BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780266|ref|YP_003064679.1| 30S ribosomal protein S12
[Candidatus Liberibacter asiaticus str. psy62]
         (124 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780266|ref|YP_003064679.1| 30S ribosomal protein S12 [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039943|gb|ACT56739.1| 30S ribosomal protein S12 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 124

 Score =  249 bits (635), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS
Sbjct: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA
Sbjct: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120

Query: 121 ERPK 124
           ERPK
Sbjct: 121 ERPK 124


>gi|315122824|ref|YP_004063313.1| 30S ribosomal protein S12 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496226|gb|ADR52825.1| 30S ribosomal protein S12 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 124

 Score =  215 bits (548), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 105/124 (84%), Positives = 112/124 (90%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPRK + R CAKVTALRG+PQKRGVCLRVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRKSAIRTCAKVTALRGSPQKRGVCLRVYTSTPKKPNSALRKVTKVRLTN 60

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PG GHNLQEHSVVMLCGGRVKDLPGVKYRV+RGVLD  GVK+RKQ+RSRYGA
Sbjct: 61  GAEVIGYIPGVGHNLQEHSVVMLCGGRVKDLPGVKYRVVRGVLDTAGVKDRKQSRSRYGA 120

Query: 121 ERPK 124
            RPK
Sbjct: 121 GRPK 124


>gi|225627708|ref|ZP_03785745.1| ribosomal protein S12 [Brucella ceti str. Cudo]
 gi|237815657|ref|ZP_04594654.1| ribosomal protein S12 [Brucella abortus str. 2308 A]
 gi|225617713|gb|EEH14758.1| ribosomal protein S12 [Brucella ceti str. Cudo]
 gi|237788955|gb|EEP63166.1| ribosomal protein S12 [Brucella abortus str. 2308 A]
          Length = 154

 Score =  193 bits (490), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 32  MPTVNQLIRKPRTAPVKRN-KVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 90

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 91  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 150

Query: 121 ERPK 124
           +RPK
Sbjct: 151 KRPK 154


>gi|190891350|ref|YP_001977892.1| 30S ribosomal protein S12 [Rhizobium etli CIAT 652]
 gi|209548930|ref|YP_002280847.1| 30S ribosomal protein S12 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|218461160|ref|ZP_03501251.1| 30S ribosomal protein S12 [Rhizobium etli Kim 5]
 gi|241204160|ref|YP_002975256.1| 30S ribosomal protein S12 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|226712639|sp|B3PW62|RS12_RHIE6 RecName: Full=30S ribosomal protein S12
 gi|226712640|sp|B5ZYT0|RS12_RHILW RecName: Full=30S ribosomal protein S12
 gi|190696629|gb|ACE90714.1| 30S ribosomal protein S12 [Rhizobium etli CIAT 652]
 gi|209534686|gb|ACI54621.1| ribosomal protein S12 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|240858050|gb|ACS55717.1| ribosomal protein S12 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|327194528|gb|EGE61386.1| 30S ribosomal protein S12 [Rhizobium etli CNPAF512]
          Length = 123

 Score =  192 bits (488), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR+ + +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRQANVKR-NKVPALQENPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|17982691|gb|AAL51933.1| ssu ribosomal protein s12p [Brucella melitensis bv. 1 str. 16M]
          Length = 134

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 12  MPTVNQLIRKPRTAPVKR-NKVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 70

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 71  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 130

Query: 121 ERPK 124
           +RPK
Sbjct: 131 KRPK 134


>gi|222148361|ref|YP_002549318.1| 30S ribosomal protein S12 [Agrobacterium vitis S4]
 gi|221735349|gb|ACM36312.1| 30S ribosomal protein S12 [Agrobacterium vitis S4]
          Length = 202

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR+   +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 80  MPTVNQLIRKPRQAQVKR-NKVPALQENPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTN 138

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 139 GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 198

Query: 121 ERPK 124
           +RPK
Sbjct: 199 KRPK 202


>gi|150396202|ref|YP_001326669.1| 30S ribosomal protein S12 [Sinorhizobium medicae WSM419]
 gi|159184987|ref|NP_354927.2| 30S ribosomal protein S12 [Agrobacterium tumefaciens str. C58]
 gi|222085671|ref|YP_002544201.1| ribosomal protein S12 [Agrobacterium radiobacter K84]
 gi|307314840|ref|ZP_07594433.1| ribosomal protein S12 [Sinorhizobium meliloti BL225C]
 gi|307322139|ref|ZP_07601513.1| ribosomal protein S12 [Sinorhizobium meliloti AK83]
 gi|22096128|sp|Q8UE13|RS12_AGRT5 RecName: Full=30S ribosomal protein S12
 gi|166231888|sp|A6U854|RS12_SINMW RecName: Full=30S ribosomal protein S12
 gi|254811060|sp|B9JDS4|RS12_AGRRK RecName: Full=30S ribosomal protein S12
 gi|150027717|gb|ABR59834.1| ribosomal protein S12 [Sinorhizobium medicae WSM419]
 gi|159140262|gb|AAK87712.2| 30S ribosomal protein S12 [Agrobacterium tumefaciens str. C58]
 gi|221723119|gb|ACM26275.1| ribosomal protein S12 [Agrobacterium radiobacter K84]
 gi|306892224|gb|EFN23036.1| ribosomal protein S12 [Sinorhizobium meliloti AK83]
 gi|306898954|gb|EFN29601.1| ribosomal protein S12 [Sinorhizobium meliloti BL225C]
          Length = 123

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR+   +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRQAQVKR-NKVPALQENPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|23502115|ref|NP_698242.1| 30S ribosomal protein S12 [Brucella suis 1330]
 gi|62290149|ref|YP_221942.1| 30S ribosomal protein S12 [Brucella abortus bv. 1 str. 9-941]
 gi|82700072|ref|YP_414646.1| 30S ribosomal protein S12 [Brucella melitensis biovar Abortus 2308]
 gi|148560102|ref|YP_001259158.1| 30S ribosomal protein S12 [Brucella ovis ATCC 25840]
 gi|161511151|ref|NP_539669.2| 30S ribosomal protein S12 [Brucella melitensis bv. 1 str. 16M]
 gi|161619194|ref|YP_001593081.1| 30S ribosomal protein S12 [Brucella canis ATCC 23365]
 gi|163843504|ref|YP_001627908.1| 30S ribosomal protein S12 [Brucella suis ATCC 23445]
 gi|189024387|ref|YP_001935155.1| Ribosomal protein S12 [Brucella abortus S19]
 gi|225852735|ref|YP_002732968.1| 30S ribosomal protein S12 [Brucella melitensis ATCC 23457]
 gi|254689457|ref|ZP_05152711.1| 30S ribosomal protein S12 [Brucella abortus bv. 6 str. 870]
 gi|254693942|ref|ZP_05155770.1| 30S ribosomal protein S12 [Brucella abortus bv. 3 str. Tulya]
 gi|254697592|ref|ZP_05159420.1| 30S ribosomal protein S12 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701979|ref|ZP_05163807.1| 30S ribosomal protein S12 [Brucella suis bv. 5 str. 513]
 gi|254704522|ref|ZP_05166350.1| 30S ribosomal protein S12 [Brucella suis bv. 3 str. 686]
 gi|254706582|ref|ZP_05168410.1| 30S ribosomal protein S12 [Brucella pinnipedialis M163/99/10]
 gi|254710308|ref|ZP_05172119.1| 30S ribosomal protein S12 [Brucella pinnipedialis B2/94]
 gi|254714305|ref|ZP_05176116.1| 30S ribosomal protein S12 [Brucella ceti M644/93/1]
 gi|254717742|ref|ZP_05179553.1| 30S ribosomal protein S12 [Brucella ceti M13/05/1]
 gi|254719295|ref|ZP_05181106.1| 30S ribosomal protein S12 [Brucella sp. 83/13]
 gi|254730486|ref|ZP_05189064.1| 30S ribosomal protein S12 [Brucella abortus bv. 4 str. 292]
 gi|256031802|ref|ZP_05445416.1| 30S ribosomal protein S12 [Brucella pinnipedialis M292/94/1]
 gi|256061319|ref|ZP_05451467.1| 30S ribosomal protein S12 [Brucella neotomae 5K33]
 gi|256113795|ref|ZP_05454595.1| 30S ribosomal protein S12 [Brucella melitensis bv. 3 str. Ether]
 gi|256257703|ref|ZP_05463239.1| 30S ribosomal protein S12 [Brucella abortus bv. 9 str. C68]
 gi|256263776|ref|ZP_05466308.1| ribosomal protein S12 [Brucella melitensis bv. 2 str. 63/9]
 gi|256369662|ref|YP_003107172.1| 30S ribosomal protein S12 [Brucella microti CCM 4915]
 gi|260168936|ref|ZP_05755747.1| 30S ribosomal protein S12 [Brucella sp. F5/99]
 gi|260546696|ref|ZP_05822435.1| ribosomal protein S12 [Brucella abortus NCTC 8038]
 gi|260565511|ref|ZP_05835995.1| 30S ribosomal protein S12 [Brucella melitensis bv. 1 str. 16M]
 gi|260566234|ref|ZP_05836704.1| ribosomal protein S12 [Brucella suis bv. 4 str. 40]
 gi|260754980|ref|ZP_05867328.1| 30S ribosomal protein S12 [Brucella abortus bv. 6 str. 870]
 gi|260758196|ref|ZP_05870544.1| 30S ribosomal protein S12 [Brucella abortus bv. 4 str. 292]
 gi|260762022|ref|ZP_05874365.1| 30S ribosomal protein S12 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883989|ref|ZP_05895603.1| 30S ribosomal protein S12 [Brucella abortus bv. 9 str. C68]
 gi|261214234|ref|ZP_05928515.1| 30S ribosomal protein S12 [Brucella abortus bv. 3 str. Tulya]
 gi|261219585|ref|ZP_05933866.1| 30S ribosomal protein S12 [Brucella ceti M13/05/1]
 gi|261314042|ref|ZP_05953239.1| 30S ribosomal protein S12 [Brucella pinnipedialis M163/99/10]
 gi|261317871|ref|ZP_05957068.1| 30S ribosomal protein S12 [Brucella pinnipedialis B2/94]
 gi|261322080|ref|ZP_05961277.1| 30S ribosomal protein S12 [Brucella ceti M644/93/1]
 gi|261325324|ref|ZP_05964521.1| 30S ribosomal protein S12 [Brucella neotomae 5K33]
 gi|261752546|ref|ZP_05996255.1| 30S ribosomal protein S12 [Brucella suis bv. 5 str. 513]
 gi|261755205|ref|ZP_05998914.1| 30S ribosomal protein S12 [Brucella suis bv. 3 str. 686]
 gi|261758429|ref|ZP_06002138.1| ribosomal protein S12 [Brucella sp. F5/99]
 gi|265984295|ref|ZP_06097030.1| 30S ribosomal protein S12 [Brucella sp. 83/13]
 gi|265988900|ref|ZP_06101457.1| 30S ribosomal protein S12 [Brucella pinnipedialis M292/94/1]
 gi|265995151|ref|ZP_06107708.1| 30S ribosomal protein S12 [Brucella melitensis bv. 3 str. Ether]
 gi|294852576|ref|ZP_06793249.1| 30S ribosomal protein S12 [Brucella sp. NVSL 07-0026]
 gi|297248545|ref|ZP_06932263.1| 30S ribosomal protein S12 [Brucella abortus bv. 5 str. B3196]
 gi|306838937|ref|ZP_07471762.1| ribosomal protein S12 [Brucella sp. NF 2653]
 gi|306840296|ref|ZP_07473069.1| ribosomal protein S12 [Brucella sp. BO2]
 gi|306844142|ref|ZP_07476736.1| ribosomal protein S12 [Brucella sp. BO1]
 gi|52783783|sp|P63194|RS12_BRUSU RecName: Full=30S ribosomal protein S12
 gi|52783790|sp|Q8GH23|RS12_BRUME RecName: Full=30S ribosomal protein S12
 gi|75496679|sp|Q57CQ3|RS12_BRUAB RecName: Full=30S ribosomal protein S12
 gi|90111769|sp|Q2YLZ8|RS12_BRUA2 RecName: Full=30S ribosomal protein S12
 gi|166231847|sp|A5VR11|RS12_BRUO2 RecName: Full=30S ribosomal protein S12
 gi|189040447|sp|A9M5Q5|RS12_BRUC2 RecName: Full=30S ribosomal protein S12
 gi|189040448|sp|B0CH37|RS12_BRUSI RecName: Full=30S ribosomal protein S12
 gi|226708468|sp|B2S684|RS12_BRUA1 RecName: Full=30S ribosomal protein S12
 gi|254811072|sp|C0RJK6|RS12_BRUMB RecName: Full=30S ribosomal protein S12
 gi|23348075|gb|AAN30157.1| ribosomal protein S12 [Brucella suis 1330]
 gi|62196281|gb|AAX74581.1| RpsL, ribosomal protein S12 [Brucella abortus bv. 1 str. 9-941]
 gi|82616173|emb|CAJ11216.1| Ribosomal protein S12, bacterial and chloroplast forms:Ribosomal
           protein S12/S23 [Brucella melitensis biovar Abortus
           2308]
 gi|148371359|gb|ABQ61338.1| ribosomal protein S12 [Brucella ovis ATCC 25840]
 gi|161336005|gb|ABX62310.1| ribosomal protein S12 [Brucella canis ATCC 23365]
 gi|163674227|gb|ABY38338.1| ribosomal protein S12 [Brucella suis ATCC 23445]
 gi|189019959|gb|ACD72681.1| Ribosomal protein S12 [Brucella abortus S19]
 gi|225641100|gb|ACO01014.1| ribosomal protein S12 [Brucella melitensis ATCC 23457]
 gi|255999824|gb|ACU48223.1| 30S ribosomal protein S12 [Brucella microti CCM 4915]
 gi|260095746|gb|EEW79623.1| ribosomal protein S12 [Brucella abortus NCTC 8038]
 gi|260151579|gb|EEW86673.1| 30S ribosomal protein S12 [Brucella melitensis bv. 1 str. 16M]
 gi|260155752|gb|EEW90832.1| ribosomal protein S12 [Brucella suis bv. 4 str. 40]
 gi|260668514|gb|EEX55454.1| 30S ribosomal protein S12 [Brucella abortus bv. 4 str. 292]
 gi|260672454|gb|EEX59275.1| 30S ribosomal protein S12 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675088|gb|EEX61909.1| 30S ribosomal protein S12 [Brucella abortus bv. 6 str. 870]
 gi|260873517|gb|EEX80586.1| 30S ribosomal protein S12 [Brucella abortus bv. 9 str. C68]
 gi|260915841|gb|EEX82702.1| 30S ribosomal protein S12 [Brucella abortus bv. 3 str. Tulya]
 gi|260924674|gb|EEX91242.1| 30S ribosomal protein S12 [Brucella ceti M13/05/1]
 gi|261294770|gb|EEX98266.1| 30S ribosomal protein S12 [Brucella ceti M644/93/1]
 gi|261297094|gb|EEY00591.1| 30S ribosomal protein S12 [Brucella pinnipedialis B2/94]
 gi|261301304|gb|EEY04801.1| 30S ribosomal protein S12 [Brucella neotomae 5K33]
 gi|261303068|gb|EEY06565.1| 30S ribosomal protein S12 [Brucella pinnipedialis M163/99/10]
 gi|261738413|gb|EEY26409.1| ribosomal protein S12 [Brucella sp. F5/99]
 gi|261742299|gb|EEY30225.1| 30S ribosomal protein S12 [Brucella suis bv. 5 str. 513]
 gi|261744958|gb|EEY32884.1| 30S ribosomal protein S12 [Brucella suis bv. 3 str. 686]
 gi|262766264|gb|EEZ12053.1| 30S ribosomal protein S12 [Brucella melitensis bv. 3 str. Ether]
 gi|263093887|gb|EEZ17838.1| ribosomal protein S12 [Brucella melitensis bv. 2 str. 63/9]
 gi|264661097|gb|EEZ31358.1| 30S ribosomal protein S12 [Brucella pinnipedialis M292/94/1]
 gi|264662887|gb|EEZ33148.1| 30S ribosomal protein S12 [Brucella sp. 83/13]
 gi|294821165|gb|EFG38164.1| 30S ribosomal protein S12 [Brucella sp. NVSL 07-0026]
 gi|297175714|gb|EFH35061.1| 30S ribosomal protein S12 [Brucella abortus bv. 5 str. B3196]
 gi|306275585|gb|EFM57317.1| ribosomal protein S12 [Brucella sp. BO1]
 gi|306289751|gb|EFM60937.1| ribosomal protein S12 [Brucella sp. BO2]
 gi|306405970|gb|EFM62224.1| ribosomal protein S12 [Brucella sp. NF 2653]
          Length = 123

