RPSBLAST alignment for GI: 254780263 and conserved domain: pfam00009

>gnl|CDD|143801 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain. This domain contains a P-loop motif, also found in several other families such as pfam00071, pfam00025 and pfam00063. Elongation factor Tu consists of three structural domains, this plus two C-terminal beta barrel domains. Length = 185
 Score =  221 bits (566), Expect = 2e-58
 Identities = 89/191 (46%), Positives = 122/191 (63%), Gaps = 17/191 (8%)

Query: 15  LSTIGHVDHGKTTLTAAITKY-----YSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD 69
           +  IGHVDHGKTTLT A+           E K+ G++D   EE+ RGITI  A VS+ET 
Sbjct: 6   IGIIGHVDHGKTTLTDALLYVTGAIDKRGEVKQEGELDRLKEERERGITIKIAAVSFETK 65

Query: 70  KRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVV 129
           KR  + ID PGH D+ K MI GA QADGAILV  A +G  PQTREH+LLA+Q+G+  I+V
Sbjct: 66  KRHINIIDTPGHVDFTKEMIRGAAQADGAILVVDAVEGVMPQTREHLLLAKQLGV-PIIV 124

Query: 130 YMNKVDAVDDDELLDISEYEIRDLLKEHKYS-DDTPIIRGSALCALQGTNKELGEDSIHA 188
           ++NK+D VDD EL ++ E   R+LL+++ +  +  P+I GS   AL G         I  
Sbjct: 125 FINKMDRVDDAELDEVVEEISRELLEKYGFGGETIPVIPGS---ALTGEG-------IDT 174

Query: 189 LMKAVDTHIPT 199
           L++A+D ++P+
Sbjct: 175 LLEALDLYLPS 185