HHsearch alignment for GI: 254780264 and conserved domain: KOG0078

>KOG0078 consensus.
Probab=97.70  E-value=0.002  Score=40.73  Aligned_cols=121  Identities=21%  Similarity=0.216  Sum_probs=81.0

Q ss_pred             CCCCCCHHHEEEEEEECCCCCCHHHHHHHHHHHCC---CCCCCCEECCCCEECCCHHHHHHHCCCEEEEEEEEEECCCCC
Q ss_conf             98656710252799986878897789999999808---732142201795613780889870853764079999607778
Q gi|254780264|r    1 MARKCKIEDSRNFGIMAHIDAGKTTTTERILYYAG---KSHKIGEVHDGSATMDWMEQEQERGITITSASTTVFWPGRDG   77 (701)
Q Consensus         1 m~~~~~~e~iRNv~iiaHvd~GKTTL~d~LL~~~g---~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~sl~~~~~~~   77 (701)
T Consensus         4 ~~~~-~~d~~~kvlliGDs~vGKt~~l~rf~d~~f~~~~~sTiG-------------------IDFk~kt--i~l---~g   58 (207)
T KOG0078           4 MAKE-DYDYLFKLLLIGDSGVGKTCLLLRFSDDSFNTSFISTIG-------------------IDFKIKT--IEL---DG   58 (207)
T ss_pred             CCCC-CCCEEEEEEEECCCCCCHHHHHHHHHHCCCCCCCCCEEE-------------------EEEEEEE--EEE---CC
T ss_conf             4457-845189999977898765576665440667677651587-------------------8878889--983---89


Q ss_pred             CCEEEEEEECCCCCCCHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHH----HHHHHCCCCEEEEECCCCCCC
Q ss_conf             713899981798755289999999860456999955888883479999----999873997899981767658
Q gi|254780264|r   78 GQKKLTIIDTPGHVDFTMEVERSIRVTDGAIALLDSNAGVEPQTETVW----RQADKYSVPRVIFCNKMDKMG  146 (701)
Q Consensus        78 ~~~~iNlIDTPGH~DF~~Ev~~aL~~~DgailvVDa~eGv~~qT~~vl----r~~~~~~lp~ilvINKiDr~~  146 (701)
T Consensus        59 ~~i~lQiWDtaGQerf~ti~~sYyrgA~gi~LvyDitne~Sfeni~~W~~~I~e~a~~~v~~~LvGNK~D~~~  131 (207)
T KOG0078          59 KKIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDITNEKSFENIRNWIKNIDEHASDDVVKILVGNKCDLEE  131 (207)
T ss_pred             EEEEEEEEECCCCHHHHHHHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCC
T ss_conf             0899999972430567889999986548249999845257777799999999863788874898511412101