RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780265|ref|YP_003064678.1| 30S ribosomal protein S7 [Candidatus Liberibacter asiaticus str. psy62] (156 letters) >gnl|CDD|143943 pfam00177, Ribosomal_S7, Ribosomal protein S7p/S5e. This family contains ribosomal protein S7 from prokaryotes and S5 from eukaryotes. Length = 149 Score = 208 bits (531), Expect = 7e-55 Identities = 82/149 (55%), Positives = 114/149 (76%) Query: 1 MSRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVA 60 M RR RA REVLPDPK++ +V K +N +M GKKS+A IVY AF+++E+K K+P+ Sbjct: 1 MPRRGRAKKREVLPDPKYNSRLVEKLINKLMKDGKKSLAEKIVYKAFEIIEEKTGKNPLE 60 Query: 61 LFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRL 120 + QA+ NV P+ EV++RRVGGA Y VP E++ +R ALAIRW++ AARKR+ +M ++L Sbjct: 61 VLVQAIENVKPRVEVKSRRVGGATYQVPVEVSPERRVALAIRWILKAARKRSGKSMAEKL 120 Query: 121 GGEIIDAANNRGVAVRKREETHKVAEANR 149 E+IDAANN+G A++K+EETHK+AEANR Sbjct: 121 ANELIDAANNKGSAIKKKEETHKMAEANR 149 >gnl|CDD|176994 CHL00053, rps7, ribosomal protein S7. Length = 155 Score = 190 bits (486), Expect = 1e-49 Identities = 79/155 (50%), Positives = 109/155 (70%) Query: 1 MSRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVA 60 MSRR A R PDP + + +V +N I+ GKKS+A IVY A +++K +K+P++ Sbjct: 1 MSRRGTAKKRTAKPDPIYRNRLVNMLVNRILKSGKKSLAYRIVYRALKKIQQKTEKNPLS 60 Query: 61 LFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRL 120 + RQA+ NVTP EV+ RRVGG+ Y VP EI S R +ALAIRWL+ A+RKR+ M +L Sbjct: 61 VLRQAIRNVTPDVEVKARRVGGSTYQVPIEIGSTRGKALAIRWLLKASRKRSGRNMAFKL 120 Query: 121 GGEIIDAANNRGVAVRKREETHKVAEANRAFSHYR 155 E++DAA G A+RK+EETH++AEANRAF+H+R Sbjct: 121 SSELVDAAKGSGNAIRKKEETHRMAEANRAFAHFR 155 >gnl|CDD|30398 COG0049, RpsG, Ribosomal protein S7 [Translation, ribosomal structure and biogenesis]. Length = 148 Score = 184 bits (470), Expect = 6e-48 Identities = 82/148 (55%), Positives = 112/148 (75%) Query: 2 SRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVAL 61 RR A REVLPDPK++ +V + +N IM GKKS+A IVYGAFD++EKK ++P+ + Sbjct: 1 PRRHTAGKREVLPDPKYNSVIVERLINKIMRDGKKSLAEKIVYGAFDIIEKKTGQNPLQV 60 Query: 62 FRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRLG 121 F +A+ NV P+ EV++RRVGGA Y VP E+ +R ALA+RW++ ARKRNE TM +RL Sbjct: 61 FEKAIENVKPREEVKSRRVGGATYQVPVEVRPRRRVALALRWIVEGARKRNEKTMAERLA 120 Query: 122 GEIIDAANNRGVAVRKREETHKVAEANR 149 E+IDAANN G A++K+E+TH++AEANR Sbjct: 121 NELIDAANNTGAAIKKKEDTHRMAEANR 148 >gnl|CDD|38501 KOG3291, KOG3291, KOG3291, Ribosomal protein S7 [Translation, ribosomal structure and biogenesis]. Length = 208 Score = 119 bits (300), Expect = 3e-28 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 3/152 (1%) Query: 1 MSRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVA 60 S R A R + ++ K MN IM GKK +A IV A +++++ +++P+ Sbjct: 57 HSAGRYAKKRFRKAQCPIVERLINKLMNHIMKNGKKLLARRIVKHALEIIKRLTERNPIQ 116 Query: 61 LFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARK---RNETTMI 117 + QA+ N P +V G Y VP ++ R LAI+W++ AR+ RN T+ Sbjct: 117 VLVQAIENCGPLEDVTRIGRAGTTYQVPVPVSPLRRVNLAIKWILTGARERSFRNIKTLA 176 Query: 118 DRLGGEIIDAANNRGVAVRKREETHKVAEANR 149 + L E+I AA G A++K++E H++AEANR Sbjct: 177 ECLADELIAAAKGSGNAIKKKDELHRMAEANR 208 >gnl|CDD|32611 COG2718, COG2718, Uncharacterized conserved protein [Function unknown]. Length = 423 Score = 28.4 bits (63), Expect = 0.96 Identities = 16/73 (21%), Positives = 27/73 (36%), Gaps = 2/73 (2%) Query: 74 EVRTRRVGGAAYSVPGEITSKRSQ--ALAIRWLIMAARKRNETTMIDRLGGEIIDAANNR 131 E +T R G VP I+ R+ +LA R + ++R + L + Sbjct: 146 EFKTHRAGYTKSGVPANISVVRTLQNSLARRTAMTRPKRRELDALAGELADIEVSEPAQL 205 Query: 132 GVAVRKREETHKV 144 R R E ++ Sbjct: 206 MEEERLRPEIARL 218 >gnl|CDD|113071 pfam04285, DUF444, Protein of unknown function (DUF444). Bacterial protein of unknown function. One family member is predicted to contain a von Willebrand factor (vWF) type A domain (Smart:VWA). Length = 421 Score = 27.4 bits (61), Expect = 1.9 Identities = 13/72 (18%), Positives = 20/72 (27%), Gaps = 2/72 (2%) Query: 74 EVRTRRVGGAAYSVPGEITSKRSQ--ALAIRWLIMAARKRNETTMIDRLGGEIIDAANNR 131 E +T R G VP I R+ A+ R + ++ L + Sbjct: 146 EFKTERAGIQKSGVPANINKVRTLRSAIKRRIALGRPKRAELDADAGELARIARWEPIDL 205 Query: 132 GVAVRKREETHK 143 R E Sbjct: 206 MEEDVLRTEIAI 217 >gnl|CDD|48393 cd02148, Nitroreductase_5, Nitroreductase-like family 5. