             CEEEEEEECCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCHHH
T ss_conf             9899999687999988999999998658994899976734589899


No 283
>pfam00735 Septin Septin. Members of this family include CDC3, CDC10, CDC11 and CDC12/Septin. Members of this family bind GTP. As regards the septins, these are polypeptides of 30-65kDa with three characteristic GTPase motifs (G-1, G-3 and G-4) that are similar to those of the Ras family. The G-4 motif is strictly conserved with a unique septin consensus of AKAD. Most septins are thought to have at least one coiled-coil region, which in some cases is necessary for intermolecular interactions that allow septins to polymerize to form rod-shaped complexes. In turn, these are arranged into tandem arrays to form filaments. They are multifunctional proteins, with roles in cytokinesis, sporulation, germ cell development, exocytosis and apoptosis.
Probab=98.08  E-value=3.1e-05  Score=51.50  Aligned_cols=140  Identities=23%  Similarity=0.322  Sum_probs=80.9

Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCC--EEEEEEECCCCHHHHHH--
Q ss_conf             27999990468988789999998764442001312686869862920637899982199--08999847873024677--
Q gi|254780263|r   12 SLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK--RFYSHIDCPGHADYVKN--   87 (392)
Q Consensus        12 ~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~--~~i~iiD~PGH~~f~~~--   87 (392)
                      .+||.++|--+.||||++..|.+..-....  . .....+...+...|.......+-++  .++|++||||-.|.+-|  
T Consensus         4 ~fnimvvG~sGlGKTTfiNtL~~~~~~~~~--~-~~~~~~~~~~t~~i~~~~~~iee~g~~l~LtiiDTpGfGd~i~n~~   80 (280)
T pfam00735         4 DFTLMVVGESGLGKTTLINTLFLTDLYPER--G-IPGPSEKIKKTVEIKATTVEIEEDGVKLNLTVIDTPGFGDAIDNSN   80 (280)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCCCCCCC--C-CCCCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCHHH
T ss_conf             789999779999789999998578577866--7-8884335567753488999998899899999998998423345166


Q ss_pred             ----------------------HHHHH---HCCCCEEEEECCC-CCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHH
Q ss_conf             ----------------------98774---0023314520123-443321067788886318760233100233356122
Q gi|254780263|r   88 ----------------------MITGA---TQADGAILVCAAE-DGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDE  141 (392)
Q Consensus        88 ----------------------mi~g~---~~~D~ailvVda~-~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~  141 (392)
                                            +.|.-   +..+++|..++.+ .|..+.-.+.+.-+... + ++|-+|-|.|...++|
T Consensus        81 ~~~~I~~yI~~qf~~yl~eE~~i~R~~~~D~RVH~cLYFI~Ptgh~L~~lDi~~mk~Ls~~-v-NvIPVIaKADtLT~~E  158 (280)
T pfam00735        81 CWKPIVEYIDEQFEQYLRDESRLNRTSIVDNRVHCCLYFISPTGHGLKPLDVEFMKKLHEK-V-NIIPVIAKADTLTPDE  158 (280)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHCC-C-CEEEEEECCCCCCHHH
T ss_conf             6999999999999999998647566777888437999975688888868899999987144-6-5366662145589999


Q ss_pred             HHHHCCCCCCEEEEEE
Q ss_conf             2110123210011101
Q gi|254780263|r  142 LLDISEYEIRDLLKEH  157 (392)
Q Consensus       142 ~~~~i~~~i~~~l~~~  157 (392)
                      +.. .+..+.+-|...
T Consensus       159 l~~-~K~~I~~~l~~~  173 (280)
T pfam00735       159 LQR-FKKRIRAEIERQ  173 (280)
T ss_pred             HHH-HHHHHHHHHHHC
T ss_conf             999-999999999985


No 284
>cd04103 Centaurin_gamma Centaurin gamma.  The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains.  Centaurin gamma contains an additional GTPase domain near its N-terminus.  The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism.  Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP.  Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments.  A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues. 
Probab=98.07  E-value=7.7e-06  Score=55.29  Aligned_cols=140  Identities=18%  Similarity=0.200  Sum_probs=76.8

