BLAST/PSIBLAST alignment of GI: 254780266 and GI: 23502115 at iteration 1
>gi|23502115|ref|NP_698242.1| 30S ribosomal protein S12 [Brucella suis 1330] Length = 123
>gi|62290149|ref|YP_221942.1| 30S ribosomal protein S12 [Brucella abortus bv. 1 str. 9-941] Length = 123
>gi|82700072|ref|YP_414646.1| 30S ribosomal protein S12 [Brucella melitensis biovar Abortus 2308] Length = 123
>gi|148560102|ref|YP_001259158.1| 30S ribosomal protein S12 [Brucella ovis ATCC 25840] Length = 123
>gi|161511151|ref|NP_539669.2| 30S ribosomal protein S12 [Brucella melitensis bv. 1 str. 16M] Length = 123
>gi|161619194|ref|YP_001593081.1| 30S ribosomal protein S12 [Brucella canis ATCC 23365] Length = 123
>gi|163843504|ref|YP_001627908.1| 30S ribosomal protein S12 [Brucella suis ATCC 23445] Length = 123
>gi|189024387|ref|YP_001935155.1| Ribosomal protein S12 [Brucella abortus S19] Length = 123
>gi|225852735|ref|YP_002732968.1| 30S ribosomal protein S12 [Brucella melitensis ATCC 23457] Length = 123
>gi|254689457|ref|ZP_05152711.1| 30S ribosomal protein S12 [Brucella abortus bv. 6 str. 870] Length = 123
>gi|254693942|ref|ZP_05155770.1| 30S ribosomal protein S12 [Brucella abortus bv. 3 str. Tulya] Length = 123
>gi|254697592|ref|ZP_05159420.1| 30S ribosomal protein S12 [Brucella abortus bv. 2 str. 86/8/59] Length = 123
>gi|254701979|ref|ZP_05163807.1| 30S ribosomal protein S12 [Brucella suis bv. 5 str. 513] Length = 123
>gi|254704522|ref|ZP_05166350.1| 30S ribosomal protein S12 [Brucella suis bv. 3 str. 686] Length = 123
>gi|254706582|ref|ZP_05168410.1| 30S ribosomal protein S12 [Brucella pinnipedialis M163/99/10] Length = 123
>gi|254710308|ref|ZP_05172119.1| 30S ribosomal protein S12 [Brucella pinnipedialis B2/94] Length = 123
>gi|254714305|ref|ZP_05176116.1| 30S ribosomal protein S12 [Brucella ceti M644/93/1] Length = 123
>gi|254717742|ref|ZP_05179553.1| 30S ribosomal protein S12 [Brucella ceti M13/05/1] Length = 123
>gi|254719295|ref|ZP_05181106.1| 30S ribosomal protein S12 [Brucella sp. 83/13] Length = 123
>gi|254730486|ref|ZP_05189064.1| 30S ribosomal protein S12 [Brucella abortus bv. 4 str. 292] Length = 123
>gi|256031802|ref|ZP_05445416.1| 30S ribosomal protein S12 [Brucella pinnipedialis M292/94/1] Length = 123
>gi|256061319|ref|ZP_05451467.1| 30S ribosomal protein S12 [Brucella neotomae 5K33] Length = 123
>gi|256113795|ref|ZP_05454595.1| 30S ribosomal protein S12 [Brucella melitensis bv. 3 str. Ether] Length = 123
>gi|256257703|ref|ZP_05463239.1| 30S ribosomal protein S12 [Brucella abortus bv. 9 str. C68] Length = 123
>gi|256263776|ref|ZP_05466308.1| ribosomal protein S12 [Brucella melitensis bv. 2 str. 63/9] Length = 123
>gi|256369662|ref|YP_003107172.1| 30S ribosomal protein S12 [Brucella microti CCM 4915] Length = 123
>gi|260168936|ref|ZP_05755747.1| 30S ribosomal protein S12 [Brucella sp. F5/99] Length = 123
>gi|260546696|ref|ZP_05822435.1| ribosomal protein S12 [Brucella abortus NCTC 8038] Length = 123
>gi|260565511|ref|ZP_05835995.1| 30S ribosomal protein S12 [Brucella melitensis bv. 1 str. 16M] Length = 123
>gi|260566234|ref|ZP_05836704.1| ribosomal protein S12 [Brucella suis bv. 4 str. 40] Length = 123
>gi|260754980|ref|ZP_05867328.1| 30S ribosomal protein S12 [Brucella abortus bv. 6 str. 870] Length = 123
>gi|260758196|ref|ZP_05870544.1| 30S ribosomal protein S12 [Brucella abortus bv. 4 str. 292] Length = 123
