RPSBLAST alignment for GI: 254780263 and conserved domain: cd01890

>gnl|CDD|133290 cd01890, LepA, LepA subfamily. LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome. LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea. This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont. Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype. Length = 179
 Score = 57.5 bits (140), Expect = 6e-09
 Identities = 42/135 (31%), Positives = 66/135 (48%), Gaps = 23/135 (17%)

Query: 16  STIGHVDHGKTTL-------TAAITKYYSEEKKEYGDIDSAPEEKLRGITI----ATAHV 64
           S I H+DHGK+TL       T  ++K   E K++   +DS   E+ RGITI       + 
Sbjct: 4   SIIAHIDHGKSTLADRLLELTGTVSK--REMKEQV--LDSMDLERERGITIKAQTVRLNY 59

Query: 65  SYETDKRFYSH-IDCPGHADY---VKNMITGATQADGAILVCAAEDGPKPQTREHILLAR 120
             +  + +  + ID PGH D+   V   +      +GA+L+  A  G + QT  +  LA 
Sbjct: 60  KAKDGQEYLLNLIDTPGHVDFSYEVSRSLAA---CEGALLLVDATQGVEAQTLANFYLAL 116

Query: 121 QIGISSIVVYMNKVD 135
           +  +  I V +NK+D
Sbjct: 117 ENNLEIIPV-INKID 130