RPSBLAST alignment for GI: 254780263 and conserved domain: KOG0461

>gnl|CDD|35682 KOG0461, KOG0461, KOG0461, Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis]. Length = 522
 Score =  147 bits (373), Expect = 4e-36
 Identities = 86/300 (28%), Positives = 160/300 (53%), Gaps = 30/300 (10%)

Query: 12  SLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI----------AT 61
           +L L  +GHVD GKTTL  A+++  S         D  P+   RGIT+          + 
Sbjct: 7   NLNLGILGHVDSGKTTLARALSELGSTAA-----FDKHPQSTERGITLDLGFSTMTVLSP 61

Query: 62  AHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQ 121
           A +  + ++  ++ +DCPGHA  ++ +I GA   D  ILV   + G + QT E +++  +
Sbjct: 62  ARLP-QGEQLQFTLVDCPGHASLIRTIIGGAQIIDLMILVIDVQKGKQTQTAECLIIG-E 119

Query: 122 IGISSIVVYMNKVDAVDDDEL---LDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTN 178
           +    +VV +NK+D + +++    ++ S  ++R  L+   +  ++PI+    + A  G  
Sbjct: 120 LLCKKLVVVINKIDVLPENQRASKIEKSAKKVRKTLESTGFDGNSPIV---EVSAADGYF 176

Query: 179 KELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGS 238
           KE     I  L +A+++ I  P+R  + PFLM ++    I+G+GTV+TG + RG ++  +
Sbjct: 177 KEEM---IQELKEALESRIFEPKRDEEGPFLMAVDHCFAIKGQGTVLTGTVLRGVLRLNT 233

Query: 239 DVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQ 298
           ++E   +  K+ KVK   ++MF++++  A AGD  G  +   +   + RG +   PG+++
Sbjct: 234 EIEFPALNEKR-KVK--SLQMFKQRVTSAAAGDRAGFCVTQFDEKLLERG-ICGPPGTLK 289