HHsearch alignment for GI: 254780264 and conserved domain: cd04150

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins. Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation. Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state. GDP/GTP exchange exposes the helix, which anchors to the membrane. Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein. A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site. Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned. Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI. It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins. Humans, but not rodents
Probab=99.10  E-value=3.4e-09  Score=77.73  Aligned_cols=110  Identities=22%  Similarity=0.194  Sum_probs=75.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEEEEEEEEECCCCCCCEEEEEEECCCCC
Q ss_conf             79998687889778999999980873214220179561378088987085376407999960777871389998179875
Q gi|254780264|r   12 NFGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSASTTVFWPGRDGGQKKLTIIDTPGHV   91 (701)
Q Consensus        12 Nv~iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~sl~~~~~~~~~~~iNlIDTPGH~   91 (701)
T Consensus         2 KililG~~~sGKTsll~~l~~--~~~~------------~~~-------pT~g~~~~~~~~~-----~~~l~iwD~~G~~   55 (159)
T cd04150           2 RILMVGLDAAGKTTILYKLKL--GEIV------------TTI-------PTIGFNVETVEYK-----NISFTVWDVGGQD   55 (159)
T ss_pred             EEEEECCCCCCHHHHHHHHHC--CCCC------------CCC-------CCCCCCEEEEEEC-----CEEEEEEECCCCC
T ss_conf             999999999998999999972--9967------------758-------9687017999989-----8999999789972


Q ss_pred             CCHHHHHHHHHHHCEEEEEEECCCCCC-HHHHHHHHHH----HHCCCCEEEEECCCCCCCC
Q ss_conf             528999999986045699995588888-3479999999----8739978999817676587
Q gi|254780264|r   92 DFTMEVERSIRVTDGAIALLDSNAGVE-PQTETVWRQA----DKYSVPRVIFCNKMDKMGA  147 (701)
Q Consensus        92 DF~~Ev~~aL~~~DgailvVDa~eGv~-~qT~~vlr~~----~~~~lp~ilvINKiDr~~~  147 (701)
T Consensus        56 ~~r~l~~~Y~~~a~~iI~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~pili~~NK~Dl~~~  116 (159)
T cd04150          56 KIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELQRMLNEDELRDAVLLVFANKQDLPNA  116 (159)
T ss_pred             CCCHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEECCCCCCC
T ss_conf             1465678647687389999977777899999999999962353369829999975667789