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHH-HHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHH
Q ss_conf             79999904689887899999987-64442001312686869862920637899982199089998478730246779877
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKY-YSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITG   91 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~-~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g   91 (392)
                      +.|+++|...-|||+|+-+.... +....      +  +    .+-. .......+.+.+.+.|.||.|...+-     -
T Consensus         1 ~KivllGd~~VGKTsl~~Rf~~~~F~~~~------~--p----t~~~-~~~~~~vdg~~~~l~i~DTaG~~~~~-----~   62 (158)
T cd04103           1 LKLGIVGNLQSGKSALVHRYLTGSYVQLE------S--P----EGGR-FKKEVLVDGQSHLLLIRDEGGAPDAQ-----F   62 (158)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCCCCC------C--C----CCCE-EEEEEEECCEEEEEEEEECCCCCCHH-----H
T ss_conf             99999996998799999999809478744------4--6----6441-79999999999999999589983433-----3


Q ss_pred             HHCCCCEEEEECCCCC-CCCCHHHHHH-HHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             4002331452012344-3321067788-8863---187602331002333561222110123210011101453221023
Q gi|254780263|r   92 ATQADGAILVCAAEDG-PKPQTREHIL-LARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        92 ~~~~D~ailvVda~~G-~~~QT~eh~~-l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
                      .+.+|+++||-|.+.= -+..-++-+. +.+.   -.+| +|++=||-|+-..+.|. ...++.+++..+.   .+.+++
T Consensus        63 ~~~ada~ilVydit~~~SF~~v~~~~~~i~~~~~~~~ip-iilvGnK~dl~~~~~r~-V~~~e~~~~a~~~---~~~~f~  137 (158)
T cd04103          63 ASWVDAVIFVFSLENEASFQTVYNLYHQLSSYRNISEIP-LILVGTQDAISESNPRV-IDDARARQLCADM---KRCSYY  137 (158)
T ss_pred             HCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCC-EEEEEECCCCCCCCCEE-CCHHHHHHHHHHC---CCCEEE
T ss_conf             214998999998898889999999999999855978996-89998770036577614-7999999999856---998899


Q ss_pred             CCEEEEEEE
Q ss_conf             311467641
Q gi|254780263|r  167 RGSALCALQ  175 (392)
Q Consensus       167 ~~sa~~g~~  175 (392)
                      .+||.++.+
T Consensus       138 EtSAk~~~N  146 (158)
T cd04103         138 ETCATYGLN  146 (158)
T ss_pred             EEECCCCCC
T ss_conf             901799959


No 285
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]
Probab=98.07  E-value=5.6e-06  Score=56.14  Aligned_cols=137  Identities=26%  Similarity=0.364  Sum_probs=83.5

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC----CHHHHHHHH
Q ss_conf             9999904689887899999987644420013126868698629206378999821990899984787----302467798
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG----HADYVKNMI   89 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG----H~~f~~~mi   89 (392)
                      +++++|.+.+|||||+..|-+....-                -.|.     ..+|+++  -.|||||    |+.+-...+
T Consensus         3 ri~~vG~~gcGKTtL~q~L~G~~~ly----------------kKTQ-----Ave~~d~--~~IDTPGEy~~~~~~Y~aL~   59 (148)
T COG4917           3 RIAFVGQVGCGKTTLFQSLYGNDTLY----------------KKTQ-----AVEFNDK--GDIDTPGEYFEHPRWYHALI   59 (148)
T ss_pred             EEEEECCCCCCCHHHHHHHHCCHHHH----------------CCCC-----EEECCCC--CCCCCCHHHHHHHHHHHHHH
T ss_conf             06875145657316788861603321----------------0000-----1330475--56588066652467899998


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCE
Q ss_conf             77400233145201234433210677888863187602331002333561222110123210011101453221023311
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGS  169 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~s  169 (392)
                      .-+.-+|.-++|-+|.++..+-.   ...+ ..+.++.|=+|+|.|+.. ++..+.    .+.+|.+.|.   -|++.+|
T Consensus        60 tt~~dadvi~~v~~and~~s~f~---p~f~-~~~~k~vIgvVTK~DLae-d~dI~~----~~~~L~eaGa---~~iF~~s  127 (148)
T COG4917          60 TTLQDADVIIYVHAANDPESRFP---PGFL-DIGVKKVIGVVTKADLAE-DADISL----VKRWLREAGA---EPIFETS  127 (148)
T ss_pred             HHHHCCCEEEEEECCCCCCCCCC---CCCC-CCCCCCEEEEEECCCCCC-HHHHHH----HHHHHHHCCC---CCEEEEE
T ss_conf             87611332554300268444488---4213-446665589986034664-676899----9999997487---5268872


Q ss_pred             EEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             46764114445652123320344310
Q gi|254780263|r  170 ALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       170 a~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
                      +..          ..++..|++.|.+
T Consensus       128 ~~d----------~~gv~~l~~~L~~  143 (148)
T COG4917         128 AVD----------NQGVEELVDYLAS  143 (148)
T ss_pred             CCC----------CCCHHHHHHHHHH
T ss_conf             558----------3119999999974


