RPSBLAST alignment for GI: 254780263 and conserved domain: TIGR00490

>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2. This model represents archaeal elongation factor 2, a protein more similar to eukaryotic EF-2 than to bacterial EF-G, both in sequence similarity and in sharing with eukaryotes the property of having a diphthamide (modified His) residue at a conserved position. The diphthamide can be ADP-ribosylated by diphtheria toxin in the presence of NAD. Length = 720
 Score = 70.3 bits (172), Expect = 8e-13
 Identities = 57/163 (34%), Positives = 88/163 (53%), Gaps = 22/163 (13%)

Query: 1   MVEKRYVRNKESLGLSTIGHVDHGKTTLT---AAITKYYSEE---KKEYGDIDSAPEEKL 54
           M + +++RN     +  + H+DHGKTTL+    A     SEE   ++ Y D D   +E+ 
Sbjct: 13  MWKPKFIRN-----IGIVAHIDHGKTTLSDNLLAGAGMISEELAGQQLYLDFDE--QEQE 65

Query: 55  RGITIATAHVS----YETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKP 110
           RGITI  A+VS    YE ++   + ID PGH D+  ++       DGAI+V  A +G  P
Sbjct: 66  RGITINAANVSMVHEYEGNEYLINLIDTPGHVDFGGDVTRAMRAVDGAIVVVCAVEGVMP 125

Query: 111 QTREHILLARQIGISSI--VVYMNKVDAVDDDELLDISEYEIR 151
           QT E +L  RQ    ++  V+++NKVD + ++  L   E + R
Sbjct: 126 QT-ETVL--RQALKENVKPVLFINKVDRLINELKLTPQELQER 165