>gi|260762022|ref|ZP_05874365.1| 30S ribosomal protein S12 [Brucella abortus bv. 2 str. 86/8/59] Length = 123
>gi|260883989|ref|ZP_05895603.1| 30S ribosomal protein S12 [Brucella abortus bv. 9 str. C68] Length = 123
>gi|261214234|ref|ZP_05928515.1| 30S ribosomal protein S12 [Brucella abortus bv. 3 str. Tulya] Length = 123
>gi|261219585|ref|ZP_05933866.1| 30S ribosomal protein S12 [Brucella ceti M13/05/1] Length = 123
>gi|261314042|ref|ZP_05953239.1| 30S ribosomal protein S12 [Brucella pinnipedialis M163/99/10] Length = 123
>gi|261317871|ref|ZP_05957068.1| 30S ribosomal protein S12 [Brucella pinnipedialis B2/94] Length = 123
>gi|261322080|ref|ZP_05961277.1| 30S ribosomal protein S12 [Brucella ceti M644/93/1] Length = 123
>gi|261325324|ref|ZP_05964521.1| 30S ribosomal protein S12 [Brucella neotomae 5K33] Length = 123
>gi|261752546|ref|ZP_05996255.1| 30S ribosomal protein S12 [Brucella suis bv. 5 str. 513] Length = 123
>gi|261755205|ref|ZP_05998914.1| 30S ribosomal protein S12 [Brucella suis bv. 3 str. 686] Length = 123
>gi|261758429|ref|ZP_06002138.1| ribosomal protein S12 [Brucella sp. F5/99] Length = 123
>gi|265984295|ref|ZP_06097030.1| 30S ribosomal protein S12 [Brucella sp. 83/13] Length = 123
>gi|265988900|ref|ZP_06101457.1| 30S ribosomal protein S12 [Brucella pinnipedialis M292/94/1] Length = 123
>gi|265995151|ref|ZP_06107708.1| 30S ribosomal protein S12 [Brucella melitensis bv. 3 str. Ether] Length = 123
>gi|294852576|ref|ZP_06793249.1| 30S ribosomal protein S12 [Brucella sp. NVSL 07-0026] Length = 123
>gi|297248545|ref|ZP_06932263.1| 30S ribosomal protein S12 [Brucella abortus bv. 5 str. B3196] Length = 123
>gi|306838937|ref|ZP_07471762.1| ribosomal protein S12 [Brucella sp. NF 2653] Length = 123
>gi|306840296|ref|ZP_07473069.1| ribosomal protein S12 [Brucella sp. BO2] Length = 123
>gi|306844142|ref|ZP_07476736.1| ribosomal protein S12 [Brucella sp. BO1] Length = 123
>gi|52783783|sp|P63194|RS12_BRUSU RecName: Full=30S ribosomal protein S12 Length = 123
>gi|52783790|sp|Q8GH23|RS12_BRUME RecName: Full=30S ribosomal protein S12 Length = 123
>gi|75496679|sp|Q57CQ3|RS12_BRUAB RecName: Full=30S ribosomal protein S12 Length = 123
>gi|90111769|sp|Q2YLZ8|RS12_BRUA2 RecName: Full=30S ribosomal protein S12 Length = 123
>gi|166231847|sp|A5VR11|RS12_BRUO2 RecName: Full=30S ribosomal protein S12 Length = 123
>gi|189040447|sp|A9M5Q5|RS12_BRUC2 RecName: Full=30S ribosomal protein S12 Length = 123
>gi|189040448|sp|B0CH37|RS12_BRUSI RecName: Full=30S ribosomal protein S12 Length = 123
>gi|226708468|sp|B2S684|RS12_BRUA1 RecName: Full=30S ribosomal protein S12 Length = 123
>gi|254811072|sp|C0RJK6|RS12_BRUMB RecName: Full=30S ribosomal protein S12 Length = 123
>gi|23348075|gb|AAN30157.1| ribosomal protein S12 [Brucella suis 1330] Length = 123
>gi|62196281|gb|AAX74581.1| RpsL, ribosomal protein S12 [Brucella abortus bv. 1 str. 9-941] Length = 123
>gi|82616173|emb|CAJ11216.1| Ribosomal protein S12, bacterial and chloroplast forms:Ribosomal protein S12/S23 [Brucella melitensis biovar Abortus 2308] Length = 123
>gi|148371359|gb|ABQ61338.1| ribosomal protein S12 [Brucella ovis ATCC 25840] Length = 123
>gi|161336005|gb|ABX62310.1| ribosomal protein S12 [Brucella canis ATCC 23365] Length = 123