No 286
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=98.06  E-value=3.6e-05  Score=51.14  Aligned_cols=120  Identities=20%  Similarity=0.285  Sum_probs=68.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHCCCC--CCCC---HHHHH------CCCEEEEEEEE-------------EECCC
Q ss_conf             9999046898878999999876444200131--2686---86986------29206378999-------------82199
Q gi|254780263|r   15 LSTIGHVDHGKTTLTAAITKYYSEEKKEYGD--IDSA---PEEKL------RGITIATAHVS-------------YETDK   70 (392)
Q Consensus        15 i~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~--~D~~---~~E~~------rGiTi~~~~~~-------------~~~~~   70 (392)
                      |+++|--.+||||.+..|-..+..++..-+-  +|+.   ..||-      -|+.+-.....             +..++
T Consensus         3 i~lvGptGvGKTTTiaKLA~~~~~~~~kV~lit~Dt~R~gA~eQL~~~a~~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (173)
T cd03115           3 ILLVGLQGVGKTTTAAKLALYLKKKGKKVLLVAADTYRPAAIEQLRVLGEQVGVPVFEEGEGKDPVSIAKRAIEHAREEN   82 (173)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             99989999988999999999999769928999748875779999999999749859922775587999999999987568


Q ss_pred             EEEEEEECCC--CHHH--HHHHH--HHHHCCCCEEEEECCCCCCCCCHHHHHHH-HHHCCCCCEEEEECCCCCCC
Q ss_conf             0899984787--3024--67798--77400233145201234433210677888-86318760233100233356
Q gi|254780263|r   71 RFYSHIDCPG--HADY--VKNMI--TGATQADGAILVCAAEDGPKPQTREHILL-ARQIGISSIVVYMNKVDAVD  138 (392)
Q Consensus        71 ~~i~iiD~PG--H~~f--~~~mi--~g~~~~D~ailvVda~~G~~~QT~eh~~l-~~~lgi~~iIv~iNKmD~v~  138 (392)
                      +-+-||||||  |.|.  +.++.  ..+..+|-.+||+||..|-.  ..+.+.. -..+++..+|  ++|+|...
T Consensus        83 ~D~IlIDTaGr~~~d~~~~~el~~l~~~~~p~~~~LVl~a~~~~~--~~~~~~~f~~~~~~~~~I--~TKlDet~  153 (173)
T cd03115          83 FDVVIVDTAGRLQIDENLMEELKKIKRVVKPDEVLLVVDAMTGQD--AVNQAKAFNEALGITGVI--LTKLDGDA  153 (173)
T ss_pred             CCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCEEECCCCCHHH--HHHHHHHHHHCCCCCEEE--EEEECCCC
T ss_conf             998999788878799999999999986448972157424655065--899999987427997899--97143899


No 287
>cd01859 MJ1464 MJ1464.  This family represents archaeal GTPase typified by the protein MJ1464 from Methanococcus jannaschii. The members of this family show a circular permutation of the GTPase signature motifs so that C-terminal strands 5, 6, and 7 (strands 6 contain the NKxD motif) are relocated to the N terminus.
Probab=98.04  E-value=6.6e-06  Score=55.68  Aligned_cols=92  Identities=17%  Similarity=0.225  Sum_probs=57.2

Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             79877400233145201234433210677888863187602331002333561222110123210011101453221023
Q gi|254780263|r   87 NMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        87 ~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
                      .+-..+..+|..+.|+||+.+..+.-.+-...++..+- ++++++||+|+++.+.. +    +...++...    ..+.+
T Consensus         5 ~i~~~i~~~D~il~VvDar~p~~~~~~~l~~~l~~~~K-~~ilvlNK~Dl~~~~~~-~----~~~~~~~~~----g~~~i   74 (156)
T cd01859           5 LVRRIIKESDVVLEVLDARDPELTRSRKLERYVLELGK-KLLIVLNKADLVPKEVL-E----KWKSIKESE----GIPVV   74 (156)
T ss_pred             HHHHHHHHCCEEEEEEECCCCCCCCCHHHHHHHHHCCC-CEEEEEECCCCCCHHHH-H----HHHHHHHCC----CCCEE
T ss_conf             99999987999999998788999869899999975699-39999775555898999-9----999998289----99737


Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHCCCC
Q ss_conf             31146764114445652123320344310252
Q gi|254780263|r  167 RGSALCALQGTNKELGEDSIHALMKAVDTHIP  198 (392)
Q Consensus       167 ~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~  198 (392)
                      .+|+..+.          ....|.+.+....+
T Consensus        75 ~iSa~~~~----------g~~~L~~~i~~~~~   96 (156)
T cd01859          75 YVSAKERL----------GTKILRRTIKELAK   96 (156)
T ss_pred             EEECCCCC----------CHHHHHHHHHHHHC
T ss_conf             87012675----------79999999998602


No 288
>PRK09435 arginine/ornithine transport system ATPase; Provisional
Probab=98.04  E-value=1.7e-05  Score=53.10  Aligned_cols=170  Identities=18%  Similarity=0.146  Sum_probs=90.2

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCC---------------CCCHHH---HHCCCEEEEEEE--------
Q ss_conf             827999990468988789999998764442001312---------------686869---862920637899--------
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDI---------------DSAPEE---KLRGITIATAHV--------   64 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~---------------D~~~~E---~~rGiTi~~~~~--------   64 (392)
                      ....|++-|-..+|||||+++|...+...+..-+.+               |+...+   ..-++=|-+..+        
T Consensus        48 ~a~~iGiTG~pG~GKStli~~l~~~~~~~g~~v~vlavDPsS~~sgGaiLGDr~Rm~~~~~~~~~fiRs~~srg~lgg~~  127 (325)
T PRK09435         48 NALRIGITGVPGVGKSTFIEALGMHLIEQGHKVAVLAVDPSSTRTGGSILGDKTRMERLSRHPNAFIRPSPSSGTLGGVA  127 (325)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCC
T ss_conf             82599742799986889999999999967985899997899998886101038888761479984884067788867733


Q ss_pred             --------EEECCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCC
Q ss_conf             --------982199089998478730246779877400233145201234433210677888863187602331002333
Q gi|254780263|r   65 --------SYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDA  136 (392)
Q Consensus        65 --------~~~~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~  136 (392)
                              -++--++-+.||.|-|--.   +=+.-+..+|..++|.....|-.-|.    ..+-.+-+.-++ +|||.|.
T Consensus       128 ~~~~~~~~~~~a~g~d~i~iETvGvGQ---~e~~v~~~~d~~~~~~~p~~GD~~Q~----~K~GImEiaDi~-vVNKaDg  199 (325)
T PRK09435        128 RKTRETMLLCEAAGFDVILVETVGVGQ---SETAVAGMVDFFLLLQLPGAGDELQG----IKKGIMELADLI-VINKADG  199 (325)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCH---HHHHHHHHCCEEEEEECCCCCCHHHH----HHHHHHHHCCEE-EEECCCC
T ss_conf             549999999997799989997067771---48899874266888835887608899----886577504268-9977675


Q ss_pred             CCCHHHHHHCCCCCCEEEEEEEEE---EEEECCCCEEEEEEECCCCCCCCCCCCCHHHH
Q ss_conf             561222110123210011101453---22102331146764114445652123320344
Q gi|254780263|r  137 VDDDELLDISEYEIRDLLKEHKYS---DDTPIIRGSALCALQGTNKELGEDSIHALMKA  192 (392)
Q Consensus       137 v~~~~~~~~i~~~i~~~l~~~~~~---~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~  192 (392)
                      -.-+. .+....+++..|.-....   -..|++.+||..   +......|+.+..+.+.
T Consensus       200 d~~~~-A~~t~~e~~~aL~l~~~~~~~W~ppVl~~SA~~---g~GI~eL~~~I~~h~~~  254 (325)
T PRK09435        200 DNHTA-ARRAAAEYRSALRLLRPKDPGWQPPVLTCSALE---GEGIDELWQAIEDHRAA  254 (325)
T ss_pred             CCHHH-HHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECC---CCCHHHHHHHHHHHHHH
T ss_conf             56589-999999999998607887899999989998158---99879999999999999


No 289
>cd01850 CDC_Septin CDC/Septin.  Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells.  They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis.  In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments.  Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.
Probab=98.03  E-value=4.8e-05  Score=50.36  Aligned_cols=140  Identities=19%  Similarity=0.288  Sum_probs=80.1

Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCC--EEEEEEECCCCHHHHHH--
Q ss_conf             27999990468988789999998764442001312686869862920637899982199--08999847873024677--
Q gi|254780263|r   12 SLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK--RFYSHIDCPGHADYVKN--   87 (392)
Q Consensus        12 ~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~--~~i~iiD~PGH~~f~~~--   87 (392)
                      .+|+.++|.-..||||++..|....--...  ...+.......+...|.......+-++  -++|+|||||-.|++-|  
T Consensus         4 ~fnimVvG~sGlGKsTfiNtLf~~~~~~~~--~~~~~~~~~~~~t~~i~~~~~~i~e~g~~l~LtviDTpGfGd~i~n~~   81 (276)
T cd01850           4 QFNIMVVGESGLGKSTFINTLFNTKLIPSD--YPPDPAEEHIDKTVEIKSSKAEIEENGVKLKLTVIDTPGFGDNINNSD   81 (276)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCCCCCCC--CCCCCHHHCCCCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCCHHH
T ss_conf             799999768999889999997478577877--778813205688825899999996399899999997688412236034


