BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780263|ref|YP_003064676.1| translation elongation factor
Tu [Candidatus Liberibacter asiaticus str. psy62]
         (392 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780263|ref|YP_003064676.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 392

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/392 (100%), Positives = 392/392 (100%)

Query: 1   MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA 60
           MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA
Sbjct: 1   MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA 60

Query: 61  TAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLAR 120
           TAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLAR
Sbjct: 61  TAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLAR 120

Query: 121 QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKE 180
           QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKE
Sbjct: 121 QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKE 180

Query: 181 LGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDV 240
           LGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDV
Sbjct: 181 LGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDV 240

Query: 241 EIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEY 300
           EIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEY
Sbjct: 241 EIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEY 300

Query: 301 SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVE 360
           SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVE
Sbjct: 301 SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVE 360

Query: 361 LIYPIAMEPNQTFSMREGGKTVGAGLILEIIE 392
           LIYPIAMEPNQTFSMREGGKTVGAGLILEIIE
Sbjct: 361 LIYPIAMEPNQTFSMREGGKTVGAGLILEIIE 392


>gi|254780150|ref|YP_003064563.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 392

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/392 (100%), Positives = 392/392 (100%)

Query: 1   MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA 60
           MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA
Sbjct: 1   MVEKRYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIA 60

Query: 61  TAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLAR 120
           TAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLAR
Sbjct: 61  TAHVSYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLAR 120

Query: 121 QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKE 180
           QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKE
Sbjct: 121 QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKE 180

Query: 181 LGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDV 240
           LGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDV
Sbjct: 181 LGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDV 240

Query: 241 EIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEY 300
           EIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEY
Sbjct: 241 EIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEY 300

Query: 301 SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVE 360
           SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVE
Sbjct: 301 SRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLEVE 360

Query: 361 LIYPIAMEPNQTFSMREGGKTVGAGLILEIIE 392
           LIYPIAMEPNQTFSMREGGKTVGAGLILEIIE
Sbjct: 361 LIYPIAMEPNQTFSMREGGKTVGAGLILEIIE 392


>gi|254780233|ref|YP_003064646.1| GTP-binding protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 624

 Score = 84.7 bits (208), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 131/284 (46%), Gaps = 37/284 (13%)

Query: 15  LSTIGHVDHGKTTLTAAITK----YYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK 70
           ++ I HVDHGKTTL   + K    +   ++     +D    EK RGITI     S   + 
Sbjct: 22  IAIIAHVDHGKTTLVDELLKQSGVFRDNQRVSERVMDCNDLEKERGITILAKVTSIVWND 81

Query: 71  RFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVY 130
              + +D PGHAD+   +       +  +++  A +GP PQT+  +  A +IG+  IVV 
Sbjct: 82  VRINIVDTPGHADFGGEVERILCMVESVVVLVDAAEGPMPQTKFVVGKALKIGLRPIVV- 140

Query: 131 MNKVDAVD--DDELLDISEYEIRDLLKEHKYSD---DTPIIRGSALCALQGTNKELGEDS 185
           +NKVD  D   DE+++    E+ DL      +D   D PI+ GS        + +   D 
Sbjct: 141 VNKVDRSDARADEVIN----EVFDLFSALDATDAQLDFPILYGSGRFGWMSDSSDGSRDQ 196

Query: 186 -IHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGR--------GTVVTGCIKRGRIKA 236
            +  L+  +  H+P P  S         EG   + G         G +VTG I  G IK+
Sbjct: 197 GMVPLLNLIVDHVPPPVIS---------EGEFKMIGTILEKDPFLGRIVTGRIHSGTIKS 247

Query: 237 GSDVEIIGMGGKKLKV-KCTDVEMF----RKKLDEAIAGDNVGL 275
             +++ +   G  ++V + + +  F    R+ +DEA AGD V +
Sbjct: 248 NQNIKALSPDGALVEVGRVSKILAFRGIDRQPIDEAHAGDIVSI 291


>gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 884

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 67/128 (52%), Gaps = 17/128 (13%)

Query: 15  LSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGIT--IATAHVSYETDKRF 72
           ++ +GHVDHGKT+L  AI K            D A  E + GIT  I    V+Y+   + 
Sbjct: 386 VTIMGHVDHGKTSLLDAIRKA-----------DVAKGE-IGGITQHIGAYQVAYQG--KN 431

Query: 73  YSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMN 132
            + +D PGHA + +    GA   D A+LV AA++   PQ  E I  A+   + SI+V +N
Sbjct: 432 ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADV-SIIVAIN 490

Query: 133 KVDAVDDD 140
           K+D +  D
Sbjct: 491 KIDKLGAD 498


>gi|254780264|ref|YP_003064677.1| elongation factor G [Candidatus Liberibacter asiaticus str. psy62]
          Length = 701

 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 72/150 (48%), Gaps = 18/150 (12%)

Query: 5   RYVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDI-------DSAPEEKLRGI 57
           R  + ++S     + H+D GKTT T  I  YY+ +  + G++       D   +E+ RGI
Sbjct: 3   RKCKIEDSRNFGIMAHIDAGKTTTTERIL-YYAGKSHKIGEVHDGSATMDWMEQEQERGI 61

Query: 58  TIATAHVSY-----ETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQT 112
           TI +A  +      +  ++  + ID PGH D+   +       DGAI +  +  G +PQT
Sbjct: 62  TITSASTTVFWPGRDGGQKKLTIIDTPGHVDFTMEVERSIRVTDGAIALLDSNAGVEPQT 121