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase.. Length = 185 Score = 27.1 bits (60), Expect = 1.9 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Query: 62 FRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAAR 109 F + L + P + R+ G A + E T+ R+ +L + I+AAR Sbjct: 85 FHEQLPRLFPHRDARSWFFGSPALA---EETAFRNSSLQGGYFILAAR 129 >gnl|CDD|143629 cd07891, CYTH-like_CthTTM-like_1, CYTH-like Clostridium thermocellum TTM-like subgroup 1. This subgroup contains the triphosphate tunnel metalloenzyme (TTM) from Clostridium thermocellum (CthTTM) and similar proteins. These are found primarily in bacteria. CthTTM is a metal dependent tripolyphosphatase, nucleoside triphosphatase, and nucleoside tetraphosphatase. It hydrolyzes the beta-gamma phosphoanhydride linkage of triphosphate-containing substrates including tripolyphosphate, nucleoside triphosphates and nucleoside tetraphosphates. These substrates are hydrolyzed, releasing Pi. Mg++ or Mn++ are required for the enzyme's activity. CthTTM appears to have no adenylate cyclase activity. This subgroup consists chiefly of bacterial sequences. These enzymes are members of the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily, which have a unique active site located within an eight-stranded beta barrel. Length = 148 Score = 26.3 bits (59), Expect = 3.9 Identities = 9/33 (27%), Positives = 13/33 (39%) Query: 53 KEKKDPVALFRQALINVTPQFEVRTRRVGGAAY 85 + RQ ++ P+ VR R G AY Sbjct: 15 RALAAKGVRIRQGYLSTDPERTVRVRIAGDRAY 47 >gnl|CDD|35358 KOG0136, KOG0136, KOG0136, Acyl-CoA oxidase [Lipid transport and metabolism]. Length = 670 Score = 26.0 bits (57), Expect = 4.2 Identities = 9/25 (36%), Positives = 12/25 (48%) Query: 3 RRRRAVVREVLPDPKFSDFVVAKFM 27 +RRR + V DP+ D FM Sbjct: 39 KRRREIEDLVASDPELQDKKPLPFM 63 >gnl|CDD|173839 cd01150, AXO, Peroxisomal acyl-CoA oxidase. Peroxisomal acyl-CoA oxidases (AXO) catalyze the first set in the peroxisomal fatty acid beta-oxidation, the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. In a second oxidative half-reaction, the reduced FAD is reoxidized by molecular oxygen. AXO is generally a homodimer, but it has been reported to form a different type of oligomer in yeast. There are several subtypes of AXO's, based on substrate specificity. Palmitoyl-CoA oxidase acts on straight-chain fatty acids and prostanoids; whereas, the closely related Trihydroxycoprostanoly-CoA oxidase has the greatest activity for 2-methyl branched side chains of bile precursors. Pristanoyl-CoA oxidase, acts on 2-methyl branched fatty acids. AXO has an additional domain, C-terminal to the region with similarity to acyl-CoA dehydrogenases, which is included in this alignment. Length = 610 Score = 25.8 bits (57), Expect = 6.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 3 RRRRAVVREVLPDPKFSDFVVAKFM 27 RR+R V RE+ DP F + +K + Sbjct: 29 RRKREVERELESDPLFQRELPSKHL 53 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.134 0.381 Gapped Lambda K H 0.267 0.0781 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,836,613 Number of extensions: 87955 Number of successful extensions: 192 Number of sequences better than 10.0: 1 Number of HSP's gapped: 191 Number of HSP's successfully gapped: 18 Length of query: 156 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 70 Effective length of database: 4,405,363 Effective search space: 308375410 Effective search space used: 308375410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.1 bits)