Q ss_pred             -------------------H---HHHHH----CCCCEEEEECCC-CCCCCCHHHHHHHHHHC-CCCCEEEEECCCCCCCC
Q ss_conf             -------------------9---87740----023314520123-44332106778888631-87602331002333561
Q gi|254780263|r   88 -------------------M---ITGAT----QADGAILVCAAE-DGPKPQTREHILLARQI-GISSIVVYMNKVDAVDD  139 (392)
Q Consensus        88 -------------------m---i~g~~----~~D~ailvVda~-~G~~~QT~eh~~l~~~l-gi~~iIv~iNKmD~v~~  139 (392)
                                         =   -|...    -++++|-.++++ .|..+.-.+   ..+.+ +.=++|-+|-|.|...+
T Consensus        82 ~~~~I~~yI~~qf~~yl~eE~~i~R~~~~~D~RVH~cLYFI~Ptgh~L~~lDi~---~mk~Ls~~vNvIPVIaKADtlT~  158 (276)
T cd01850          82 CWKPIVDYIDDQFDQYLREESRIKRNPRIPDTRVHACLYFIEPTGHGLKPLDIE---FMKRLSKRVNIIPVIAKADTLTP  158 (276)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEECCCCCCCCHHHHH---HHHHHCCCCCEEEEEECCCCCCH
T ss_conf             099999999999999999985314578887774489999967888888799999---99996275645667851666999


Q ss_pred             HHHHHHCCCCCCEEEEEE
Q ss_conf             222110123210011101
Q gi|254780263|r  140 DELLDISEYEIRDLLKEH  157 (392)
Q Consensus       140 ~~~~~~i~~~i~~~l~~~  157 (392)
                      +|+.. .+..+.+-|+..
T Consensus       159 ~El~~-~K~~I~~~l~~~  175 (276)
T cd01850         159 EELKE-FKQRIMEDIEEH  175 (276)
T ss_pred             HHHHH-HHHHHHHHHHHC
T ss_conf             99999-999999999985


No 290
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=98.02  E-value=1.2e-05  Score=54.12  Aligned_cols=51  Identities=18%  Similarity=0.097  Sum_probs=39.1

Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCC-CCCEEEEECCCCCCCCH
Q ss_conf             7740023314520123443321067788886318-76023310023335612
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPKPQTREHILLARQIG-ISSIVVYMNKVDAVDDD  140 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lg-i~~iIv~iNKmD~v~~~  140 (392)
                      +.+..+|+.+.|+||+.+....-.+-..+++... -+++++++||+|+++.+
T Consensus         4 ~~i~~aD~vl~V~DaR~p~ss~n~~l~~~lr~~~~~K~~i~VlNK~Dl~~~~   55 (157)
T cd01858           4 KVIDSSDVVIQVLDARDPMGTRCKHVEEYLKKEKPHKHLIFVLNKCDLVPTW   55 (157)
T ss_pred             HHHHHCCEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCEEEEEECCCCCCHH
T ss_conf             9787599999998898888878989999987537999789999894479878


No 291
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]
Probab=98.01  E-value=1.6e-05  Score=53.33  Aligned_cols=167  Identities=19%  Similarity=0.215  Sum_probs=87.9

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCC---------------CCCHHHH---HCCCEEEEEE--------
Q ss_conf             8827999990468988789999998764442001312---------------6868698---6292063789--------
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDI---------------DSAPEEK---LRGITIATAH--------   63 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~---------------D~~~~E~---~rGiTi~~~~--------   63 (392)
                      ++| .|+|-|-..+|||||++.|...+...+..-+.+               |+...++   .-|+=|-+..        
T Consensus        50 ~a~-viGITG~PGaGKSTli~~L~~~l~~~G~rVaVlAVDPSSp~TGGsiLGDRiRM~~~~~~~~vFiRs~~srG~lGGl  128 (323)
T COG1703          50 NAH-VIGITGVPGAGKSTLIEALGRELRERGHRVAVLAVDPSSPFTGGSILGDRIRMQRLAVDPGVFIRSSPSRGTLGGL  128 (323)
T ss_pred             CCC-EEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHHHHHHHCCCCCEEEEECCCCCCCHHH
T ss_conf             983-7873179988668899999999997796789999889999878530120766776446998178426877651016


