>cd00876 Ras Ras family. The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins. Ras proteins regulate cell growth, proliferation and differentiation. Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding. Many RasGEFs have been identified. These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras. Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of m

Probab=98.86 E-value=7.9e-08 Score=68.98 Aligned_cols=109 Identities=25% Similarity=0.250 Sum_probs=73.6 Q ss_pred EEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEE-EEEEEEECCCCCCCEEEEEEECCCCC Q ss_conf 99986878897789999999808732142201795613780889870853764-07999960777871389998179875 Q gi|254780264|r 13 FGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITS-ASTTVFWPGRDGGQKKLTIIDTPGHV 91 (701) Q Consensus 13 v~iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~s-s~~sl~~~~~~~~~~~iNlIDTPGH~ 91 (701) T Consensus 2 i~ivG~~~vGKTsli~r~~~~--~f~~--~------~~p----------Ti~~~~~~~~~~---~~~~~~l~i~Dt~g~~ 58 (160) T cd00876 2 VVVLGAGGVGKSAITIQFVKG--TFVE--E------YDP----------TIEDSYRKTIVV---DGETYTLDILDTAGQE 58 (160) T ss_pred EEEECCCCCCHHHHHHHHHHC--CCCC--C------CCC----------CEEEEEEEEEEE---CCEEEEEEEEECCCCH T ss_conf 999996996799999999619--5998--7------788----------300489999997---6699999999799962 Q ss_pred CCHHHHHHHHHHHCEEEEEEECCCCCCHHHH-HHHHHH----HHCCCCEEEEECCCCC Q ss_conf 5289999999860456999955888883479-999999----8739978999817676 Q gi|254780264|r 92 DFTMEVERSIRVTDGAIALLDSNAGVEPQTE-TVWRQA----DKYSVPRVIFCNKMDK 144 (701) Q Consensus 92 DF~~Ev~~aL~~~DgailvVDa~eGv~~qT~-~vlr~~----~~~~lp~ilvINKiDr 144 (701) T Consensus 59 ~~~~~~~~~~~~a~~~ilvfd~~~~~Sf~~i~~~~~~i~~~~~~~~~piilvgnK~Dl 116 (160) T cd00876 59 EFSAMRDLYIRQGDGFILVYSITDRESFEEIKGYREQILRVKDDEDIPIVLVGNKCDL 116 (160) T ss_pred HHHHHHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCC T ss_conf 3557889997643689997328987899999999999999728788629999974562

HHsearch alignment for GI: 254780264 and conserved domain: cd00876