RPSBLAST alignment for GI: 254780263 and conserved domain: TIGR00487

>gnl|CDD|161900 TIGR00487, IF-2, translation initiation factor IF-2. This model discriminates eubacterial (and mitochondrial) translation initiation factor 2 (IF-2), encoded by the infB gene in bacteria, from similar proteins in the Archaea and Eukaryotes. In the bacteria and in organelles, the initiator tRNA is charged with N-formyl-Met instead of Met. This translation factor acts in delivering the initator tRNA to the ribosome. It is one of a number of GTP-binding translation factors recognized by the pfam model GTP_EFTU. Length = 587
 Score = 75.6 bits (186), Expect = 2e-14
 Identities = 72/227 (31%), Positives = 99/227 (43%), Gaps = 26/227 (11%)

Query: 17  TI-GHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGIT--IATAHVSYETDKRFY 73
           TI GHVDHGKT+L  +I K    +  E G           GIT  I   HV  E D +  
Sbjct: 91  TIMGHVDHGKTSLLDSIRKTKVAQG-EAG-----------GITQHIGAYHVENE-DGKMI 137

Query: 74  SHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNK 133
           + +D PGH  +      GA   D  +LV AA+DG  PQT E I  A+   +  I+V +NK
Sbjct: 138 TFLDTPGHEAFTSMRARGAKVTDIVVLVVAADDGVMPQTIEAISHAKAANV-PIIVAINK 196

Query: 134 VDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAV 193
           +D  + +      E     L+ E  +  DT  +  SAL    G ++ L  D I  L   V
Sbjct: 197 IDKPEANPDRVKQELSEYGLVPE-DWGGDTIFVPVSALTG-DGIDELL--DMI-LLQSEV 251

Query: 194 DTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDV 240
           +     P           IE     +GRG V T  ++ G ++ G  V
Sbjct: 252 EELKANPNGQASGVV---IEAQLD-KGRGPVATVLVQSGTLRVGDIV 294