Q ss_pred             --------EEEECCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             --------998219908999847873024677987740023314520123443321067788886318760233100233
Q gi|254780263|r   64 --------VSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVD  135 (392)
Q Consensus        64 --------~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD  135 (392)
                              .-++--+|-+.||-|-|--.=   =+.-+..+|..++|.-+.-|-.-|..    .+-.|-+--+ ++|||+|
T Consensus       129 S~at~~~i~~ldAaG~DvIIVETVGvGQs---ev~I~~~aDt~~~v~~pg~GD~~Q~i----K~GimEiaDi-~vINKaD  200 (323)
T COG1703         129 SRATREAIKLLDAAGYDVIIVETVGVGQS---EVDIANMADTFLVVMIPGAGDDLQGI----KAGIMEIADI-IVINKAD  200 (323)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCCCC---HHHHHHHCCEEEEEECCCCCCHHHHH----HHHHHHHHHE-EEEECCC
T ss_conf             68899999999861898899981478841---55776521668999657888278888----7414654033-5672567


Q ss_pred             CCCCHHHHHHCCCCCCE---EEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCC
Q ss_conf             35612221101232100---111014532210233114676411444565212332034431025
Q gi|254780263|r  136 AVDDDELLDISEYEIRD---LLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHI  197 (392)
Q Consensus       136 ~v~~~~~~~~i~~~i~~---~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~  197 (392)
                      +-..+..+-.....+..   .-...+|  ..|++.+||..|-          .+.+|.+++.++.
T Consensus       201 ~~~A~~a~r~l~~al~~~~~~~~~~~W--~ppv~~t~A~~g~----------Gi~~L~~ai~~h~  253 (323)
T COG1703         201 RKGAEKAARELRSALDLLREVWRENGW--RPPVVTTSALEGE----------GIDELWDAIEDHR  253 (323)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCC--CCCEEEEEECCCC----------CHHHHHHHHHHHH
T ss_conf             265899999999999751145423688--8864676413577----------8799999999999


No 292
>KOG0780 consensus
Probab=98.01  E-value=3.2e-05  Score=51.46  Aligned_cols=123  Identities=24%  Similarity=0.339  Sum_probs=80.3

Q ss_pred             HHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCC----CCC------CCCHH--HHHCCCEEEEEEEE-------
Q ss_conf             421038827999990468988789999998764442001----312------68686--98629206378999-------
Q gi|254780263|r    5 RYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEY----GDI------DSAPE--EKLRGITIATAHVS-------   65 (392)
Q Consensus         5 ~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~----~~~------D~~~~--E~~rGiTi~~~~~~-------   65 (392)
                      ...+.||++ |.++|--.+||||.+..|..++.+++...    +++      |.++.  +|. ++-+-.+|..       
T Consensus        95 ~~~K~kpsV-imfVGLqG~GKTTtc~KlA~y~kkkG~K~~LvcaDTFRagAfDQLkqnA~k~-~iP~ygsyte~dpv~ia  172 (483)
T KOG0780          95 QPKKGKPSV-IMFVGLQGSGKTTTCTKLAYYYKKKGYKVALVCADTFRAGAFDQLKQNATKA-RVPFYGSYTEADPVKIA  172 (483)
T ss_pred             CCCCCCCCE-EEEEECCCCCCCEEHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHH-CCEEEECCCCCCHHHHH
T ss_conf             615689708-9998305788630089999999846872457760224530689999876740-77068403665558999


Q ss_pred             ------EECCCEEEEEEECCC-C---HHHHHHHHHHH--HCCCCEEEEECCCCCCCCCHHHHHHHHHHC----CCCCEEE
Q ss_conf             ------821990899984787-3---02467798774--002331452012344332106778888631----8760233
Q gi|254780263|r   66 ------YETDKRFYSHIDCPG-H---ADYVKNMITGA--TQADGAILVCAAEDGPKPQTREHILLARQI----GISSIVV  129 (392)
Q Consensus        66 ------~~~~~~~i~iiD~PG-H---~~f~~~mi~g~--~~~D~ailvVda~~G~~~QT~eh~~l~~~l----gi~~iIv  129 (392)
                            |..+++-+.|+||-| |   +...-+|+.-.  -.+|-.|+|+||.-|   |.-|  ..++++    +|--  |
T Consensus       173 ~egv~~fKke~fdvIIvDTSGRh~qe~sLfeEM~~v~~ai~Pd~vi~VmDasiG---Qaae--~Qa~aFk~~vdvg~--v  245 (483)
T KOG0780         173 SEGVDRFKKENFDVIIVDTSGRHKQEASLFEEMKQVSKAIKPDEIIFVMDASIG---QAAE--AQARAFKETVDVGA--V  245 (483)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC---HHHH--HHHHHHHHHHCCCE--E
T ss_conf             999998886397289982787301248999999999851598738999856200---7679--99998877615403--7


