RPSBLAST alignment for GI: 254780263 and conserved domain: PRK12317

>gnl|CDD|183433 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed. Length = 425
 Score =  235 bits (602), Expect = 1e-62
 Identities = 151/440 (34%), Positives = 224/440 (50%), Gaps = 82/440 (18%)

Query: 10  KESLGLSTIGHVDHGKTTLT-----------AAITKYYSEEKKEYGD--------IDSAP 50
           K  L L+ IGHVDHGK+TL              I +   EE KE G         +D   
Sbjct: 4   KPHLNLAVIGHVDHGKSTLVGRLLYETGAIDEHIIEELREEAKEKGKESFKFAWVMDRLK 63

Query: 51  EEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAED--GP 108
           EE+ RG+TI  AH  +ETDK +++ +DCPGH D+VKNMITGA+QAD A+LV AA+D  G 
Sbjct: 64  EERERGVTIDLAHKKFETDKYYFTIVDCPGHRDFVKNMITGASQADAAVLVVAADDAGGV 123

Query: 109 KPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEY-----EIRDLLKEHKY-SDD 162
            PQTREH+ LAR +GI+ ++V +NK+DAV+ DE      Y     E+  LLK   Y  DD
Sbjct: 124 MPQTREHVFLARTLGINQLIVAINKMDAVNYDE----KRYEEVKEEVSKLLKMVGYKPDD 179

Query: 163 TPIIRGSALCALQGTNKELGEDSIH-------ALMKAVDTHIPTPQRSLDAPFLMHIEGS 215
            P I  S   A +G N  + + S +        L++A+D  +  P++