RPSBLAST alignment for GI: 254780263 and conserved domain: pfam03143

>gnl|CDD|111981 pfam03143, GTP_EFTU_D3, Elongation factor Tu C-terminal domain. Elongation factor Tu consists of three structural domains, this is the third domain. This domain adopts a beta barrel structure. This the third domain is involved in binding to both charged tRNA and binding to EF-Ts pfam00889. Length = 97
 Score =  127 bits (322), Expect = 5e-30
 Identities = 47/97 (48%), Positives = 65/97 (67%), Gaps = 1/97 (1%)

Query: 296 SIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSP-GSQAVMPGDR 354
            I+ +++F+A VYIL   EGG  T F D Y PQF+  T DVTG+I +   G + VMPGD 
Sbjct: 1   PIKPHTKFKAQVYILNHPEGGGYTPFFDGYTPQFYCRTTDVTGKIKVLEEGPEFVMPGDN 60

Query: 355 VDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEII 391
             + VELI PIA+EP   F++REGG+TV  G++ E++
Sbjct: 61  AIVTVELIKPIAVEPGGRFAIREGGRTVAVGVVTEVL 97