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRTAPVKR-NKVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|298291433|ref|YP_003693372.1| ribosomal protein S12 [Starkeya novella DSM 506]
 gi|296927944|gb|ADH88753.1| ribosomal protein S12 [Starkeya novella DSM 506]
          Length = 123

 Score =  191 bits (486), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/124 (76%), Positives = 107/124 (86%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR+   RA  KV AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKPREAQ-RARNKVPALQASPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GYEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|256159975|ref|ZP_05457690.1| 30S ribosomal protein S12 [Brucella ceti M490/95/1]
 gi|256255203|ref|ZP_05460739.1| 30S ribosomal protein S12 [Brucella ceti B1/94]
 gi|261222399|ref|ZP_05936680.1| 30S ribosomal protein S12 [Brucella ceti B1/94]
 gi|265998364|ref|ZP_06110921.1| 30S ribosomal protein S12 [Brucella ceti M490/95/1]
 gi|260920983|gb|EEX87636.1| 30S ribosomal protein S12 [Brucella ceti B1/94]
 gi|262552832|gb|EEZ08822.1| 30S ribosomal protein S12 [Brucella ceti M490/95/1]
          Length = 123

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRTAPVKR-NKVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|86357300|ref|YP_469192.1| 30S ribosomal protein S12 [Rhizobium etli CFN 42]
 gi|116251535|ref|YP_767373.1| 30S ribosomal protein S12 [Rhizobium leguminosarum bv. viciae 3841]
 gi|119366794|sp|Q2K9M1|RS12_RHIEC RecName: Full=30S ribosomal protein S12
 gi|119366795|sp|Q1MIE6|RS12_RHIL3 RecName: Full=30S ribosomal protein S12
 gi|86281402|gb|ABC90465.1| 30S ribosomal protein S12 [Rhizobium etli CFN 42]
 gi|115256183|emb|CAK07264.1| putative 30S ribosomal protein S12 [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 123

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 95/124 (76%), Positives = 107/124 (86%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR+ + +   KV AL+ NPQKRGVC RVYT TP+KPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRQANVKR-NKVPALQENPQKRGVCTRVYTTTPRKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|239832127|ref|ZP_04680456.1| ribosomal protein S12 [Ochrobactrum intermedium LMG 3301]
 gi|239824394|gb|EEQ95962.1| ribosomal protein S12 [Ochrobactrum intermedium LMG 3301]
          Length = 154

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 32  MPTVNQLIRKPRIAPVKR-NKVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 90

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 91  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 150

Query: 121 ERPK 124
           +RPK
Sbjct: 151 KRPK 154


>gi|15965104|ref|NP_385457.1| 30S ribosomal protein S12 [Sinorhizobium meliloti 1021]
 gi|227821751|ref|YP_002825721.1| 30S ribosomal protein S12 [Sinorhizobium fredii NGR234]
 gi|20140129|sp|Q92QH4|RS12_RHIME RecName: Full=30S ribosomal protein S12
 gi|254811102|sp|C3MAX5|RS12_RHISN RecName: Full=30S ribosomal protein S12
 gi|15074284|emb|CAC45930.1| Probable 30S ribosomal protein S12 [Sinorhizobium meliloti 1021]
 gi|227340750|gb|ACP24968.1| 30S ribosomal protein S12 [Sinorhizobium fredii NGR234]
          Length = 123

 Score =  191 bits (484), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 95/124 (76%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR+   +   KV AL+ NPQKRGVC RVYT TP+KPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRQAQVKR-NKVPALQENPQKRGVCTRVYTTTPRKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|163759413|ref|ZP_02166499.1| 30S ribosomal protein S12 [Hoeflea phototrophica DFL-43]
 gi|162283817|gb|EDQ34102.1| 30S ribosomal protein S12 [Hoeflea phototrophica DFL-43]
          Length = 123

 Score =  191 bits (484), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR+   +   KV AL  NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRQAPVKR-NKVPALEQNPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y VIRGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GYEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHVIRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|49474409|ref|YP_032451.1| 30S ribosomal protein S12 [Bartonella quintana str. Toulouse]
 gi|52783354|sp|Q6FZB7|RS12_BARQU RecName: Full=30S ribosomal protein S12
 gi|49239913|emb|CAF26311.1| 30s ribosomal protein s12 [Bartonella quintana str. Toulouse]
          Length = 123

 Score =  191 bits (484), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTVNQLIRKPRVTPVKR-NKVPALQSNPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRG+LD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGLLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|153009281|ref|YP_001370496.1| 30S ribosomal protein S12 [Ochrobactrum anthropi ATCC 49188]
 gi|166231874|sp|A6X0B3|RS12_OCHA4 RecName: Full=30S ribosomal protein S12
 gi|151561169|gb|ABS14667.1| ribosomal protein S12 [Ochrobactrum anthropi ATCC 49188]
          Length = 123

 Score =  191 bits (484), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRIAPVKR-NKVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|319408770|emb|CBI82427.1| 30S ribosomal protein S12 [Bartonella schoenbuchensis R1]
          Length = 123

 Score =  189 bits (481), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 95/124 (76%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRVAPVKR-NKVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRG+LD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGLLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|49475799|ref|YP_033840.1| 30S ribosomal protein S12 [Bartonella henselae str. Houston-1]
 gi|27151676|sp|Q8KNX8|RS12_BARHE RecName: Full=30S ribosomal protein S12
 gi|22450089|emb|CAC51476.1| putative ribosomal protein S12 [Bartonella henselae str. Houston-1]
 gi|49238606|emb|CAF27847.1| 30S ribosomal protein s12 [Bartonella henselae str. Houston-1]
          Length = 123

 Score =  189 bits (481), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 95/124 (76%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRITPIKR-NKVPALQSNPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRG+LD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGLLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|304391448|ref|ZP_07373390.1| ribosomal protein S12 [Ahrensia sp. R2A130]
 gi|303295677|gb|EFL90035.1| ribosomal protein S12 [Ahrensia sp. R2A130]
          Length = 123

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R PRK   +  +KV A+  NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRNPRKAPIKR-SKVPAMEANPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|163868655|ref|YP_001609864.1| 30S ribosomal protein S12 [Bartonella tribocorum CIP 105476]
 gi|240850840|ref|YP_002972240.1| 30S ribosomal protein S12 [Bartonella grahamii as4aup]
 gi|189040446|sp|A9IW34|RS12_BART1 RecName: Full=30S ribosomal protein S12
 gi|161018311|emb|CAK01869.1| 30S ribosomal protein S12 [Bartonella tribocorum CIP 105476]
 gi|240267963|gb|ACS51551.1| 30S ribosomal protein S12 [Bartonella grahamii as4aup]
          Length = 123

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/124 (76%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRVAPVKR-NKVPALQSNPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRG+LD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGLLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|13470547|ref|NP_102115.1| 30S ribosomal protein S12 [Mesorhizobium loti MAFF303099]
 gi|260469677|ref|ZP_05813839.1| ribosomal protein S12 [Mesorhizobium opportunistum WSM2075]
 gi|319783315|ref|YP_004142791.1| ribosomal protein S12 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|20140189|sp|Q98N61|RS12_RHILO RecName: Full=30S ribosomal protein S12
 gi|14021288|dbj|BAB47901.1| 30S ribosomal protein S12 [Mesorhizobium loti MAFF303099]
 gi|259028536|gb|EEW29850.1| ribosomal protein S12 [Mesorhizobium opportunistum WSM2075]
 gi|317169203|gb|ADV12741.1| ribosomal protein S12 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 123

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/124 (76%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV A++ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRIAPVKR-NKVPAMQQNPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|304321435|ref|YP_003855078.1| 30S ribosomal protein S12 [Parvularcula bermudensis HTCC2503]
 gi|303300337|gb|ADM09936.1| 30S ribosomal protein S12 [Parvularcula bermudensis HTCC2503]
          Length = 123

 Score =  188 bits (478), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPRK   R   KV  L+GNPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTIQQLIRKPRKPK-RKINKVPHLQGNPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|256044887|ref|ZP_05447791.1| 30S ribosomal protein S12 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265991314|ref|ZP_06103871.1| 30S ribosomal protein S12 [Brucella melitensis bv. 1 str. Rev.1]
 gi|26006391|gb|AAN77280.1|AF448459_1 ribosomal protein S12 [Brucella melitensis]
 gi|263002098|gb|EEZ14673.1| 30S ribosomal protein S12 [Brucella melitensis bv. 1 str. Rev.1]
          Length = 123

