RPSBLAST alignment for GI: 254780263 and conserved domain: TIGR00484

>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G. After peptide bond formation, this elongation factor of bacteria and organelles catalyzes the translocation of the tRNA-mRNA complex, with its attached nascent polypeptide chain, from the A-site to the P-site of the ribosome. Every completed bacterial genome has at least one copy, but some species have additional EF-G-like proteins. The closest homolog to canonical (e.g. E. coli) EF-G in the spirochetes clusters as if it is derived from mitochondrial forms, while a more distant second copy is also present. Synechocystis PCC6803 has a few proteins more closely related to EF-G than to any other characterized protein. Two of these resemble E. coli EF-G more closely than does the best match from the spirochetes; it may be that both function as authentic EF-G. Length = 689
 Score = 56.0 bits (135), Expect = 1e-08
 Identities = 40/122 (32%), Positives = 56/122 (45%), Gaps = 7/122 (5%)

Query: 20  HVDHGKTTLTAAITKYYSEEKK--EYGD----IDSAPEEKLRGITIATAHVSYETDKRFY 73
           H+D GKTT T  I  Y     K  E  D    +D   +EK RGITI +A  +        
Sbjct: 18  HIDAGKTTTTERILFYTGRIHKIGEVHDGAATMDWMEQEKERGITITSAATTVFWKGHRI 77

Query: 74  SHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNK 133
           + ID PGH D+   +       DGA+ V  A  G +PQ+      A +  +  I  ++NK
Sbjct: 78  NIIDTPGHVDFTVEVERSLRVLDGAVAVLDAVGGVQPQSETVWRQANRYEVPRI-AFVNK 136

Query: 134 VD 135
           +D
Sbjct: 137 MD 138