HHsearch results for GI: 254780266 and protein with PDBid: 2zkq_l

>2zkq_l 40S ribosomal protein S23E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 3jyv_L* 1s1h_L*
Probab=100.00  E-value=4.1e-44  Score=278.00  Aligned_cols=104  Identities=29%  Similarity=0.592  Sum_probs=93.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCEEEEEEE-CCCCEEEEEECCCC--CCCCCCCEEEE-----EC
Q ss_conf             786466667700068621247875675184567442432889996-69969999807888--75464678999-----53
Q gi|254780266|r   14 GSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL-TSGVEVIAYVPGEG--HNLQEHSVVML-----CG   85 (124)
Q Consensus        14 k~~~~~~K~~~L~~~PqkkGVclkv~~~~PKKPNSA~RKvarV~L-sng~~v~ayIPGeG--hnlqehs~VLv-----rG   85 (124)
                      +......|+++|++|||++|||+++++++|||||||+||||+|+| +||++|||||||||  |||||||+|||     +|
T Consensus        30 ~~~~~~~K~~pl~g~Pq~kGivl~~~~~~pKkPNSA~RK~~rV~L~~ngk~vtA~iPG~G~~h~l~eh~~Vlv~g~G~rG  109 (143)
T 2zkq_l           30 AHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKG  109 (143)
T ss_dssp             CCCCCCCCCCCSTTCSCEEEEEEEEEEEECCTTCCCEEEEEEEEESGGGCEEEEECCSSCSSCCCCTTCCEEECSSSSSS
T ss_pred             HHHCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCCCCEEEEEEEEECCCEEEEEEECCCCCCCCCCCCCEEEEEECCCCC
T ss_conf             43033313583458975256899976733579875201699999905990999992798650556648899997357578


Q ss_pred             CCCCCCCCCEEEEEECC-CCCCCCCCCCCCCCC
Q ss_conf             78388887547898040-014433420012112
Q gi|254780266|r   86 GRVKDLPGVKYRVIRGV-LDAQGVKNRKQARSR  117 (124)
Q Consensus        86 Grv~DlPGVry~ivRG~-~D~~gv~~Rk~~RSk  117 (124)
                      |+++|||||+|++|||. +++..+..++..+|+
T Consensus       110 g~~~DlPGVrykvvr~~~~~l~~l~~gkkekpr  142 (143)
T 2zkq_l          110 HAVGDIPGVRFKVVKVANVSLLALYKGKKERPR  142 (143)
T ss_dssp             CCBTTBTTCCEECCTTSTTSCSTTTTCCCCC--
T ss_pred             CCCCCCCCEEEEEEEECCCCHHHHHCCCCCCCC
T ss_conf             867889971389999648318988636343789