 Score =  187 bits (476), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/124 (76%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRTAPVKR-NKVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDL GV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLLGVRYHIIRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|255019478|ref|ZP_05291574.1| SSU ribosomal protein S12p (S23e) [Acidithiobacillus caldus ATCC
           51756]
 gi|254971073|gb|EET28539.1| SSU ribosomal protein S12p (S23e) [Acidithiobacillus caldus ATCC
           51756]
          Length = 123

 Score =  187 bits (476), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPRK    A +KV AL  NPQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTLNQLVRKPRKAPT-AKSKVPALEANPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GVKNRKQARS+YGA
Sbjct: 60  GFEVSSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTAGVKNRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|158424183|ref|YP_001525475.1| 30S ribosomal protein S12 [Azorhizobium caulinodans ORS 571]
 gi|172047989|sp|A8IAT8|RS12_AZOC5 RecName: Full=30S ribosomal protein S12
 gi|158331072|dbj|BAF88557.1| ribosomal protein S12 [Azorhizobium caulinodans ORS 571]
          Length = 123

 Score =  187 bits (475), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR+   +A  K  AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKPREAQ-KARDKAPALQSSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  SYEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|319404430|emb|CBI78033.1| 30S ribosomal protein S12 [Bartonella rochalimae ATCC BAA-1498]
 gi|319407431|emb|CBI81082.1| 30S ribosomal protein S12 [Bartonella sp. 1-1C]
          Length = 123

 Score =  187 bits (475), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/124 (75%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRVVPVKR-NKVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RG+LD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIVRGLLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|154245618|ref|YP_001416576.1| 30S ribosomal protein S12 [Xanthobacter autotrophicus Py2]
 gi|226712673|sp|A7IFX6|RS12_XANP2 RecName: Full=30S ribosomal protein S12
 gi|154159703|gb|ABS66919.1| ribosomal protein S12 [Xanthobacter autotrophicus Py2]
          Length = 123

 Score =  187 bits (475), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR+   +A  K  AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKPREAQ-KARDKAPALQASPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  SYEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|325293341|ref|YP_004279205.1| 30S ribosomal protein S12 [Agrobacterium sp. H13-3]
 gi|325061194|gb|ADY64885.1| 30S ribosomal protein S12 [Agrobacterium sp. H13-3]
          Length = 123

 Score =  187 bits (475), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/124 (75%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR+   +   KV AL+ NPQKRGVC RVYT TP+KPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRQAQVKR-NKVPALQENPQKRGVCTRVYTTTPRKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEG NLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGRNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|319405903|emb|CBI79535.1| 30S ribosomal protein S12 [Bartonella sp. AR 15-3]
          Length = 123

 Score =  187 bits (474), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRVVPVKR-NKVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+I Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RG+LD QGVKNRKQ RS+YGA
Sbjct: 60  GFEIIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIVRGLLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|319899104|ref|YP_004159197.1| 30S ribosomal protein S12 [Bartonella clarridgeiae 73]
 gi|319403068|emb|CBI76623.1| 30S ribosomal protein S12 [Bartonella clarridgeiae 73]
          Length = 123

 Score =  186 bits (473), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/124 (75%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRVVPVKR-NKVPALQENPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RG+LD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIVRGLLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|121601641|ref|YP_988992.1| 30S ribosomal protein S12 [Bartonella bacilliformis KC583]
 gi|121602315|ref|YP_988962.1| 30S ribosomal protein S12 [Bartonella bacilliformis KC583]
 gi|158513081|sp|A1USK9|RS12_BARBK RecName: Full=30S ribosomal protein S12
 gi|120613818|gb|ABM44419.1| ribosomal protein S12 [Bartonella bacilliformis KC583]
 gi|120614492|gb|ABM45093.1| ribosomal protein S12 [Bartonella bacilliformis KC583]
          Length = 123

 Score =  186 bits (472), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/124 (75%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRVVPVKR-NKVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y +IRG+LD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVVIRGGRVKDLPGVRYHIIRGLLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|163851580|ref|YP_001639623.1| 30S ribosomal protein S12 [Methylobacterium extorquens PA1]
 gi|188581370|ref|YP_001924815.1| 30S ribosomal protein S12 [Methylobacterium populi BJ001]
 gi|218530389|ref|YP_002421205.1| 30S ribosomal protein S12 [Methylobacterium chloromethanicum CM4]
 gi|240138748|ref|YP_002963220.1| 30S ribosomal subunit protein S12 [Methylobacterium extorquens AM1]
 gi|254561348|ref|YP_003068443.1| 30S ribosomal subunit protein S12 [Methylobacterium extorquens DM4]
 gi|226712614|sp|A9W4P6|RS12_METEP RecName: Full=30S ribosomal protein S12
 gi|226712616|sp|B1ZLJ9|RS12_METPB RecName: Full=30S ribosomal protein S12
 gi|254811094|sp|B7L0Q6|RS12_METC4 RecName: Full=30S ribosomal protein S12
 gi|163663185|gb|ABY30552.1| ribosomal protein S12 [Methylobacterium extorquens PA1]
 gi|179344868|gb|ACB80280.1| ribosomal protein S12 [Methylobacterium populi BJ001]
 gi|218522692|gb|ACK83277.1| ribosomal protein S12 [Methylobacterium chloromethanicum CM4]
 gi|240008717|gb|ACS39943.1| 30S ribosomal subunit protein S12 [Methylobacterium extorquens AM1]
 gi|254268626|emb|CAX24585.1| 30S ribosomal subunit protein S12 [Methylobacterium extorquens DM4]
          Length = 123

 Score =  185 bits (470), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI +PRK   +A  KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIAQPRKAQ-KARNKVPALNACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|299135262|ref|ZP_07028453.1| ribosomal protein S12 [Afipia sp. 1NLS2]
 gi|298590239|gb|EFI50443.1| ribosomal protein S12 [Afipia sp. 1NLS2]
          Length = 123

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI  PR+   ++  KV AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIANPREAQ-KSRKKVPALQQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|307946281|ref|ZP_07661616.1| ribosomal protein S12 [Roseibium sp. TrichSKD4]
 gi|307769945|gb|EFO29171.1| ribosomal protein S12 [Roseibium sp. TrichSKD4]
          Length = 165

 Score =  185 bits (469), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPRK   +   KV A+   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 43  MPTINQLIRKPRKVPAKR-NKVPAMEACPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTN 101

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVK+RKQ RS+YGA
Sbjct: 102 GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKDRKQRRSKYGA 161

Query: 121 ERPK 124
           +RPK
Sbjct: 162 KRPK 165


>gi|328543353|ref|YP_004303462.1| 30S ribosomal protein S12 [Polymorphum gilvum SL003B-26A1]
 gi|326413097|gb|ADZ70160.1| 30S ribosomal protein S12 [Polymorphum gilvum SL003B-26A1]
          Length = 123

 Score =  185 bits (469), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPRK   +   KV A+   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKPRKDPPKR-NKVPAMEACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|198282632|ref|YP_002218953.1| 30S ribosomal protein S12 [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218665629|ref|YP_002424825.1| ribosomal protein S12 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226708447|sp|B7J462|RS12_ACIF2 RecName: Full=30S ribosomal protein S12
 gi|226708448|sp|B5ELX4|RS12_ACIF5 RecName: Full=30S ribosomal protein S12
 gi|198247153|gb|ACH82746.1| ribosomal protein S12 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218517842|gb|ACK78428.1| ribosomal protein S12 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 123

 Score =  185 bits (469), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/124 (72%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPRK    A +KV AL  NPQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTLNQLVRKPRKRPV-AKSKVPALDANPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GVKNRKQ+RS+YGA
Sbjct: 60  GFEVSSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTAGVKNRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|118591189|ref|ZP_01548588.1| 30S ribosomal protein S12 [Stappia aggregata IAM 12614]
 gi|118436265|gb|EAV42907.1| 30S ribosomal protein S12 [Stappia aggregata IAM 12614]
          Length = 123

 Score =  184 bits (468), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPRK   +   KV A+   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKPRKDPPKR-NKVPAMEACPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|120402290|ref|YP_952119.1| 30S ribosomal protein S12 [Mycobacterium vanbaalenii PYR-1]
 gi|161898737|ref|YP_001136332.2| 30S ribosomal protein S12 [Mycobacterium gilvum PYR-GCK]
 gi|169630930|ref|YP_001704579.1| 30S ribosomal protein S12 [Mycobacterium abscessus ATCC 19977]
 gi|315446006|ref|YP_004078885.1| 30S ribosomal protein S12P [Mycobacterium sp. Spyr1]
 gi|158513009|sp|A1T4L3|RS12_MYCVP RecName: Full=30S ribosomal protein S12
 gi|226712620|sp|B1MGI0|RS12_MYCA9 RecName: Full=30S ribosomal protein S12
 gi|119955108|gb|ABM12113.1| SSU ribosomal protein S12P [Mycobacterium vanbaalenii PYR-1]
 gi|169242897|emb|CAM63925.1| 30S ribosomal protein S12 [Mycobacterium abscessus]
 gi|315264309|gb|ADU01051.1| SSU ribosomal protein S12P [Mycobacterium sp. Spyr1]
          Length = 124

 Score =  184 bits (468), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTINQLVRKGRRDKI-AKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  AVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|114704479|ref|ZP_01437387.1| Ribosomal protein S12, bacterial and chloroplast forms:Ribosomal
           protein S12/S23 [Fulvimarina pelagi HTCC2506]
 gi|114539264|gb|EAU42384.1| Ribosomal protein S12, bacterial and chloroplast forms:Ribosomal
           protein S12/S23 [Fulvimarina pelagi HTCC2506]
          Length = 123

 Score =  184 bits (468), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/126 (74%), Positives = 103/126 (81%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAK--VTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           MPT+NQLIRKPR    R   +  V AL  NPQKRGVC RVYT TPKKPNSALRKV K RL
Sbjct: 1   MPTINQLIRKPR---IRPAERNTVPALEANPQKRGVCTRVYTTTPKKPNSALRKVAKVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
            +G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+Y
Sbjct: 58  VNGYEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKY 117

Query: 119 GAERPK 124
           GA+RPK
Sbjct: 118 GAKRPK 123


>gi|23011450|ref|ZP_00051805.1| COG0048: Ribosomal protein S12 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 123

 Score =  184 bits (468), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI +PR+   +A  KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIAQPRRAQ-KARNKVPALNACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|27380516|ref|NP_772045.1| 30S ribosomal protein S12 [Bradyrhizobium japonicum USDA 110]
 gi|52783407|sp|Q89J79|RS12_BRAJA RecName: Full=30S ribosomal protein S12
 gi|27353680|dbj|BAC50670.1| 30S ribosomal protein S12 [Bradyrhizobium japonicum USDA 110]
          Length = 123

 Score =  184 bits (467), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI +PR+   ++  KV AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIAQPREVQ-KSRKKVPALQQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|237786409|ref|YP_002907114.1| 30S ribosomal protein S12 [Corynebacterium kroppenstedtii DSM
           44385]
 gi|259494644|sp|C4LL66|RS12_CORK4 RecName: Full=30S ribosomal protein S12
 gi|237759321|gb|ACR18571.1| 30S ribosomal protein S12 [Corynebacterium kroppenstedtii DSM
           44385]
          Length = 123

 Score =  184 bits (467), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK RK   +A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRKDK-KAKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+YR+IRG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYRIIRGSLDTQGVKDRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|110634035|ref|YP_674243.1| 30S ribosomal protein S12 [Mesorhizobium sp. BNC1]
 gi|119366784|sp|Q11HP7|RS12_MESSB RecName: Full=30S ribosomal protein S12
 gi|110285019|gb|ABG63078.1| SSU ribosomal protein S12P [Chelativorans sp. BNC1]
          Length = 123

 Score =  184 bits (467), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLI KPRK   +   KV A+  NPQKRGVC RVYT +PKKPNSA+RKV K RL +
Sbjct: 1   MPTVNQLIAKPRKAPVKR-NKVPAMEANPQKRGVCTRVYTTSPKKPNSAMRKVAKIRLAN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKSRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|54027052|ref|YP_121294.1| 30S ribosomal protein S12 [Nocardia farcinica IFM 10152]
 gi|60390779|sp|Q5YPG1|RS12_NOCFA RecName: Full=30S ribosomal protein S12
 gi|54018560|dbj|BAD59930.1| putative ribosomal protein S12 [Nocardia farcinica IFM 10152]
          Length = 124

