>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily. RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively. RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis. Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression. In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo. RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors. Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm. Both are believed to have tu

Probab=98.50 E-value=2.4e-06 Score=59.47 Aligned_cols=111 Identities=27% Similarity=0.325 Sum_probs=70.1 Q ss_pred EEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEEEEEEEEECCCCCCCEEEEEEECCCCCC Q ss_conf 99986878897789999999808732142201795613780889870853764079999607778713899981798755 Q gi|254780264|r 13 FGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSASTTVFWPGRDGGQKKLTIIDTPGHVD 92 (701) Q Consensus 13 v~iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~sl~~~~~~~~~~~iNlIDTPGH~D 92 (701) T Consensus 2 iv~vGd~~VGKTsli~rf~~~--~f~--~~------y~~T~~~------~-~~~~--~~v---~~~~~~l~iwDtaG~e~ 59 (165) T cd04146 2 IAVLGASGVGKSALVVRFLTK--RFI--GE------YDPNLES------L-YSRQ--VTI---DGEQVSLEILDTAGQQQ 59 (165) T ss_pred EEEECCCCCCHHHHHHHHHHC--CCC--CC------CCCCCCC------E-EEEE--EEE---CCEEEEEEEEECCCCCC T ss_conf 999998997789999999749--899--87------5995563------0-5799--999---99999999992898501 Q ss_pred CHHHH-HHHHHHHCEEEEEEECCCCCCHHHHHHHHH-HH-----HCCCCEEEEECCCCCC Q ss_conf 28999-999986045699995588888347999999-98-----7399789998176765 Q gi|254780264|r 93 FTMEV-ERSIRVTDGAIALLDSNAGVEPQTETVWRQ-AD-----KYSVPRVIFCNKMDKM 145 (701) Q Consensus 93 F~~Ev-~~aL~~~DgailvVDa~eGv~~qT~~vlr~-~~-----~~~lp~ilvINKiDr~ 145 (701) T Consensus 60 ~~~~~~~~~~~~a~~~ilvydit~~~Sf~~~~~~~~~i~~~~~~~~~~piilVGNK~DL~ 119 (165) T cd04146 60 ADTEQLERSIRWADGFVLVYSITDRSSFDEISQLKQLIREIKKRDREIPVILVGNKADLL 119 (165) T ss_pred CCHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCC T ss_conf 220125543045878999986588899999999999999984669995399844554521

HHsearch alignment for GI: 254780264 and conserved domain: cd04146