RPSBLAST alignment for GI: 254780264 and conserved domain: COG1217

>gnl|CDD|31410 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]. Length = 603
 Score = 48.2 bits (115), Expect = 7e-06
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 604 QLLEPLMKVEVTVPAEYVGDVIGDLSSRRGQIQGQENRSV-YVVIDAHVPLSCMFKYVDS 662
              EP  +V + VP E+ G VI  L  R+G+++         V ++  +P   +  +   
Sbjct: 395 VKCEPFEEVTIDVPEEHQGAVIEKLGERKGEMKDMAPDGKGRVRLEFVIPARGLIGFRTE 454

Query: 663 LRSMSQGRGQYTMIFDHYAPV 683
             +M++G G     FDHY PV
Sbjct: 455 FLTMTRGTGIMNHSFDHYRPV 475