>cd00880 Era_like Era (E. coli Ras-like protein)-like. This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons. FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control. Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain. EngA and its orthologs are composed of two GTPase domains and, since the se

Probab=99.66 E-value=2.4e-15 Score=117.22 Aligned_cols=111 Identities=17% Similarity=0.220 Sum_probs=80.9 Q ss_pred EECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEEEEEEEEECCCCCCCEEEEEEECCCCC--- Q ss_conf 98687889778999999980873214220179561378088987085376407999960777871389998179875--- Q gi|254780264|r 15 IMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSASTTVFWPGRDGGQKKLTIIDTPGHV--- 91 (701) Q Consensus 15 iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~sl~~~~~~~~~~~iNlIDTPGH~--- 91 (701) T Consensus 1 ivG~~N~GKStL~N~L~~~--~~~~vs~-~--------------~gtT~~~~~~~~~~~~----~~~i~lvDtpG~~~~~ 59 (163) T cd00880 1 LFGRTNAGKSSLLNALLGQ--EVAIVSP-V--------------PGTTTDPVEYVWELGP----LGPVVLIDTPGIDEAG 59 (163) T ss_pred CCCCCCCCHHHHHHHHHCC--CCCEECC-C--------------CCEECCCEEEEEEECC----CCEEEEEECCCCCCCC T ss_conf 9197998999999999589--9610169-8--------------9986564589999547----8659997279852223 Q ss_pred ----CCHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC Q ss_conf ----5289999999860456999955888883479999999873997899981767658 Q gi|254780264|r 92 ----DFTMEVERSIRVTDGAIALLDSNAGVEPQTETVWRQADKYSVPRVIFCNKMDKMG 146 (701) Q Consensus 92 ----DF~~Ev~~aL~~~DgailvVDa~eGv~~qT~~vlr~~~~~~lp~ilvINKiDr~~ 146 (701) T Consensus 60 ~~~~~~~~~~~~~~~~~D~il~viD~~~~~~~~~~~~l~~l~~~~~p~i~v~NK~D~~~ 118 (163) T cd00880 60 GLGREREELARRVLERADLILFVVDADLRADEEEEKLLELLRERGKPVLLVLNKIDLLP 118 (163) T ss_pred CHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECEECCC T ss_conf 10168999999999868989999878999755669999999971974278853420678

HHsearch alignment for GI: 254780264 and conserved domain: cd00880