Q ss_pred             EECCCCC
Q ss_conf             1002333
Q gi|254780263|r  130 YMNKVDA  136 (392)
Q Consensus       130 ~iNKmD~  136 (392)
                      .+||||-
T Consensus       246 IlTKlDG  252 (483)
T KOG0780         246 ILTKLDG  252 (483)
T ss_pred             EEEECCC
T ss_conf             9972256


No 293
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1).  This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria.  The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2.  AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family.  The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections.  The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins).
Probab=98.00  E-value=2e-05  Score=52.70  Aligned_cols=164  Identities=20%  Similarity=0.246  Sum_probs=92.9

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCH-------HHH
Q ss_conf             7999990468988789999998764442001312686869862920637899982199089998478730-------246
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHA-------DYV   85 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~-------~f~   85 (392)
                      |||+.+|-..+|||+....|++...-...          ......|-......-++.++++++|||||--       +..
T Consensus         1 LrIvLlGktGsGKSstgNtILG~~~F~s~----------~~~~svT~~c~~~~~~~~gr~v~VIDTPg~~dt~~~~~~~~   70 (196)
T cd01852           1 LRLVLVGKTGAGKSATGNTILGREVFESK----------LSASSVTKTCQKESAVWDGRRVNVIDTPGLFDTSVSPEQLS   70 (196)
T ss_pred             CEEEEECCCCCCCHHHHEEECCCCCCCCC----------CCCCCCCEEEEEEEEEECCCEEEEEECCCCCCCCCCHHHHH
T ss_conf             98999789998615340325687666788----------99998755888888998893799996776356558979999


Q ss_pred             HHHHHHHH----CCCCEEEEECCCCCCCCCH-HHHH-HHHHHCC---CCCEEEEECCCCCCCCHH---HHHHCCCCCCEE
Q ss_conf             77987740----0233145201234433210-6778-8886318---760233100233356122---211012321001
Q gi|254780263|r   86 KNMITGAT----QADGAILVCAAEDGPKPQT-REHI-LLARQIG---ISSIVVYMNKVDAVDDDE---LLDISEYEIRDL  153 (392)
Q Consensus        86 ~~mi~g~~----~~D~ailvVda~~G~~~QT-~eh~-~l~~~lg---i~~iIv~iNKmD~v~~~~---~~~~i~~~i~~~  153 (392)
                      +++.+.++    .+++.|||+....  +.+. ++-+ .+.+.+|   .++.||..|--|......   ........++.+
T Consensus        71 ~ei~~~~~l~~pGpHa~LLVi~~~r--fT~ee~~~v~~i~~~FGe~~~~~tivLFT~~D~L~~~sie~~i~~~~~~L~~l  148 (196)
T cd01852          71 KEIVRCLSLSAPGPHAFLLVVPLGR--FTEEEEQAVETLQELFGEKVLDHTIVLFTRGDDLEGGTLEDYLENSCEALKRL  148 (196)
T ss_pred             HHHHHHHHHCCCCCEEEEEEEECCC--CCHHHHHHHHHHHHHHCHHHHHHEEEEEECCCCCCCCCHHHHHHHCCHHHHHH
T ss_conf             9999999843899739999997898--89899999999999977786852899996540116886999987346999999


Q ss_pred             EEEEEEEEEEECCCCEEEEEEECC-CCCCCCCCCCCHHHHHHCCCC
Q ss_conf             110145322102331146764114-445652123320344310252
Q gi|254780263|r  154 LKEHKYSDDTPIIRGSALCALQGT-NKELGEDSIHALMKAVDTHIP  198 (392)
Q Consensus       154 l~~~~~~~~~pii~~sa~~g~~~~-n~~~~~~~~~~Ll~~i~~~~~  198 (392)
                      +++.+-.          ...++.. +..........||+.+++.+.
T Consensus       149 i~kCg~R----------y~~fnN~~~~~~~~~QV~eLl~kIe~mv~  184 (196)
T cd01852         149 LEKCGGR----------YVAFNNKAKGEEQEQQVKELLAKVESMVK  184 (196)
T ss_pred             HHHHCCE----------EEEEECCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             9985998----------99986789975138999999999999999