 Score =  184 bits (467), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTINQLVRKGRRDKV-AKTKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|209884808|ref|YP_002288665.1| ribosomal protein S12 [Oligotropha carboxidovorans OM5]
 gi|226712625|sp|B6JES8|RS12_OLICO RecName: Full=30S ribosomal protein S12
 gi|209873004|gb|ACI92800.1| ribosomal protein S12 [Oligotropha carboxidovorans OM5]
          Length = 123

 Score =  184 bits (466), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI KPR    ++  KV AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIAKPRVLQ-KSRKKVPALQQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|146192858|emb|CAL76863.1| 30S ribosomal subunit protein S12 [Bradyrhizobium sp. ORS278]
          Length = 130

 Score =  184 bits (466), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI  PR+   ++  KV AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 8   MPTINQLIANPREVQ-KSRKKVPALQQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 66

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 67  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 126

Query: 121 ERPK 124
           +RPK
Sbjct: 127 KRPK 130


>gi|170748631|ref|YP_001754891.1| 30S ribosomal protein S12 [Methylobacterium radiotolerans JCM 2831]
 gi|226712617|sp|B1LWS1|RS12_METRJ RecName: Full=30S ribosomal protein S12
 gi|170655153|gb|ACB24208.1| ribosomal protein S12 [Methylobacterium radiotolerans JCM 2831]
          Length = 123

 Score =  184 bits (466), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI +PRK   R+  KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIAQPRKIQ-RSRNKVPALDACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|315497966|ref|YP_004086770.1| ribosomal protein s12 [Asticcacaulis excentricus CB 48]
 gi|315415978|gb|ADU12619.1| ribosomal protein S12 [Asticcacaulis excentricus CB 48]
          Length = 123

 Score =  184 bits (466), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPRK + +   KV AL+G+PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLIRKPRKPNPKR-NKVPALKGSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+E + Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS YGA
Sbjct: 60  GIESVCYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSHYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|312140980|ref|YP_004008316.1| 30S ribosomal protein s12 rpsl [Rhodococcus equi 103S]
 gi|325675383|ref|ZP_08155067.1| 30S ribosomal protein S12 [Rhodococcus equi ATCC 33707]
 gi|311890319|emb|CBH49637.1| 30S ribosomal protein S12 RpsL [Rhodococcus equi 103S]
 gi|325553354|gb|EGD23032.1| 30S ribosomal protein S12 [Rhodococcus equi ATCC 33707]
          Length = 124

 Score =  183 bits (465), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTINQLVRKGRRDKA-AKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  SVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|326384202|ref|ZP_08205884.1| 30S ribosomal protein S12 [Gordonia neofelifaecis NRRL B-59395]
 gi|326197067|gb|EGD54259.1| 30S ribosomal protein S12 [Gordonia neofelifaecis NRRL B-59395]
          Length = 123

 Score =  183 bits (465), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 89/122 (72%), Positives = 104/122 (85%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R     A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTINQLVRKGRTDKTSA-KKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+YR+IRG LD QGVK+RKQARSRYGA
Sbjct: 60  GVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYRIIRGSLDTQGVKDRKQARSRYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|148256397|ref|YP_001240982.1| 30S ribosomal protein S12 [Bradyrhizobium sp. BTAi1]
 gi|161353768|ref|YP_001205100.2| 30S ribosomal protein S12 [Bradyrhizobium sp. ORS278]
 gi|158513288|sp|A5ELN2|RS12_BRASB RecName: Full=30S ribosomal protein S12
 gi|158514335|sp|A4YSI7|RS12_BRASO RecName: Full=30S ribosomal protein S12
 gi|146408570|gb|ABQ37076.1| SSU ribosomal protein S12P [Bradyrhizobium sp. BTAi1]
          Length = 123

 Score =  183 bits (465), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI  PR+   ++  KV AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIANPREVQ-KSRKKVPALQQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|90417768|ref|ZP_01225680.1| ribosomal protein S12 [Aurantimonas manganoxydans SI85-9A1]
 gi|90337440|gb|EAS51091.1| ribosomal protein S12 [Aurantimonas manganoxydans SI85-9A1]
          Length = 123

 Score =  183 bits (465), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/126 (73%), Positives = 103/126 (81%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAK--VTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           MPT+NQL+RKPR    R   +  V AL  NPQKRGVC RVYT TPKKPNSALRKV K RL
Sbjct: 1   MPTINQLVRKPR---VRPTERNTVPALEANPQKRGVCTRVYTTTPKKPNSALRKVAKVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
            +G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVKNRKQ RS+Y
Sbjct: 58  VNGYEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKY 117

Query: 119 GAERPK 124
           GA+RPK
Sbjct: 118 GAKRPK 123


>gi|256380603|ref|YP_003104263.1| 30S ribosomal protein S12 [Actinosynnema mirum DSM 43827]
 gi|255924906|gb|ACU40417.1| ribosomal protein S12 [Actinosynnema mirum DSM 43827]
          Length = 124

 Score =  183 bits (465), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRQDKV-AKQKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|296141146|ref|YP_003648389.1| ribosomal protein S12 [Tsukamurella paurometabola DSM 20162]
 gi|296029280|gb|ADG80050.1| ribosomal protein S12 [Tsukamurella paurometabola DSM 20162]
          Length = 124

 Score =  183 bits (464), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+    +  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTINQLVRKGRRDKA-SKTKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  SVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|319948729|ref|ZP_08022850.1| 30S ribosomal protein S12 [Dietzia cinnamea P4]
 gi|319437631|gb|EFV92630.1| 30S ribosomal protein S12 [Dietzia cinnamea P4]
          Length = 123

 Score =  183 bits (464), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   ++     AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTINQLVRKGRQDK-KSATSTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK+RKQARSRYGA
Sbjct: 60  GVEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKDRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|83594025|ref|YP_427777.1| 30S ribosomal protein S12 [Rhodospirillum rubrum ATCC 11170]
 gi|118597394|sp|Q2RQV5|RS12_RHORT RecName: Full=30S ribosomal protein S12
 gi|83576939|gb|ABC23490.1| SSU ribosomal protein S12P [Rhodospirillum rubrum ATCC 11170]
          Length = 123

 Score =  183 bits (464), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 90/124 (72%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPRK   +   KV A++  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKPRKAVVKR-NKVPAMQACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVK+R+Q RS+YGA
Sbjct: 60  GFEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKDRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|148554279|ref|YP_001261861.1| 30S ribosomal protein S12 [Sphingomonas wittichii RW1]
 gi|166231889|sp|A5V607|RS12_SPHWW RecName: Full=30S ribosomal protein S12
 gi|148499469|gb|ABQ67723.1| SSU ribosomal protein S12P [Sphingomonas wittichii RW1]
          Length = 123

 Score =  183 bits (464), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 90/124 (72%), Positives = 107/124 (86%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R+   +A +KV A+  NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKGREPQ-KAKSKVPAMEKNPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+PGEGHNLQEHSVV++ GGRV+DLPGV+Y V+RGVLD QGVK+RKQ+RS+YGA
Sbjct: 60  SREVISYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDTQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|254470481|ref|ZP_05083885.1| ribosomal protein S12 [Pseudovibrio sp. JE062]
 gi|211960792|gb|EEA95988.1| ribosomal protein S12 [Pseudovibrio sp. JE062]
          Length = 123

 Score =  182 bits (463), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR+   +   KV A+   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKPRQVPAKR-NKVPAMEACPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|288818169|ref|YP_003432517.1| ribosomal protein S12 [Hydrogenobacter thermophilus TK-6]
 gi|288787569|dbj|BAI69316.1| ribosomal protein S12 [Hydrogenobacter thermophilus TK-6]
 gi|308751770|gb|ADO45253.1| ribosomal protein S12 [Hydrogenobacter thermophilus TK-6]
          Length = 131

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 108/124 (87%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R+   R  +K  AL+GNPQKRGVC+RVYTVTPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLVRQGRE-QKRKKSKSPALQGNPQKRGVCVRVYTVTPKKPNSALRKVTRVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+VIRG LD  GV NR+Q+RS+YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKVIRGALDTAGVANRRQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|115519537|gb|ABJ07521.1| SSU ribosomal protein S12P [Rhodopseudomonas palustris BisA53]
          Length = 140

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI  PR    ++  KV AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 18  MPTINQLIANPRVVQ-KSRKKVPALQQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 76

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 77  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 136

Query: 121 ERPK 124
           +RPK
Sbjct: 137 KRPK 140


>gi|86749410|ref|YP_485906.1| 30S ribosomal protein S12 [Rhodopseudomonas palustris HaA2]
 gi|119366797|sp|Q2IXR5|RS12_RHOP2 RecName: Full=30S ribosomal protein S12
 gi|86572438|gb|ABD06995.1| SSU ribosomal protein S12P [Rhodopseudomonas palustris HaA2]
          Length = 123

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI +PR    ++  KV AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIARPRVVQ-KSRKKVPALQQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|220921894|ref|YP_002497195.1| 30S ribosomal protein S12 [Methylobacterium nodulans ORS 2060]
 gi|254811095|sp|B8IS80|RS12_METNO RecName: Full=30S ribosomal protein S12
 gi|219946500|gb|ACL56892.1| ribosomal protein S12 [Methylobacterium nodulans ORS 2060]
          Length = 123

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI  PRK   ++  KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIANPRKIQ-KSRNKVPALEACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|325000497|ref|ZP_08121609.1| 30S ribosomal protein S12 [Pseudonocardia sp. P1]
          Length = 124

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIQQLVRKGREDKV-AKTKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+VIRG LD QGVKNRKQ+RSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKVIRGSLDTQGVKNRKQSRSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|227487135|ref|ZP_03917451.1| ribosomal protein S12 [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227541698|ref|ZP_03971747.1| ribosomal protein S12 [Corynebacterium glucuronolyticum ATCC 51866]
 gi|227092793|gb|EEI28105.1| ribosomal protein S12 [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227182513|gb|EEI63485.1| ribosomal protein S12 [Corynebacterium glucuronolyticum ATCC 51866]
          Length = 123

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R  S ++  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRH-SKKSKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+YR+IRG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYRIIRGSLDTQGVKDRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|119867054|ref|YP_937006.1| 30S ribosomal protein S12 [Mycobacterium sp. KMS]
 gi|126433620|ref|YP_001069311.1| 30S ribosomal protein S12 [Mycobacterium sp. JLS]
 gi|161407225|ref|YP_638154.2| 30S ribosomal protein S12 [Mycobacterium sp. MCS]
 gi|119366787|sp|Q1BDD6|RS12_MYCSS RecName: Full=30S ribosomal protein S12
 gi|158513057|sp|A1UBK8|RS12_MYCSK RecName: Full=30S ribosomal protein S12
 gi|158513448|sp|A3PV93|RS12_MYCSJ RecName: Full=30S ribosomal protein S12
 gi|119693143|gb|ABL90216.1| SSU ribosomal protein S12P [Mycobacterium sp. KMS]
 gi|126233420|gb|ABN96820.1| SSU ribosomal protein S12P [Mycobacterium sp. JLS]
          Length = 124

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTINQLVRKGRRDKI-AKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|288957417|ref|YP_003447758.1| small subunit ribosomal protein S12 [Azospirillum sp. B510]
 gi|288909725|dbj|BAI71214.1| small subunit ribosomal protein S12 [Azospirillum sp. B510]
          Length = 123

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 90/124 (72%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR+    A  KV A+   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKPRE-PLAARNKVPAMEACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|170738708|ref|YP_001767363.1| 30S ribosomal protein S12 [Methylobacterium sp. 4-46]
 gi|226712618|sp|B0UHX4|RS12_METS4 RecName: Full=30S ribosomal protein S12
 gi|168192982|gb|ACA14929.1| ribosomal protein S12 [Methylobacterium sp. 4-46]
          Length = 123

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI  PRK   ++  KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIANPRKIQ-KSRNKVPALDACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|145218140|gb|ABP47544.1| SSU ribosomal protein S12P [Mycobacterium gilvum PYR-GCK]
          Length = 211

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 88  MPTINQLVRKGRRDKI-AKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 146

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 147 AVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 206

