HHsearch alignment for GI: 254780263 and conserved domain: pfam09439

>pfam09439 SRPRB Signal recognition particle receptor beta subunit. The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase which anchors the alpha subunit to the endoplasmic reticulum membrane.
Probab=99.01  E-value=1.9e-09  Score=77.68  Aligned_cols=113  Identities=19%  Similarity=0.245  Sum_probs=74.0

Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEEECCCEEEEEEECCCCHHHHH
Q ss_conf             388279999904689887899999987644420013126868698629206--378999821990899984787302467
Q gi|254780263|r    9 NKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSYETDKRFYSHIDCPGHADYVK   86 (392)
Q Consensus         9 ~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~~~~~~~i~iiD~PGH~~f~~   86 (392)
T Consensus         2 ~~p--tvLllGl~~sGKT~Lf~~L~~~~~~------~T---------~tS~~~n~~~~~~~~~~~~~~lvD~PGh~klR~   64 (181)
T pfam09439         2 SQP--AVIIAGLCDSGKTSLFTLLTTGSVR------KT---------VTSQEPSAAYKYMNNKGNSLTLIDFPGHVKLRY   64 (181)
T ss_pred             CCC--EEEEECCCCCCHHHHHHHHHCCCCC------CE---------ECCCCCCCEEEEECCCCCEEEEEECCCCHHHHH
T ss_conf             988--6999868999899999999759948------75---------888678640687516896689998899689999


Q ss_pred             HHHH---HHHCCCCEEEEECCCC--CCCCCHHHHHHH-HH---H--CCCCCEEEEECCCCCCCC
Q ss_conf             7987---7400233145201234--433210677888-86---3--187602331002333561
Q gi|254780263|r   87 NMIT---GATQADGAILVCAAED--GPKPQTREHILL-AR---Q--IGISSIVVYMNKVDAVDD  139 (392)
Q Consensus        87 ~mi~---g~~~~D~ailvVda~~--G~~~QT~eh~~l-~~---~--lgi~~iIv~iNKmD~v~~  139 (392)
T Consensus        65 ~~~~~~~~~~~~~gIVfVVDS~~~~~~l~~~Ae~Ly~iL~~~~~~~~~vP-vLI~cNKqDl~~A  127 (181)
T pfam09439        65 KLLETLKDSSSLRGLVFVVDSTAFPKEVTDTAEFLYDILSITELLKNGID-ILIACNKQEIFTA  127 (181)
T ss_pred             HHHHHHHHHCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHCHHHCCCCCC-EEEEEECCCCCCC
T ss_conf             99986430026449999997866566799999999999844543368997-8999737463357