HHsearch alignment for GI: 254780266 and conserved domain: KOG1749

>KOG1749 consensus.
Probab=99.91  E-value=1.5e-24  Score=164.78  Aligned_cols=98  Identities=33%  Similarity=0.647  Sum_probs=83.7

Q ss_pred             CCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCEEEEEEE-CCCCEEEEEECCCC--CCCCCCCEEEEEC-C----
Q ss_conf             86466667700068621247875675184567442432889996-69969999807888--7546467899953-7----
Q gi|254780266|r   15 SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL-TSGVEVIAYVPGEG--HNLQEHSVVMLCG-G----   86 (124)
Q Consensus        15 ~~~~~~K~~~L~~~PqkkGVclkv~~~~PKKPNSA~RKvarV~L-sng~~v~ayIPGeG--hnlqehs~VLvrG-G----   86 (124)
T Consensus        31 ~lGta~K~~pfggashAKgIvLEKigVEAKQPNSAiRKcvRvQLIkngKKITafVp~dgcln~ieendevlv~gfgrkg~  110 (143)
T KOG1749          31 LLGTAYKSSPFGGASHAKGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGH  110 (143)
T ss_pred             HHCCHHHCCCCCCCCCCCEEEEEEEEEECCCCCHHHHHHEEEEEEECCCEEEEEECCCCCEEEECCCCEEEEECCCCCCC
T ss_conf             64513322877886556446888610311497378765316645307846789826887152112587566440475675


Q ss_pred             CCCCCCCCEEEEEE--CCCCCCCCCCCC
Q ss_conf             83888875478980--400144334200
Q gi|254780266|r   87 RVKDLPGVKYRVIR--GVLDAQGVKNRK  112 (124)
Q Consensus        87 rv~DlPGVry~ivR--G~~D~~gv~~Rk  112 (124)
T Consensus       111 avgdipgvrfkvvkv~~vsl~alf~~kk  138 (143)
T KOG1749         111 AVGDIPGVRFKVVKVSGVSLLALFKEKK  138 (143)
T ss_pred             CCCCCCCEEEEEEEECCCCHHHHHHCCC
T ss_conf             0367786378999970737456553444