Query: 121 ERPK 124
           ++ K
Sbjct: 207 KKEK 210


>gi|90424942|ref|YP_533312.1| 30S ribosomal protein S12 [Rhodopseudomonas palustris BisB18]
 gi|119366798|sp|Q211E3|RS12_RHOPB RecName: Full=30S ribosomal protein S12
 gi|90106956|gb|ABD88993.1| SSU ribosomal protein S12P [Rhodopseudomonas palustris BisB18]
          Length = 123

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI  PR    ++  KV AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIASPRVVQ-KSRKKVPALQQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|75675551|ref|YP_317972.1| 30S ribosomal protein S12 [Nitrobacter winogradskyi Nb-255]
 gi|90111788|sp|Q3SSX1|RS12_NITWN RecName: Full=30S ribosomal protein S12
 gi|74420421|gb|ABA04620.1| SSU ribosomal protein S12P [Nitrobacter winogradskyi Nb-255]
          Length = 123

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI  PR    ++  KV AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIASPRVLQ-KSRKKVPALQQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|217976772|ref|YP_002360919.1| 30S ribosomal protein S12 [Methylocella silvestris BL2]
 gi|254811096|sp|B8ELG8|RS12_METSB RecName: Full=30S ribosomal protein S12
 gi|217502148|gb|ACK49557.1| ribosomal protein S12 [Methylocella silvestris BL2]
          Length = 123

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/125 (72%), Positives = 106/125 (84%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRKG-SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT++QLIRKPR+  ++R  A+   L  +PQKRGVC RVYT TPKKPNSALRKV K RLT
Sbjct: 1   MPTISQLIRKPRQEKTYREKAR--HLGASPQKRGVCTRVYTTTPKKPNSALRKVAKVRLT 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YG
Sbjct: 59  NGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYG 118

Query: 120 AERPK 124
           A+RPK
Sbjct: 119 AKRPK 123


>gi|85715136|ref|ZP_01046120.1| 30S ribosomal protein S12 [Nitrobacter sp. Nb-311A]
 gi|92117093|ref|YP_576822.1| 30S ribosomal protein S12 [Nitrobacter hamburgensis X14]
 gi|119366789|sp|Q1QN35|RS12_NITHX RecName: Full=30S ribosomal protein S12
 gi|85698051|gb|EAQ35924.1| 30S ribosomal protein S12 [Nitrobacter sp. Nb-311A]
 gi|91799987|gb|ABE62362.1| SSU ribosomal protein S12P [Nitrobacter hamburgensis X14]
          Length = 123

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI  PR    ++  KV AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIASPRVIQ-KSRKKVPALQQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|300782603|ref|YP_003762894.1| 30S ribosomal protein S12 [Amycolatopsis mediterranei U32]
 gi|302523988|ref|ZP_07276330.1| ribosomal protein S12 [Streptomyces sp. AA4]
 gi|299792117|gb|ADJ42492.1| small subunit ribosomal protein S12 [Amycolatopsis mediterranei
           U32]
 gi|302432883|gb|EFL04699.1| ribosomal protein S12 [Streptomyces sp. AA4]
          Length = 124

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRQDKA-AKQKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|332187788|ref|ZP_08389522.1| ribosomal protein S12 [Sphingomonas sp. S17]
 gi|332012138|gb|EGI54209.1| ribosomal protein S12 [Sphingomonas sp. S17]
          Length = 123

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 107/124 (86%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   +A +KV A+  NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRELQ-KAKSKVPAMEQNPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+PGEGHNLQEHSVV++ GGRV+DLPGV+Y V+RGVLD QGVK+RKQ+RS+YGA
Sbjct: 60  SREVISYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDTQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|39936318|ref|NP_948594.1| 30S ribosomal protein S12 [Rhodopseudomonas palustris CGA009]
 gi|91977657|ref|YP_570316.1| 30S ribosomal protein S12 [Rhodopseudomonas palustris BisB5]
 gi|162134980|ref|YP_782501.2| 30S ribosomal protein S12 [Rhodopseudomonas palustris BisA53]
 gi|192292042|ref|YP_001992647.1| 30S ribosomal protein S12 [Rhodopseudomonas palustris TIE-1]
 gi|316933522|ref|YP_004108504.1| 30S ribosomal protein S12 [Rhodopseudomonas palustris DX-1]
 gi|52783364|sp|Q6N4T2|RS12_RHOPA RecName: Full=30S ribosomal protein S12; AltName: Full=RRP-S12
 gi|119366799|sp|Q134S4|RS12_RHOPS RecName: Full=30S ribosomal protein S12
 gi|158564058|sp|Q07KL3|RS12_RHOP5 RecName: Full=30S ribosomal protein S12
 gi|226712642|sp|B3QBY5|RS12_RHOPT RecName: Full=30S ribosomal protein S12
 gi|39650173|emb|CAE28696.1| 30S ribosomal protein S12 [Rhodopseudomonas palustris CGA009]
 gi|91684113|gb|ABE40415.1| SSU ribosomal protein S12P [Rhodopseudomonas palustris BisB5]
 gi|192285791|gb|ACF02172.1| ribosomal protein S12 [Rhodopseudomonas palustris TIE-1]
 gi|315601236|gb|ADU43771.1| ribosomal protein S12 [Rhodopseudomonas palustris DX-1]
          Length = 123

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI  PR    ++  KV AL+ +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIANPRVVQ-KSRKKVPALQQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|87199265|ref|YP_496522.1| 30S ribosomal protein S12 [Novosphingobium aromaticivorans DSM
           12444]
 gi|110825783|sp|Q2G8Y5|RS12_NOVAD RecName: Full=30S ribosomal protein S12
 gi|87134946|gb|ABD25688.1| SSU ribosomal protein S12P [Novosphingobium aromaticivorans DSM
           12444]
          Length = 123

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 107/124 (86%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   +A +KV A+  NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGREPQ-KAKSKVPAMEQNPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+PGEGHNLQEHSVV++ GGRV+DLPGV+Y V+RGVLD QGVK+RKQ+RS+YGA
Sbjct: 60  SREVISYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDTQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|197104690|ref|YP_002130067.1| 30S ribosomal protein S12 [Phenylobacterium zucineum HLK1]
 gi|226712629|sp|B4R8L1|RS12_PHEZH RecName: Full=30S ribosomal protein S12
 gi|196478110|gb|ACG77638.1| 30S ribosomal protein S12 [Phenylobacterium zucineum HLK1]
          Length = 123

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR+ +  A  KV AL+G PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRQ-TKPARNKVPALKGCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+E + Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS YGA
Sbjct: 60  GIEAVCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSLYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|114570350|ref|YP_757030.1| 30S ribosomal protein S12 [Maricaulis maris MCS10]
 gi|119366783|sp|Q0ANP5|RS12_MARMM RecName: Full=30S ribosomal protein S12
 gi|114340812|gb|ABI66092.1| SSU ribosomal protein S12P [Maricaulis maris MCS10]
          Length = 123

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/124 (72%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPRK   +   KV AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKPRKDKPKR-NKVPALQACPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV++Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GHEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|108768376|gb|ABG07098.1| SSU ribosomal protein S12P [Mycobacterium sp. MCS]
          Length = 221

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 98  MPTINQLVRKGRRDKI-AKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 156

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 157 QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 216

Query: 121 ERPK 124
           ++ K
Sbjct: 217 KKEK 220


>gi|209964035|ref|YP_002296950.1| 30S ribosomal protein S12 [Rhodospirillum centenum SW]
 gi|226712641|sp|B6IRQ1|RS12_RHOCS RecName: Full=30S ribosomal protein S12
 gi|209957501|gb|ACI98137.1| ribosomal protein S12 [Rhodospirillum centenum SW]
          Length = 123

 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR     A  KV AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKPR-APLVARDKVPALQECPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRGVLD QGVK+R+Q RS YGA
Sbjct: 60  GYEVISYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKDRRQRRSLYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|83858571|ref|ZP_00952093.1| 30S ribosomal protein S12 [Oceanicaulis alexandrii HTCC2633]
 gi|83853394|gb|EAP91246.1| 30S ribosomal protein S12 [Oceanicaulis alexandrii HTCC2633]
          Length = 123

 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/124 (72%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPRK   +   KV AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRKDKPKR-NKVPALQACPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV++Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+R+Q RS+YGA
Sbjct: 60  GYEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|329851748|ref|ZP_08266429.1| ribosomal protein S12 [Asticcacaulis biprosthecum C19]
 gi|328839597|gb|EGF89170.1| ribosomal protein S12 [Asticcacaulis biprosthecum C19]
          Length = 123

 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR+   +   KV AL+G PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTVNQLIRKPRQPKPKR-NKVPALKGCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +E + Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS YGA
Sbjct: 60  QIEAVCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSHYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|144900879|emb|CAM77743.1| 30S ribosomal protein S12 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 123

 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/124 (72%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR+       KV AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKPRQ-PLATRNKVPALEACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|111018921|ref|YP_701893.1| 30S ribosomal protein S12 [Rhodococcus jostii RHA1]
 gi|226361021|ref|YP_002778799.1| 30S ribosomal protein S12 [Rhodococcus opacus B4]
 gi|119366800|sp|Q0SFF1|RS12_RHOSR RecName: Full=30S ribosomal protein S12
 gi|254811103|sp|C1AYS6|RS12_RHOOB RecName: Full=30S ribosomal protein S12
 gi|110818451|gb|ABG93735.1| 30S ribosomal protein S12 [Rhodococcus jostii RHA1]
 gi|226239506|dbj|BAH49854.1| 30S ribosomal protein S12 [Rhodococcus opacus B4]
          Length = 124

 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTINQLVRKGRRDKT-AKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK RKQARSRYGA
Sbjct: 60  SVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKGRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|134103269|ref|YP_001108930.1| 30S ribosomal protein S12 [Saccharopolyspora erythraea NRRL 2338]
 gi|291007938|ref|ZP_06565911.1| 30S ribosomal protein S12 [Saccharopolyspora erythraea NRRL 2338]
 gi|158513555|sp|A4FPN0|RS12_SACEN RecName: Full=30S ribosomal protein S12
 gi|133915892|emb|CAM06005.1| 30S ribosomal protein S12 [Saccharopolyspora erythraea NRRL 2338]
          Length = 124

 Score =  181 bits (460), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRQDKV-AKTKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG  D QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSADTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|85709064|ref|ZP_01040130.1| Ribosomal protein S12, bacterial and chloroplast form
           [Erythrobacter sp. NAP1]
 gi|85690598|gb|EAQ30601.1| Ribosomal protein S12, bacterial and chloroplast form
           [Erythrobacter sp. NAP1]
          Length = 123

 Score =  181 bits (458), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R    +A +KV A+  NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRTPQ-KAKSKVPAMEQNPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+PGEGHNLQEHSVV++ GGRV+DLPGV+Y V+RGVLD QGVK+RKQ+RS+YGA
Sbjct: 60  QREVISYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDTQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|149915839|ref|ZP_01904363.1| 30S ribosomal protein S12 [Roseobacter sp. AzwK-3b]
 gi|149810162|gb|EDM70008.1| 30S ribosomal protein S12 [Roseobacter sp. AzwK-3b]
          Length = 123

 Score =  181 bits (458), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   R+  K   L+G PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKVRS-QKSMHLQGCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|237654001|ref|YP_002890315.1| 30S ribosomal protein S12 [Thauera sp. MZ1T]
 gi|237625248|gb|ACR01938.1| ribosomal protein S12 [Thauera sp. MZ1T]
          Length = 125

 Score =  181 bits (458), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR+    A +KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRQLEV-AKSKVPALEACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|182678332|ref|YP_001832478.1| 30S ribosomal protein S12 [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|226708462|sp|B2IK57|RS12_BEII9 RecName: Full=30S ribosomal protein S12
 gi|182634215|gb|ACB94989.1| ribosomal protein S12 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 123

 Score =  180 bits (457), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 91/125 (72%), Positives = 105/125 (84%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPR-KGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT++QLIRKPR + ++R  A+   L   PQKRGVC RVYT TPKKPNSALRKV K RLT
Sbjct: 1   MPTISQLIRKPRHEKAYREKAR--HLEACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLT 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVKNRKQ RS+YG
Sbjct: 59  NGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYG 118

Query: 120 AERPK 124
           A+RPK
Sbjct: 119 AKRPK 123


>gi|83312234|ref|YP_422498.1| 30S ribosomal protein S12 [Magnetospirillum magneticum AMB-1]
 gi|115305658|sp|Q2W2I6|RS12_MAGMM RecName: Full=30S ribosomal protein S12
 gi|82947075|dbj|BAE51939.1| Ribosomal protein S12 [Magnetospirillum magneticum AMB-1]
          Length = 123

