HHsearch alignment for GI: 254780263 and conserved domain: pfam00448

>pfam00448 SRP54 SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins.
Probab=98.11  E-value=4.4e-05  Score=50.58  Aligned_cols=123  Identities=20%  Similarity=0.313  Sum_probs=70.8

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCC--CCCC---HHHH------HCCCEEEEEEE-------------EE
Q ss_conf             82799999046898878999999876444200131--2686---8698------62920637899-------------98
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGD--IDSA---PEEK------LRGITIATAHV-------------SY   66 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~--~D~~---~~E~------~rGiTi~~~~~-------------~~   66 (392)
T Consensus         1 P~v-i~lvGptGvGKTTTiaKLAa~~~~~~~~V~lit~Dt~R~gA~eQL~~ya~~l~v~~~~~~~~~d~~~~~~~~l~~~   79 (196)
T pfam00448         1 PNV-ILLVGLQGSGKTTTIAKLAAYLKKQGKKVLLVAADTFRAAAIEQLKQLAERLGVPVFGSGTGSDPAAVAFDAVEKA   79 (196)
T ss_pred             CEE-EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHH
T ss_conf             969-9998999998899999999999977992899975877688999999999863981781487778789999999998


Q ss_pred             ECCCEEEEEEECCC--CHH--HHHHH--HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             21990899984787--302--46779--8774002331452012344332106778888631876023310023335
Q gi|254780263|r   67 ETDKRFYSHIDCPG--HAD--YVKNM--ITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAV  137 (392)
Q Consensus        67 ~~~~~~i~iiD~PG--H~~--f~~~m--i~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v  137 (392)
T Consensus        80 ~~~~~D~IlIDTaGr~~~d~~~~~el~~~~~~~~~~~~~LVl~a~~~~~~~-~~~~~f~~~~~~~~~I--~TKlDet  153 (196)
T pfam00448        80 KAENYDVVLVDTAGRLQNDKNLMDELKKIKRVIAPDEVLLVLDATTGQNAL-NQAKAFNEAVGITGVI--LTKLDGD  153 (196)
T ss_pred             HHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHH-HHHHHHHHHCCCCCEE--EEEECCC
T ss_conf             846899999989998747677899999998522873028998567782137-8999876004776268--8840578