Query: 113 REHILLARQIGISSI--VVYMNKVDAVDDD 140
                + RQ    S+  V++ NK+D +  D
Sbjct: 122 ET---VWRQADKYSVPRVIFCNKMDKMGAD 148


>gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 606

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 64/130 (49%), Gaps = 9/130 (6%)

Query: 14  GLSTIGHVDHGKTTLTAAITKY---YSEEKKEYGDIDSAPEEKLRGITI--ATAHVSY-E 67
             S + H+DHGK+TL     ++    +E +     +D+   E+ RGITI   T  ++Y  
Sbjct: 13  NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTS 72

Query: 68  TDKRFY--SHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGIS 125
           TD + Y  + ID PGH D+   +    +  +G++LV  A  G + QT  ++  A      
Sbjct: 73  TDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID-NNH 131

Query: 126 SIVVYMNKVD 135
            I+  +NK D
Sbjct: 132 EIITVLNKAD 141


>gi|254780316|ref|YP_003064729.1| phenylalanyl-tRNA synthetase subunit beta [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 805

 Score = 26.2 bits (56), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 9/33 (27%), Positives = 19/33 (57%)

Query: 161 DDTPIIRGSALCALQGTNKELGEDSIHALMKAV 193
           DD+ + +G A+C ++G    +  + +   +KAV
Sbjct: 209 DDSSLCKGFAMCCVKGVRNNVAPNWMRQRLKAV 241


>gi|254780961|ref|YP_003065374.1| hypothetical protein CLIBASIA_04310 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 200

 Score = 25.8 bits (55), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 174 LQGTNKELGEDSIHALMKAVDTHIP 198
           L   N+++   S H L KAVD +IP
Sbjct: 139 LSRRNRKIARKSQHVLGKAVDFYIP 163


>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 371

 Score = 24.6 bits (52), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 308 YILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQA 348
           YI+  ++G  ++  +DN    F+ + A   G I+ + G QA
Sbjct: 286 YIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQA 326


>gi|254780930|ref|YP_003065343.1| nodulation protein (outer membrane efflux protein) [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 452

 Score = 24.3 bits (51), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 13/87 (14%)

Query: 134 VDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAV 193
           +DA    E + I+ ++I DL K++        I  S L   QG   +L    + A +K++
Sbjct: 165 IDARHFKERISIA-HQILDLYKKN--------IELSHLKFTQGATSKLSLVKLEAEIKSI 215

Query: 194 DTHIPTPQRSLDAPFLMHIEGSCGIEG 220
           ++ IPT ++S    F M++     + G
Sbjct: 216 ESDIPTLEKS----FRMNVHNISTLLG 238


>gi|254780342|ref|YP_003064755.1| substrate-binding region of ABC-type glycine betaine transport
           system [Candidatus Liberibacter asiaticus str. psy62]
          Length = 309

 Score = 24.3 bits (51), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 15/31 (48%)

Query: 67  ETDKRFYSHIDCPGHADYVKNMITGATQADG 97
           + D++F        H D +KN + G T  DG
Sbjct: 266 KQDRQFVGRTMLRTHPDLLKNWLIGVTTFDG 296


>gi|254780382|ref|YP_003064795.1| ATP dependent RNA helicase protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 465

 Score = 23.9 bits (50), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 47/114 (41%), Gaps = 12/114 (10%)

Query: 198 PTPQRSLDAPFLMHIEGSCGIEGRGTVVTGC--------IKRGRIKAGSDVEIIGMGGKK 249
           PTP +    P ++     CGI   GT  T          +++GR +      +I    ++
Sbjct: 24  PTPIQIKTIPLVLQRHDVCGIAQTGTGKTASFVLPMLTILEKGRARVRMPRTLILEPTRE 83

Query: 250 LKVKCTD-VEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGR--VVCAPGSIQEY 300
           L  +  D  E + K  +  +A    G+     N+  + RG   ++C PG I ++
Sbjct: 84  LAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKK-LERGADVLICTPGRILDH 136


>gi|254780392|ref|YP_003064805.1| leucyl aminopeptidase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 494

 Score = 23.5 bits (49), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 8/23 (34%), Positives = 15/23 (65%)

Query: 324 NYRPQFFMDTADVTGRIILSPGS 346
           +Y P   +D A +TG +++S G+
Sbjct: 359 HYNPHLMIDLATLTGAMVVSLGN 381


>gi|254781102|ref|YP_003065515.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 497

 Score = 23.1 bits (48), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 25/60 (41%)

Query: 78  CPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAV 137
           C G  D  K  I G    D A +    +D P+ +  E I      GI   +   N+++A+
Sbjct: 390 CGGDRDQGKRPIMGKIALDLADIAIVTDDNPRSEDPEKIRAEIIHGIPGFIEKGNRIEAI 449


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.318    0.137    0.393 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 253,258
Number of Sequences: 1233
Number of extensions: 10574
Number of successful extensions: 40
Number of sequences better than 100.0: 16
Number of HSP's better than 100.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 22
Number of HSP's gapped (non-prelim): 17
length of query: 392
length of database: 328,796
effective HSP length: 76
effective length of query: 316
effective length of database: 235,088
effective search space: 74287808
effective search space used: 74287808
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 39 (19.6 bits)