 Score =  180 bits (457), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR+    A  KV A+   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKPRQ-PVAARNKVPAMEACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD QGVK+R+Q RS+YGA
Sbjct: 60  GFEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTQGVKDRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|85703981|ref|ZP_01035084.1| ribosomal protein S12 [Roseovarius sp. 217]
 gi|149203506|ref|ZP_01880476.1| 30S ribosomal protein S12 [Roseovarius sp. TM1035]
 gi|85671301|gb|EAQ26159.1| ribosomal protein S12 [Roseovarius sp. 217]
 gi|149143339|gb|EDM31378.1| 30S ribosomal protein S12 [Roseovarius sp. TM1035]
          Length = 123

 Score =  180 bits (457), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   R   K   L+G PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKVRT-TKSQHLQGCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|118471302|ref|YP_885784.1| 30S ribosomal protein S12 [Mycobacterium smegmatis str. MC2 155]
 gi|296168534|ref|ZP_06850339.1| 30S ribosomal protein S12 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|152060834|sp|A0QS96|RS12_MYCS2 RecName: Full=30S ribosomal protein S12
 gi|152060835|sp|P0C563|RS12_MYCSM RecName: Full=30S ribosomal protein S12
 gi|511651|gb|AAA62390.1| ribosomal protein S12 [Mycobacterium smegmatis]
 gi|118172589|gb|ABK73485.1| ribosomal protein S12 [Mycobacterium smegmatis str. MC2 155]
 gi|295896676|gb|EFG76314.1| 30S ribosomal protein S12 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 124

 Score =  180 bits (457), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRRDKI-AKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|226305250|ref|YP_002765208.1| 30S ribosomal protein S12 [Rhodococcus erythropolis PR4]
 gi|229490576|ref|ZP_04384414.1| ribosomal protein S12 [Rhodococcus erythropolis SK121]
 gi|259494660|sp|C0ZVT4|RS12_RHOE4 RecName: Full=30S ribosomal protein S12
 gi|226184365|dbj|BAH32469.1| 30S ribosomal protein S12 [Rhodococcus erythropolis PR4]
 gi|229322396|gb|EEN88179.1| ribosomal protein S12 [Rhodococcus erythropolis SK121]
          Length = 124

 Score =  180 bits (457), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRRDKT-AKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK RKQARSRYGA
Sbjct: 60  SVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKGRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|262203669|ref|YP_003274877.1| 30S ribosomal protein S12 [Gordonia bronchialis DSM 43247]
 gi|262087016|gb|ACY22984.1| ribosomal protein S12 [Gordonia bronchialis DSM 43247]
          Length = 123

 Score =  180 bits (457), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R     A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTINQLVRKGRHDKA-AKTKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK+RKQARSRYGA
Sbjct: 60  SVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKDRKQARSRYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|302205488|gb|ADL09830.1| 30S ribosomal protein S12 [Corynebacterium pseudotuberculosis C231]
 gi|308275724|gb|ADO25623.1| 30S ribosomal protein S12 [Corynebacterium pseudotuberculosis I19]
          Length = 128

 Score =  180 bits (456), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 106/126 (84%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVT--ALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           MPT+ QL+RK   G     AKV+  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL
Sbjct: 6   MPTIQQLVRK---GRHDKTAKVSTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRL 62

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           TSG+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK+RKQARSRY
Sbjct: 63  TSGIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGALDTQGVKDRKQARSRY 122

Query: 119 GAERPK 124
           GA++ K
Sbjct: 123 GAKKEK 128


>gi|241761055|ref|ZP_04759144.1| ribosomal protein S12 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260752979|ref|YP_003225872.1| 30S ribosomal protein S12 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|283856272|ref|YP_003377795.1| 30S ribosomal protein S12 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374674|gb|EER64135.1| ribosomal protein S12 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552342|gb|ACV75288.1| ribosomal protein S12 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|283775267|gb|ADB28961.1| ribosomal protein S12 [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 123

 Score =  180 bits (456), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   +  +KV A+  NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRQLQ-KERSKVPAMEANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+PGEGHNLQEHSVV++ GGRV+DLPGV+Y V+RGVLD QGVK+RKQ+RS+YGA
Sbjct: 60  QREVISYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDTQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|254822762|ref|ZP_05227763.1| 30S ribosomal protein S12 [Mycobacterium intracellulare ATCC 13950]
 gi|464704|sp|P33565|RS12_MYCIT RecName: Full=30S ribosomal protein S12
 gi|149995|gb|AAA25375.1| ribosomal protein S12 [Mycobacterium intracellulare]
          Length = 124

 Score =  180 bits (456), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRRDKV-AKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|256371210|ref|YP_003109034.1| ribosomal protein S12 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256007794|gb|ACU53361.1| ribosomal protein S12 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 123

 Score =  180 bits (456), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+   R   K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIAQLVRKGREAK-RTKTKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LDA GVKNRKQARSRYGA
Sbjct: 60  GVEVTAYIPGIGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGTLDAAGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KREK 123


>gi|85374471|ref|YP_458533.1| 30S ribosomal protein S12 [Erythrobacter litoralis HTCC2594]
 gi|149184306|ref|ZP_01862624.1| Ribosomal protein S12, bacterial and chloroplast form
           [Erythrobacter sp. SD-21]
 gi|123099510|sp|Q2N9A5|RS12_ERYLH RecName: Full=30S ribosomal protein S12
 gi|84787554|gb|ABC63736.1| Ribosomal protein S12, bacterial and chloroplast form
           [Erythrobacter litoralis HTCC2594]
 gi|148831626|gb|EDL50059.1| Ribosomal protein S12, bacterial and chloroplast form
           [Erythrobacter sp. SD-21]
          Length = 123

 Score =  180 bits (456), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R    +A +KV A+  NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRVPQ-KAKSKVPAMEQNPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+PGEGHNLQEHSVV++ GGRV+DLPGV+Y V+RGVLD QGVK+RKQ+RS+YGA
Sbjct: 60  QREVISYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDTQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|289608522|emb|CBI60576.1| unnamed protein product [Sordaria macrospora]
          Length = 123

 Score =  179 bits (455), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 107/124 (86%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   +A +KV A+  NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGREPQ-KAKSKVPAMDQNPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+PGEGHNLQEHSVV++ GGRV+DLPGV+Y V+RGVLD QGVK+R+Q+RS+YGA
Sbjct: 60  QREVISYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDTQGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|86605980|ref|YP_474743.1| 30S ribosomal protein S12 [Synechococcus sp. JA-3-3Ab]
 gi|110825785|sp|Q2JUX7|RS12_SYNJA RecName: Full=30S ribosomal protein S12
 gi|86554522|gb|ABC99480.1| ribosomal protein S12 [Synechococcus sp. JA-3-3Ab]
          Length = 135

 Score =  179 bits (455), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR+ RK + R   K  AL+G PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIREERKAAVRKT-KAPALKGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LDA GVK+RKQ RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDAAGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|227502637|ref|ZP_03932686.1| ribosomal protein S12 [Corynebacterium accolens ATCC 49725]
 gi|306835201|ref|ZP_07468236.1| 30S ribosomal protein S12 [Corynebacterium accolens ATCC 49726]
 gi|227076677|gb|EEI14640.1| ribosomal protein S12 [Corynebacterium accolens ATCC 49725]
 gi|304568922|gb|EFM44452.1| 30S ribosomal protein S12 [Corynebacterium accolens ATCC 49726]
          Length = 123

 Score =  179 bits (455), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+ + R      AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRQ-TKRKEVSTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LDAQGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDAQGVKDRKQARSRYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|225710342|gb|ACO11017.1| 30S ribosomal protein S12 [Caligus rogercresseyi]
          Length = 127

 Score =  179 bits (455), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQL+RK RK   +  +K  AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLVRKGRK-VIKLASKARALDSCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EVIAY+PGEGHNLQEHS+V++ GGR+KDLPGV+Y ++RG LD  GV +R+QARSRYGA
Sbjct: 60  GIEVIAYIPGEGHNLQEHSIVLVRGGRIKDLPGVRYTIVRGALDTAGVADRRQARSRYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|326332175|ref|ZP_08198455.1| ribosomal protein S12 [Nocardioidaceae bacterium Broad-1]
 gi|325949881|gb|EGD41941.1| ribosomal protein S12 [Nocardioidaceae bacterium Broad-1]
          Length = 123

 Score =  179 bits (455), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+      +K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTINQLVRKGREDKA-TKSKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  GVEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|195952638|ref|YP_002120928.1| 30S ribosomal protein S12 [Hydrogenobaculum sp. Y04AAS1]
 gi|226708513|sp|B4U739|RS12_HYDS0 RecName: Full=30S ribosomal protein S12
 gi|195932250|gb|ACG56950.1| ribosomal protein S12 [Hydrogenobaculum sp. Y04AAS1]
          Length = 135

 Score =  179 bits (455), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 107/124 (86%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLI++ R+   +  +K  AL+GNPQKRGVC+RVYTVTPKKPNSALRKV + RL++
Sbjct: 1   MPTVNQLIKEGRE-KIKKKSKAPALQGNPQKRGVCVRVYTVTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD  GV NR+Q+RS+YGA
Sbjct: 60  GIEVTCYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDTAGVANRRQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|15828007|ref|NP_302270.1| 30S ribosomal protein S12 [Mycobacterium leprae TN]
 gi|221230484|ref|YP_002503900.1| 30S ribosomal protein S12 [Mycobacterium leprae Br4923]
 gi|13432233|sp|P30766|RS12_MYCLE RecName: Full=30S ribosomal protein S12
 gi|254811098|sp|B8ZSC4|RS12_MYCLB RecName: Full=30S ribosomal protein S12
 gi|511121|emb|CAA56423.1| S12 protein [Mycobacterium leprae]
 gi|511123|emb|CAA56425.1| S12 protein [Mycobacterium leprae]
 gi|13093560|emb|CAC30834.1| 30S ribosomal protein S12 [Mycobacterium leprae]
 gi|219933591|emb|CAR71976.1| 30S ribosomal protein S12 [Mycobacterium leprae Br4923]
          Length = 124

 Score =  179 bits (455), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL+GNPQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRRDKI-GKVKTAALKGNPQRRGVCTRVYTSTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|134096326|ref|YP_001101401.1| 30S ribosomal protein S12 [Herminiimonas arsenicoxydans]
 gi|152980527|ref|YP_001355106.1| 30S ribosomal protein S12 [Janthinobacterium sp. Marseille]
 gi|158513608|sp|A4G9U3|RS12_HERAR RecName: Full=30S ribosomal protein S12
 gi|166231865|sp|A6T3K9|RS12_JANMA RecName: Full=30S ribosomal protein S12
 gi|133740229|emb|CAL63280.1| 30S ribosomal subunit protein S12 [Herminiimonas arsenicoxydans]
 gi|151280604|gb|ABR89014.1| small subunit ribosomal protein S12 [Janthinobacterium sp.
           Marseille]
          Length = 127

 Score =  179 bits (455), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR+PR  S R  +K  AL  +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRQPRV-SARVKSKSPALENSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YG 
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGALDTQGVKDRKQARSKYGT 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|103488300|ref|YP_617861.1| 30S ribosomal protein S12 [Sphingopyxis alaskensis RB2256]
 gi|119366810|sp|Q1GP94|RS12_SPHAL RecName: Full=30S ribosomal protein S12
 gi|98978377|gb|ABF54528.1| SSU ribosomal protein S12P [Sphingopyxis alaskensis RB2256]
          Length = 123

 Score =  179 bits (455), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R    +  +KV A+  NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRTPQ-KVKSKVPAMDANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI Y+PGEGHNLQEHSVV++ GGRV+DLPGV+Y V+RGVLD QGVK+RKQ+RS+YGA
Sbjct: 60  AREVITYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDTQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|91774630|ref|YP_544386.1| 30S ribosomal protein S12 [Methylobacillus flagellatus KT]
 gi|119366786|sp|Q1H4P2|RS12_METFK RecName: Full=30S ribosomal protein S12
 gi|91708617|gb|ABE48545.1| SSU ribosomal protein S12P [Methylobacillus flagellatus KT]
          Length = 125

 Score =  179 bits (455), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 90/124 (72%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR+    A +KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRQKVV-AKSKVPALESCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD  GVK+RKQARS+YGA
Sbjct: 60  GYEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGSLDTAGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|71905956|ref|YP_283543.1| 30S ribosomal protein S12 [Dechloromonas aromatica RCB]
 gi|90111777|sp|Q47JA8|RS12_DECAR RecName: Full=30S ribosomal protein S12
 gi|71845577|gb|AAZ45073.1| SSU ribosomal protein S12P [Dechloromonas aromatica RCB]
          Length = 125

