RPSBLAST alignment for GI: 254780263 and conserved domain: PRK00049

>gnl|CDD|178823 PRK00049, PRK00049, elongation factor Tu; Reviewed. Length = 396
 Score =  620 bits (1601), Expect = e-178
 Identities = 239/397 (60%), Positives = 295/397 (74%), Gaps = 6/397 (1%)

Query: 1   MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSE----EKKEYGDIDSAPEEKLRG 56
           M ++++ R K  + + TIGHVDHGKTTLTAAITK  ++    E K Y  ID APEEK RG
Sbjct: 1   MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITKVLAKKGGAEAKAYDQIDKAPEEKARG 60

Query: 57  ITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHI 116
           ITI TAHV YET+KR Y+H+DCPGHADYVKNMITGA Q DGAILV +A DGP PQTREHI
Sbjct: 61  ITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI 120

Query: 117 LLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY-SDDTPIIRGSALCALQ 175
           LLARQ+G+  IVV++NK D VDD+ELL++ E E+R+LL ++ +  DDTPIIRGSAL AL+
Sbjct: 121 LLARQVGVPYIVVFLNKCDMVDDEELLELVEMEVRELLSKYDFPGDDTPIIRGSALKALE 180

Query: 176 GTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIK 235
           G + E  E  I  LM AVD++IPTP+R++D PFLM IE    I GRGTVVTG ++RG IK
Sbjct: 181 GDDDEEWEKKILELMDAVDSYIPTPERAIDKPFLMPIEDVFSISGRGTVVTGRVERGIIK 240

Query: 236 AGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPG 295
            G +VEI+G+   + K   T VEMFRK LDE  AGDNVG LLRG+ R DV RG+V+  PG
Sbjct: 241 VGEEVEIVGIRDTQ-KTTVTGVEMFRKLLDEGQAGDNVGALLRGIKREDVERGQVLAKPG 299

Query: 296 SIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRV 355
           SI  +++F A VY+L+  EGGR T F + YRPQF+  T DVTG I L  G + VMPGD V
Sbjct: 300 SITPHTKFEAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDVTGVIELPEGVEMVMPGDNV 359

Query: 356 DLEVELIYPIAMEPNQTFSMREGGKTVGAGLILEIIE 392
           ++ VELI PIAME    F++REGG+TVGAG++ +IIE
Sbjct: 360 EMTVELIAPIAMEEGLRFAIREGGRTVGAGVVTKIIE 396