>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division. Among the Ras superfamily, Ran is a unique small G protein. It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily. Ran may therefore interact with a wide range of proteins in various intracellular locations. Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors. Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins. The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is

Probab=98.60 E-value=1.1e-06 Score=61.55 Aligned_cols=109 Identities=23% Similarity=0.269 Sum_probs=72.5 Q ss_pred EEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEEE--EEEEEECCCCCCCEEEEEEECCCC Q ss_conf 999868788977899999998087321422017956137808898708537640--799996077787138999817987 Q gi|254780264|r 13 FGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSA--STTVFWPGRDGGQKKLTIIDTPGH 90 (701) Q Consensus 13 v~iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss--~~sl~~~~~~~~~~~iNlIDTPGH 90 (701) T Consensus 3 ivlvGd~~VGKTsli~r~~~--~~f~~----~----~~----------~Tig~~~~~~~~~~---~~~~v~l~iwDtaGq 59 (166) T cd00877 3 LVLVGDGGTGKTTFVKRHLT--GEFEK----K----YV----------ATLGVEVHPLDFHT---NRGKIRFNVWDTAGQ 59 (166) T ss_pred EEEECCCCCCHHHHHHHHHH--CCCCC----C----CC----------CCCCEEEEEEEEEE---CCEEEEEEEEECCCC T ss_conf 99999999888999999983--99999----8----68----------73255679999999---997999999975787 Q ss_pred CCCHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHH-HHH--HHCCCCEEEEECCCCC Q ss_conf 55289999999860456999955888883479999-999--8739978999817676 Q gi|254780264|r 91 VDFTMEVERSIRVTDGAIALLDSNAGVEPQTETVW-RQA--DKYSVPRVIFCNKMDK 144 (701) Q Consensus 91 ~DF~~Ev~~aL~~~DgailvVDa~eGv~~qT~~vl-r~~--~~~~lp~ilvINKiDr 144 (701) T Consensus 60 e~~~~l~~~y~~~a~~~ilvyDvt~~~Sf~~v~~w~~~i~~~~~~~piilVgNK~Dl 116 (166) T cd00877 60 EKFGGLRDGYYIGGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCGNIPIVLCGNKVDI 116 (166) T ss_pred HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCC T ss_conf 156668788740065799843789888999999999999986899989999986217

HHsearch alignment for GI: 254780264 and conserved domain: cd00877