 Score =  179 bits (455), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR    +A +KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRVAE-KAKSKVPALEKCPQKRGVCTRVYTTTPKKPNSALRKVCKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|296282577|ref|ZP_06860575.1| 30S ribosomal protein S12 [Citromicrobium bathyomarinum JL354]
          Length = 123

 Score =  179 bits (455), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R    +  +KV A+  NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRTPQ-KTKSKVPAMEQNPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+PGEGHNLQEHSVV++ GGRV+DLPGV+Y V+RGVLD QGVK+RKQ+RS+YGA
Sbjct: 60  QREVISYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDTQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|254468985|ref|ZP_05082391.1| ribosomal protein S12 [beta proteobacterium KB13]
 gi|207087795|gb|EDZ65078.1| ribosomal protein S12 [beta proteobacterium KB13]
          Length = 125

 Score =  179 bits (455), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPRK      +KV AL  +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKPRK-RIVEKSKVPALEASPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RKQARS+YGA
Sbjct: 60  GYEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVNDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|300857749|ref|YP_003782732.1| 30S ribosomal protein S12 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|300685203|gb|ADK28125.1| 30S ribosomal protein S12 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302330043|gb|ADL20237.1| 30S ribosomal protein S12 [Corynebacterium pseudotuberculosis 1002]
          Length = 123

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 106/126 (84%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVT--ALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           MPT+ QL+RK   G     AKV+  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL
Sbjct: 1   MPTIQQLVRK---GRHDKTAKVSTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           TSG+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK+RKQARSRY
Sbjct: 58  TSGIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGALDTQGVKDRKQARSRY 117

Query: 119 GAERPK 124
           GA++ K
Sbjct: 118 GAKKEK 123


>gi|331000384|ref|ZP_08324064.1| ribosomal protein S12 [Parasutterella excrementihominis YIT 11859]
 gi|329572090|gb|EGG53759.1| ribosomal protein S12 [Parasutterella excrementihominis YIT 11859]
          Length = 161

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR+ +    +K  AL   PQKRGVC RVYT TP+KPNSALRKV K RLT+
Sbjct: 37  MPTINQLVRKPRERAIEK-SKSPALNNCPQKRGVCTRVYTTTPRKPNSALRKVAKVRLTN 95

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y V+RG LD QGVK+RKQ+RS+YGA
Sbjct: 96  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGSLDTQGVKDRKQSRSKYGA 155

Query: 121 ERPK 124
           +RPK
Sbjct: 156 KRPK 159


>gi|319944809|ref|ZP_08019072.1| 30S ribosomal protein S12 [Lautropia mirabilis ATCC 51599]
 gi|319741923|gb|EFV94347.1| 30S ribosomal protein S12 [Lautropia mirabilis ATCC 51599]
          Length = 126

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPRK +    +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRKSAV-VKSKSPALEDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|119899711|ref|YP_934924.1| 30S ribosomal protein S12 [Azoarcus sp. BH72]
 gi|158512918|sp|A1KB32|RS12_AZOSB RecName: Full=30S ribosomal protein S12
 gi|119672124|emb|CAL96038.1| 30S ribosomal protein S12 [Azoarcus sp. BH72]
          Length = 125

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR+      +KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRQMDV-VKSKVPALEACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|94496289|ref|ZP_01302867.1| ribosomal protein S12 [Sphingomonas sp. SKA58]
 gi|94424468|gb|EAT09491.1| ribosomal protein S12 [Sphingomonas sp. SKA58]
          Length = 123

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   +A +KV A+  NPQKRGVC RVYT TPKKPNSALRKV K RL +
Sbjct: 1   MPTINQLVRKGRELQ-KAKSKVPAMEANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI Y+PGEGHNLQEHSVV++ GGRV+DLPGV+Y V+RGVLD QGVK+RKQ+RS+YGA
Sbjct: 60  QREVITYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDTQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|167644767|ref|YP_001682430.1| 30S ribosomal protein S12 [Caulobacter sp. K31]
 gi|189040449|sp|B0SUQ4|RS12_CAUSK RecName: Full=30S ribosomal protein S12
 gi|167347197|gb|ABZ69932.1| ribosomal protein S12 [Caulobacter sp. K31]
          Length = 123

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/124 (72%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPR+       KV AL+G PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTVNQLIRKPRQPKP-VRNKVPALKGCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+E + Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS YGA
Sbjct: 60  GIEAVCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSLYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|21223040|ref|NP_628819.1| 30S ribosomal protein S12 [Streptomyces coelicolor A3(2)]
 gi|29831460|ref|NP_826094.1| 30S ribosomal protein S12 [Streptomyces avermitilis MA-4680]
 gi|182436639|ref|YP_001824358.1| 30S ribosomal protein S12 [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|239929526|ref|ZP_04686479.1| 30S ribosomal protein S12 [Streptomyces ghanaensis ATCC 14672]
 gi|239943569|ref|ZP_04695506.1| 30S ribosomal protein S12 [Streptomyces roseosporus NRRL 15998]
 gi|239980065|ref|ZP_04702589.1| 30S ribosomal protein S12 [Streptomyces albus J1074]
 gi|239990022|ref|ZP_04710686.1| 30S ribosomal protein S12 [Streptomyces roseosporus NRRL 11379]
 gi|254391402|ref|ZP_05006605.1| 30S ribosomal protein S12 [Streptomyces clavuligerus ATCC 27064]
 gi|282860800|ref|ZP_06269866.1| ribosomal protein S12 [Streptomyces sp. ACTE]
 gi|290958168|ref|YP_003489350.1| 30S ribosomal protein S12 [Streptomyces scabiei 87.22]
 gi|291437852|ref|ZP_06577242.1| 30S ribosomal protein S12 [Streptomyces ghanaensis ATCC 14672]
 gi|291447036|ref|ZP_06586426.1| ribosomal protein S12 [Streptomyces roseosporus NRRL 15998]
 gi|291451922|ref|ZP_06591312.1| ribosomal protein S12 [Streptomyces albus J1074]
 gi|294630874|ref|ZP_06709434.1| 30S ribosomal protein S12 [Streptomyces sp. e14]
 gi|294814461|ref|ZP_06773104.1| 30S ribosomal protein S12 [Streptomyces clavuligerus ATCC 27064]
 gi|297192712|ref|ZP_06910110.1| ribosomal protein S12 [Streptomyces pristinaespiralis ATCC 25486]
 gi|297201721|ref|ZP_06919118.1| ribosomal protein S12 [Streptomyces sviceus ATCC 29083]
 gi|302553525|ref|ZP_07305867.1| ribosomal protein S12 [Streptomyces viridochromogenes DSM 40736]
 gi|302559011|ref|ZP_07311353.1| 30S ribosomal protein S12 [Streptomyces griseoflavus Tu4000]
 gi|326442850|ref|ZP_08217584.1| 30S ribosomal protein S12 [Streptomyces clavuligerus ATCC 27064]
 gi|326777261|ref|ZP_08236526.1| ribosomal protein S12 [Streptomyces cf. griseus XylebKG-1]
 gi|329938248|ref|ZP_08287699.1| 30S ribosomal protein S12 [Streptomyces griseoaurantiacus M045]
 gi|61236792|sp|P0A4A3|RS12_STRCO RecName: Full=30S ribosomal protein S12
 gi|61236798|sp|P0A4A4|RS12_STRAW RecName: Full=30S ribosomal protein S12
 gi|61236802|sp|P0A4A5|RS12_STRLI RecName: Full=30S ribosomal protein S12
 gi|61236805|sp|P0A4A6|RS12_STRFL RecName: Full=30S ribosomal protein S12
 gi|226712655|sp|B1W419|RS12_STRGG RecName: Full=30S ribosomal protein S12
 gi|1685024|gb|AAC44743.1| ribosomal protein S12 [Streptomyces filamentosus]
 gi|1772348|dbj|BAA12096.1| ribosomal protein S12 [Streptomyces lividans]
 gi|7288055|emb|CAB81850.1| 30S ribosomal protein S12 [Streptomyces coelicolor A3(2)]
 gi|13989955|gb|AAK49775.1| ribosomal protein S12 [Streptomyces avermitilis]
 gi|29608575|dbj|BAC72629.1| putative ribosomal protein S12 [Streptomyces avermitilis MA-4680]
 gi|126506524|gb|ABO14701.1| streptomycin resistance protein [Cloning vector pLS205]
 gi|178465155|dbj|BAG19675.1| putative 30S ribosomal protein S12 [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|197705092|gb|EDY50904.1| 30S ribosomal protein S12 [Streptomyces clavuligerus ATCC 27064]
 gi|197710906|gb|EDY54940.1| ribosomal protein S12 [Streptomyces sviceus ATCC 29083]
 gi|197721634|gb|EDY65542.1| ribosomal protein S12 [Streptomyces pristinaespiralis ATCC 25486]
 gi|238626050|gb|ACR48329.1| Nos3 [Streptomyces actuosus]
 gi|260647694|emb|CBG70799.1| putative 30S ribosomal protein S12 [Streptomyces scabiei 87.22]
 gi|282564536|gb|EFB70072.1| ribosomal protein S12 [Streptomyces sp. ACTE]
 gi|291340747|gb|EFE67703.1| 30S ribosomal protein S12 [Streptomyces ghanaensis ATCC 14672]
 gi|291349983|gb|EFE76887.1| ribosomal protein S12 [Streptomyces roseosporus NRRL 15998]
 gi|291354871|gb|EFE81773.1| ribosomal protein S12 [Streptomyces albus J1074]
 gi|292834207|gb|EFF92556.1| 30S ribosomal protein S12 [Streptomyces sp. e14]
 gi|294327060|gb|EFG08703.1| 30S ribosomal protein S12 [Streptomyces clavuligerus ATCC 27064]
 gi|297159575|gb|ADI09287.1| 30S ribosomal protein S12 [Streptomyces bingchenggensis BCW-1]
 gi|302471143|gb|EFL34236.1| ribosomal protein S12 [Streptomyces viridochromogenes DSM 40736]
 gi|302476629|gb|EFL39722.1| 30S ribosomal protein S12 [Streptomyces griseoflavus Tu4000]
 gi|303274564|gb|ADM07450.1| ribosomal protein S12 [Streptomyces fradiae]
 gi|320009112|gb|ADW03962.1| ribosomal protein S12 [Streptomyces flavogriseus ATCC 33331]
 gi|326657594|gb|EGE42440.1| ribosomal protein S12 [Streptomyces cf. griseus XylebKG-1]
 gi|328884418|emb|CCA57657.1| SSU ribosomal protein S12p [Streptomyces venezuelae ATCC 10712]
 gi|329302737|gb|EGG46627.1| 30S ribosomal protein S12 [Streptomyces griseoaurantiacus M045]
          Length = 123

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL G+PQ+RGVC RV+T TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRQDKVEK-NKTPALEGSPQRRGVCTRVFTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|300932740|ref|ZP_07147996.1| 30S ribosomal protein S12 [Corynebacterium resistens DSM 45100]
          Length = 123

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R    +  A   AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRHDKSQKVA-TAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGTLDTQGVKDRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|240167680|ref|ZP_04746339.1| 30S ribosomal protein S12 [Mycobacterium kansasii ATCC 12478]
          Length = 124

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    A  K  AL+G+PQ+RGVC RVYT TP+KPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRRDKI-AKVKTAALKGSPQRRGVCTRVYTTTPRKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|303256443|ref|ZP_07342457.1| ribosomal protein S12 [Burkholderiales bacterium 1_1_47]
 gi|302859934|gb|EFL83011.1| ribosomal protein S12 [Burkholderiales bacterium 1_1_47]
          Length = 125

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR+ +    +K  AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRERAIEK-SKSPALNNCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y V+RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGSLDTQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|291286307|ref|YP_003503123.1| 30S ribosomal protein S12 [Denitrovibrio acetiphilus DSM 12809]
 gi|290883467|gb|ADD67167.1| ribosomal protein S12 [Denitrovibrio acetiphilus DSM 12809]
          Length = 123

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK       K  AL+GNPQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTLNQLVRKGRKKQVEKT-KSPALQGNPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y+++RG LD +GVKNRKQ+RS+YG 
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIVRGALDTEGVKNRKQSRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|225849553|ref|YP_002729718.1| 30S ribosomal protein S12 [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643477|gb|ACN98527.1| ribosomal protein S12 [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 134

