RPSBLAST alignment for GI: 254780263 and conserved domain: CHL00071

>gnl|CDD|177010 CHL00071, tufA, elongation factor Tu. Length = 409
 Score =  544 bits (1403), Expect = e-155
 Identities = 226/410 (55%), Positives = 291/410 (70%), Gaps = 19/410 (4%)

Query: 1   MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAIT----KYYSEEKKEYGDIDSAPEEKLRG 56
           M  +++ R K  + + TIGHVDHGKTTLTAAIT         + K+Y +IDSAPEEK RG
Sbjct: 1   MAREKFERKKPHVNIGTIGHVDHGKTTLTAAITMTLAAKGGAKAKKYDEIDSAPEEKARG 60

Query: 57  ITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHI 116
           ITI TAHV YET+ R Y+H+DCPGHADYVKNMITGA Q DGAILV +A DGP PQT+EHI
Sbjct: 61  ITINTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTKEHI 120

Query: 117 LLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY-SDDTPIIRGSALCAL- 174
           LLA+Q+G+ +IVV++NK D VDD+ELL++ E E+R+LL ++ +  DD PI+ GSAL AL 
Sbjct: 121 LLAKQVGVPNIVVFLNKEDQVDDEELLELVELEVRELLSKYDFPGDDIPIVSGSALLALE 180

Query: 175 ---QGTNKELGE----DSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTG 227
              +    + GE    D I+ LM AVD++IPTP+R  D PFLM IE    I GRGTV TG
Sbjct: 181 ALTENPKIKRGENKWVDKIYNLMDAVDSYIPTPERDTDKPFLMAIEDVFSITGRGTVATG 240

Query: 228 CIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPR 287
            I+RG +K G  VEI+G+   K     T +EMF+K LDE +AGDNVG+LLRG+ + D+ R
Sbjct: 241 RIERGTVKVGDTVEIVGLRETKT-TTVTGLEMFQKTLDEGLAGDNVGILLRGIQKEDIER 299

Query: 288 GRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRI---ILSP 344
           G V+  PG+I  +++F A VYILT  EGGR T F   YRPQF++ T DVTG+I       
Sbjct: 300 GMVLAKPGTITPHTKFEAQVYILTKEEGGRHTPFFPGYRPQFYVRTTDVTGKIESFTADD 359

Query: 345 GSQA--VMPGDRVDLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE 392
           GS+   VMPGDR+ + VELIYPIA+E    F++REGG+TVGAG++ +I++
Sbjct: 360 GSKTEMVMPGDRIKMTVELIYPIAIEKGMRFAIREGGRTVGAGVVSKILK 409