No 294
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=97.99  E-value=7.1e-05  Score=49.29  Aligned_cols=122  Identities=21%  Similarity=0.304  Sum_probs=74.5

Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCC--CCCC---HHHHHCCCE--EEEEE-----------------E
Q ss_conf             3882799999046898878999999876444200131--2686---869862920--63789-----------------9
Q gi|254780263|r    9 NKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGD--IDSA---PEEKLRGIT--IATAH-----------------V   64 (392)
Q Consensus         9 ~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~--~D~~---~~E~~rGiT--i~~~~-----------------~   64 (392)
                      .++...|-.+|==.+||||.++.|..++.+.+..-.-  .|..   .-|+-+-..  +++-+                 .
T Consensus        97 ~~~P~vImmvGLQGsGKTTt~~KLA~~lkk~~~kvllVaaD~~RpAA~eQL~~La~q~~v~~f~~~~~~~Pv~Iak~al~  176 (451)
T COG0541          97 KKPPTVILMVGLQGSGKTTTAGKLAKYLKKKGKKVLLVAADTYRPAAIEQLKQLAEQVGVPFFGSGTEKDPVEIAKAALE  176 (451)
T ss_pred             CCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCHHHHHHHHHH
T ss_conf             89985899981567974868999999999749945898505678689999999998609853167788997999999999


Q ss_pred             EEECCCEEEEEEECCCC----HHHHHHH--HHHHHCCCCEEEEECCCCCCCCCHHHHHHHH----HHCCCCCEEEEECCC
Q ss_conf             98219908999847873----0246779--8774002331452012344332106778888----631876023310023
Q gi|254780263|r   65 SYETDKRFYSHIDCPGH----ADYVKNM--ITGATQADGAILVCAAEDGPKPQTREHILLA----RQIGISSIVVYMNKV  134 (392)
Q Consensus        65 ~~~~~~~~i~iiD~PGH----~~f~~~m--i~g~~~~D~ailvVda~~G~~~QT~eh~~l~----~~lgi~~iIv~iNKm  134 (392)
                      ++..+++-+-|+||.|-    ++.+.+|  |..+..+|-.||||||..|-.   -  ...|    ..+++. -+| ++||
T Consensus       177 ~ak~~~~DvvIvDTAGRl~ide~Lm~El~~Ik~~~~P~E~llVvDam~GQd---A--~~~A~aF~e~l~it-GvI-lTKl  249 (451)
T COG0541         177 KAKEEGYDVVIVDTAGRLHIDEELMDELKEIKEVINPDETLLVVDAMIGQD---A--VNTAKAFNEALGIT-GVI-LTKL  249 (451)
T ss_pred             HHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCHH---H--HHHHHHHHHHCCCC-EEE-EECC
T ss_conf             999749988999688733030999999999985539874899876444567---8--99999986626986-499-9714


Q ss_pred             CCC
Q ss_conf             335
Q gi|254780263|r  135 DAV  137 (392)
Q Consensus       135 D~v  137 (392)
                      |.-
T Consensus       250 DGd  252 (451)
T COG0541         250 DGD  252 (451)
T ss_pred             CCC
T ss_conf             678


No 295
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]
Probab=97.97  E-value=9.4e-06  Score=54.73  Aligned_cols=154  Identities=17%  Similarity=0.210  Sum_probs=80.8

Q ss_pred             HHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCC----CCC-CHHHHHC---CC---EEEEEEEE-----E-
Q ss_conf             242103882799999046898878999999876444200131----268-6869862---92---06378999-----8-
Q gi|254780263|r    4 KRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGD----IDS-APEEKLR---GI---TIATAHVS-----Y-   66 (392)
Q Consensus         4 ~~~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~----~D~-~~~E~~r---Gi---Ti~~~~~~-----~-   66 (392)
                      ....+.++.+.|.+.|.+.||||||+.++++.+.++- ..+.    +-+ .+.|+-+   |.   .+.++..+     + 
T Consensus         5 ~~a~~~~~~~~i~v~Gp~GSGKTaLie~~~~~L~~~~-~~aVI~~Di~t~~Da~~l~~~~g~~i~~v~TG~~CH~da~m~   83 (202)
T COG0378           5 RLAEKNRPMLRIGVGGPPGSGKTALIEKTLRALKDEY-KIAVITGDIYTKEDADRLRKLPGEPIIGVETGKGCHLDASMN   83 (202)
T ss_pred             HHHHHCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHC-CEEEEECEEECHHHHHHHHHCCCCEEEEECCCCCCCCCHHHH