HHsearch alignment for GI: 254780266 and conserved domain: cd03367

>cd03367 Ribosomal_S23 S12-like family, 40S ribosomal protein S23 subfamily; S23 is located at the interface of the large and small ribosomal subunits of eukaryotes, adjacent to the decoding center. It interacts with domain III of the eukaryotic elongation factor 2 (eEF2), which catalyzes the translocation of the growing peptidyl-tRNA to the P site to make room for the next aminoacyl-tRNA at the A (acceptor) site. Through its interaction with eEF2, S23 may play an important role in translocation. Also members of this subfamily are the archaeal 30S ribosomal S12 proteins. Prokaryotic S12 is essential for maintenance of a pretranslocation state and, together with S13, functions as control element for the rRNA- and tRNA-driven movements of translocation. S12 and S23 are also implicated in translation accuracy. Antibiotics such as streptomycin bind S12/S23 and cause the ribosome to misread the genetic code.
Probab=100.00  E-value=5.4e-43  Score=272.68  Aligned_cols=102  Identities=34%  Similarity=0.647  Sum_probs=94.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCEEEEEEE-CCCCEEEEEECCCC--CCCCCCCEEEE-----
Q ss_conf             73786466667700068621247875675184567442432889996-69969999807888--75464678999-----
Q gi|254780266|r   12 RKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL-TSGVEVIAYVPGEG--HNLQEHSVVML-----   83 (124)
Q Consensus        12 Rkk~~~~~~K~~~L~~~PqkkGVclkv~~~~PKKPNSA~RKvarV~L-sng~~v~ayIPGeG--hnlqehs~VLv-----   83 (124)
T Consensus         3 ~r~~~~~~~K~~pl~g~pq~kGIvl~~~~~~pKkPNSA~RK~~rVqL~kngk~vtAyiPg~G~~h~lqEh~~Vlv~g~g~   82 (115)
T cd03367           3 KKRHLGTKYKADPLGGAPHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPGDGCLNFIDENDEVLVAGFGR   82 (115)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCCCEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCEEEEEECCC
T ss_conf             31201741257855689651668999988534899741017999999149919999917998424356488999972277


Q ss_pred             ECCCCCCCCCCEEEEEE--CCCCCCCCCCCCC
Q ss_conf             53783888875478980--4001443342001
Q gi|254780266|r   84 CGGRVKDLPGVKYRVIR--GVLDAQGVKNRKQ  113 (124)
Q Consensus        84 rGGrv~DlPGVry~ivR--G~~D~~gv~~Rk~  113 (124)
T Consensus        83 ~G~~v~DlPGVrykvvrV~~vsl~~l~~gkke  114 (115)
T cd03367          83 KGRAVGDIPGVRFKVVKVNGVSLLALFKGKKE  114 (115)
T ss_pred             CCCCCCCCCCEEEEEEEECCEEHHHHHCCCCC
T ss_conf             88725879970689999988668997513035