>gi|163674227|gb|ABY38338.1| ribosomal protein S12 [Brucella suis ATCC 23445] Length = 123
>gi|189019959|gb|ACD72681.1| Ribosomal protein S12 [Brucella abortus S19] Length = 123
>gi|225641100|gb|ACO01014.1| ribosomal protein S12 [Brucella melitensis ATCC 23457] Length = 123
>gi|255999824|gb|ACU48223.1| 30S ribosomal protein S12 [Brucella microti CCM 4915] Length = 123
>gi|260095746|gb|EEW79623.1| ribosomal protein S12 [Brucella abortus NCTC 8038] Length = 123
>gi|260151579|gb|EEW86673.1| 30S ribosomal protein S12 [Brucella melitensis bv. 1 str. 16M] Length = 123
>gi|260155752|gb|EEW90832.1| ribosomal protein S12 [Brucella suis bv. 4 str. 40] Length = 123
>gi|260668514|gb|EEX55454.1| 30S ribosomal protein S12 [Brucella abortus bv. 4 str. 292] Length = 123
>gi|260672454|gb|EEX59275.1| 30S ribosomal protein S12 [Brucella abortus bv. 2 str. 86/8/59] Length = 123
>gi|260675088|gb|EEX61909.1| 30S ribosomal protein S12 [Brucella abortus bv. 6 str. 870] Length = 123
>gi|260873517|gb|EEX80586.1| 30S ribosomal protein S12 [Brucella abortus bv. 9 str. C68] Length = 123
>gi|260915841|gb|EEX82702.1| 30S ribosomal protein S12 [Brucella abortus bv. 3 str. Tulya] Length = 123
>gi|260924674|gb|EEX91242.1| 30S ribosomal protein S12 [Brucella ceti M13/05/1] Length = 123
>gi|261294770|gb|EEX98266.1| 30S ribosomal protein S12 [Brucella ceti M644/93/1] Length = 123
>gi|261297094|gb|EEY00591.1| 30S ribosomal protein S12 [Brucella pinnipedialis B2/94] Length = 123
>gi|261301304|gb|EEY04801.1| 30S ribosomal protein S12 [Brucella neotomae 5K33] Length = 123
>gi|261303068|gb|EEY06565.1| 30S ribosomal protein S12 [Brucella pinnipedialis M163/99/10] Length = 123
>gi|261738413|gb|EEY26409.1| ribosomal protein S12 [Brucella sp. F5/99] Length = 123
>gi|261742299|gb|EEY30225.1| 30S ribosomal protein S12 [Brucella suis bv. 5 str. 513] Length = 123
>gi|261744958|gb|EEY32884.1| 30S ribosomal protein S12 [Brucella suis bv. 3 str. 686] Length = 123
>gi|262766264|gb|EEZ12053.1| 30S ribosomal protein S12 [Brucella melitensis bv. 3 str. Ether] Length = 123
>gi|263093887|gb|EEZ17838.1| ribosomal protein S12 [Brucella melitensis bv. 2 str. 63/9] Length = 123
>gi|264661097|gb|EEZ31358.1| 30S ribosomal protein S12 [Brucella pinnipedialis M292/94/1] Length = 123
>gi|264662887|gb|EEZ33148.1| 30S ribosomal protein S12 [Brucella sp. 83/13] Length = 123
>gi|294821165|gb|EFG38164.1| 30S ribosomal protein S12 [Brucella sp. NVSL 07-0026] Length = 123
>gi|297175714|gb|EFH35061.1| 30S ribosomal protein S12 [Brucella abortus bv. 5 str. B3196] Length = 123
>gi|306275585|gb|EFM57317.1| ribosomal protein S12 [Brucella sp. BO1] Length = 123
>gi|306289751|gb|EFM60937.1| ribosomal protein S12 [Brucella sp. BO2] Length = 123
>gi|306405970|gb|EFM62224.1| ribosomal protein S12 [Brucella sp. NF 2653] Length = 123
Score = 192 bits (487), Expect = 2e-47, Method: Compositional matrix adjust.
Identities = 96/124 (77%), Positives = 105/124 (84%), Gaps = 1/124 (0%)
Query: 1 MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
MPTVNQLIRKPR + KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1 MPTVNQLIRKPRTAPVKR-NKVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59
Query: 61 GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 60 GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 119
Query: 121 ERPK 124
+RPK
Sbjct: 120 KRPK 123