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 107/124 (86%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   +  +K  AL+GNPQKRGVC+RVYT TPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLVRKGRE-KIKKKSKAPALQGNPQKRGVCVRVYTTTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LDA GVK+RKQ+RS+YGA
Sbjct: 60  GIEVTCYIPGIGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAAGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|15607822|ref|NP_215196.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis H37Rv]
 gi|15840085|ref|NP_335122.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis CDC1551]
 gi|31791866|ref|NP_854359.1| 30S ribosomal protein S12 [Mycobacterium bovis AF2122/97]
 gi|121636603|ref|YP_976826.1| 30S ribosomal protein S12 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148660457|ref|YP_001281980.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis H37Ra]
 gi|148821887|ref|YP_001286641.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis F11]
 gi|167967583|ref|ZP_02549860.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis H37Ra]
 gi|215402464|ref|ZP_03414645.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis 02_1987]
 gi|215410237|ref|ZP_03419045.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis 94_M4241A]
 gi|215425923|ref|ZP_03423842.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis T92]
 gi|215429521|ref|ZP_03427440.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis EAS054]
 gi|215444805|ref|ZP_03431557.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis T85]
 gi|218752333|ref|ZP_03531129.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis GM 1503]
 gi|219556531|ref|ZP_03535607.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis T17]
 gi|224989075|ref|YP_002643762.1| 30S ribosomal protein S12 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253797624|ref|YP_003030625.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis KZN
           1435]
 gi|254231003|ref|ZP_04924330.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis C]
 gi|254363631|ref|ZP_04979677.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254549642|ref|ZP_05140089.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|260185564|ref|ZP_05763038.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis CPHL_A]
 gi|260199691|ref|ZP_05767182.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis T46]
 gi|260203853|ref|ZP_05771344.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis K85]
 gi|289442082|ref|ZP_06431826.1| SSU ribosomal protein S12 [Mycobacterium tuberculosis T46]
 gi|289446241|ref|ZP_06435985.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis CPHL_A]
 gi|289552938|ref|ZP_06442148.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis KZN 605]
 gi|289568623|ref|ZP_06448850.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis T17]
 gi|289573289|ref|ZP_06453516.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis K85]
 gi|289744405|ref|ZP_06503783.1| ribosomal protein S12 [Mycobacterium tuberculosis 02_1987]
 gi|289749188|ref|ZP_06508566.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis T92]
 gi|289752730|ref|ZP_06512108.1| ribosomal protein S12 [Mycobacterium tuberculosis EAS054]
 gi|289756770|ref|ZP_06516148.1| ribosomal protein S12 [Mycobacterium tuberculosis T85]
 gi|289760808|ref|ZP_06520186.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis GM 1503]
 gi|294993053|ref|ZP_06798744.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis 210]
 gi|297633180|ref|ZP_06950960.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis KZN 4207]
 gi|297730160|ref|ZP_06959278.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis KZN R506]
 gi|298524174|ref|ZP_07011583.1| ribosomal protein S12 [Mycobacterium tuberculosis 94_M4241A]
 gi|306774792|ref|ZP_07413129.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu001]
 gi|306781475|ref|ZP_07419812.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu002]
 gi|306783332|ref|ZP_07421654.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu003]
 gi|306787702|ref|ZP_07426024.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu004]
 gi|306794468|ref|ZP_07432770.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu005]
 gi|306796436|ref|ZP_07434738.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu006]
 gi|306802295|ref|ZP_07438963.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu008]
 gi|306806505|ref|ZP_07443173.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu007]
 gi|306966703|ref|ZP_07479364.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu009]
 gi|306970896|ref|ZP_07483557.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu010]
 gi|307078624|ref|ZP_07487794.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu011]
 gi|307083188|ref|ZP_07492301.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu012]
 gi|313657487|ref|ZP_07814367.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis KZN V2475]
 gi|730628|sp|P41196|RS12_MYCTU RecName: Full=30S ribosomal protein S12
 gi|38605726|sp|Q53538|RS12_MYCBO RecName: Full=30S ribosomal protein S12
 gi|158512940|sp|A1KGG2|RS12_MYCBP RecName: Full=30S ribosomal protein S12
 gi|166231872|sp|A5U068|RS12_MYCTA RecName: Full=30S ribosomal protein S12
 gi|254811097|sp|C1AL15|RS12_MYCBT RecName: Full=30S ribosomal protein S12
 gi|433443|emb|CAA50323.1| ribosomal protein S12 [Mycobacterium tuberculosis]
 gi|463130|gb|AAA66176.1| ribosomal protein S12 [Mycobacterium tuberculosis H37Rv]
 gi|2909655|emb|CAA17465.1| PROBABLE 30S RIBOSOMAL PROTEIN S12 RPSL [Mycobacterium tuberculosis
           H37Rv]
 gi|13880234|gb|AAK44936.1| ribosomal protein S12 [Mycobacterium tuberculosis CDC1551]
 gi|24429931|gb|AAN52761.1| ribosomal protein S12 [Mycobacterium tuberculosis]
 gi|24429937|gb|AAN52764.1| ribosomal protein S12 [Mycobacterium tuberculosis]
 gi|31617453|emb|CAD93563.1| PROBABLE 30S RIBOSOMAL PROTEIN S12 RPSL [Mycobacterium bovis
           AF2122/97]
 gi|121492250|emb|CAL70717.1| Probable 30S ribosomal protein S12 rpsL [Mycobacterium bovis BCG
           str. Pasteur 1173P2]
 gi|124600062|gb|EAY59072.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis C]
 gi|134149145|gb|EBA41190.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148504609|gb|ABQ72418.1| 30S ribosomal protein S12 [Mycobacterium tuberculosis H37Ra]
 gi|148720414|gb|ABR05039.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis F11]
 gi|224772188|dbj|BAH24994.1| 30S ribosomal protein S12 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253319127|gb|ACT23730.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis KZN
           1435]
 gi|289415001|gb|EFD12241.1| SSU ribosomal protein S12 [Mycobacterium tuberculosis T46]
 gi|289419199|gb|EFD16400.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis CPHL_A]
 gi|289437570|gb|EFD20063.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis KZN 605]
 gi|289537720|gb|EFD42298.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis K85]
 gi|289542377|gb|EFD46025.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis T17]
 gi|289684933|gb|EFD52421.1| ribosomal protein S12 [Mycobacterium tuberculosis 02_1987]
 gi|289689775|gb|EFD57204.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis T92]
 gi|289693317|gb|EFD60746.1| ribosomal protein S12 [Mycobacterium tuberculosis EAS054]
 gi|289708314|gb|EFD72330.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis GM 1503]
 gi|289712334|gb|EFD76346.1| ribosomal protein S12 [Mycobacterium tuberculosis T85]
 gi|298493968|gb|EFI29262.1| ribosomal protein S12 [Mycobacterium tuberculosis 94_M4241A]
 gi|308216685|gb|EFO76084.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu001]
 gi|308325773|gb|EFP14624.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu002]
 gi|308331828|gb|EFP20679.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu003]
 gi|308335614|gb|EFP24465.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu004]
 gi|308337231|gb|EFP26082.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu005]
 gi|308343097|gb|EFP31948.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu006]
 gi|308346981|gb|EFP35832.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu007]
 gi|308350961|gb|EFP39812.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu008]
 gi|308355557|gb|EFP44408.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu009]
 gi|308359516|gb|EFP48367.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu010]
 gi|308363420|gb|EFP52271.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu011]
 gi|308367058|gb|EFP55909.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis SUMu012]
 gi|323720906|gb|EGB29972.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis
           CDC1551A]
 gi|328457405|gb|AEB02828.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis KZN
           4207]
          Length = 124

 Score =  179 bits (453), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    +  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRRDKI-SKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|284992879|ref|YP_003411433.1| 30S ribosomal protein S12 [Geodermatophilus obscurus DSM 43160]
 gi|284066124|gb|ADB77062.1| ribosomal protein S12 [Geodermatophilus obscurus DSM 43160]
          Length = 124

 Score =  179 bits (453), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+       K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTINQLVRKGREDKVEKT-KTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGV+NRKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVRNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|38233079|ref|NP_938846.1| 30S ribosomal protein S12 [Corynebacterium diphtheriae NCTC 13129]
 gi|52783365|sp|Q6NJD8|RS12_CORDI RecName: Full=30S ribosomal protein S12
 gi|38199338|emb|CAE48971.1| 30S ribosomal protein S12 [Corynebacterium diphtheriae]
          Length = 123

 Score =  179 bits (453), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R       A   AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRHDKTAKVA-TAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGALDTQGVKDRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|331699181|ref|YP_004335420.1| 30S ribosomal protein S12 [Pseudonocardia dioxanivorans CB1190]
 gi|326953870|gb|AEA27567.1| ribosomal protein S12 [Pseudonocardia dioxanivorans CB1190]
          Length = 124

 Score =  179 bits (453), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIQQLVRKGRQDKV-AKTKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVKNRKQARSRYGA
Sbjct: 60  LIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|326388191|ref|ZP_08209794.1| 30S ribosomal protein S12 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207357|gb|EGD58171.1| 30S ribosomal protein S12 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 123

 Score =  179 bits (453), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R    +  +KV A+  NPQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRVPQ-KTKSKVPAMEQNPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+PGEGHNLQEHSVV++ GGRV+DLPGV+Y V+RGVLD QGVK+RKQ+RS+YGA
Sbjct: 60  SREVISYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDTQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|257095045|ref|YP_003168686.1| 30S ribosomal protein S12 [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047569|gb|ACV36757.1| ribosomal protein S12 [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 125

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR+ + R+ +KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRE-AIRSKSKVPALGNCPQKRGVCTRVYTTTPKKPNSALRKVCKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD QGVK RKQ+RS+YG 
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTQGVKKRKQSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|237749511|ref|ZP_04579991.1| small subunit ribosomal protein S12 [Oxalobacter formigenes OXCC13]
 gi|229380873|gb|EEO30964.1| small subunit ribosomal protein S12 [Oxalobacter formigenes OXCC13]
          Length = 127

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/124 (72%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR+PR  S +A +K  AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRQPRV-SVKAKSKSPALDNCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|318056677|ref|ZP_07975400.1| 30S ribosomal protein S12 [Streptomyces sp. SA3_actG]
 gi|318075393|ref|ZP_07982725.1| 30S ribosomal protein S12 [Streptomyces sp. SA3_actF]
          Length = 123

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL G+PQ+RGVC RV+T TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRQDKVEK-NKTPALDGSPQRRGVCTRVFTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|84494793|ref|ZP_00993912.1| 30S ribosomal protein S12 [Janibacter sp. HTCC2649]
 gi|84384286|gb|EAQ00166.1| 30S ribosomal protein S12 [Janibacter sp. HTCC2649]
          Length = 124

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+          AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTINQLVRKGRQDKVTKTT-TPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK RKQARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDTQGVKGRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|329902662|ref|ZP_08273218.1| SSU ribosomal protein S12p (S23e) [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327548664|gb|EGF33312.1| SSU ribosomal protein S12p (S23e) [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 127

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR+PR  S R  +K  AL  +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRQPRV-SARVKSKSPALENSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YG 
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGALDTQGVKDRKQSRSKYGT 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|25027070|ref|NP_737124.1| 30S ribosomal protein S12 [Corynebacterium efficiens YS-314]
 gi|259506803|ref|ZP_05749703.1| 30S ribosomal protein S12 [Corynebacterium efficiens YS-314]
 gi|27151670|sp|P59163|RS12_COREF RecName: Full=30S ribosomal protein S12
 gi|23492350|dbj|BAC17324.1| putative 30S ribosomal protein S12 [Corynebacterium efficiens
           YS-314]
 gi|259165614|gb|EEW50168.1| 30S ribosomal protein S12 [Corynebacterium efficiens YS-314]
          Length = 122

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 102/122 (83%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R       A   AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRHDKTAKVA-TAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGALDTQGVKDRKQARSRYGA 119

Query: 121 ER 122
           +R
Sbjct: 120 KR 121


>gi|56313632|emb|CAI08277.1| 30S ribosomal protein S12 [Aromatoleum aromaticum EbN1]
          Length = 137

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR+ +    +KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 13  MPTINQLVRKPRQLAV-IKSKVPALDACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 71

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YGA
Sbjct: 72  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGA 131

Query: 121 ERPK 124
           +RPK
Sbjct: 132 KRPK 135


>gi|161350049|ref|YP_159178.2| 30S ribosomal protein S12 [Aromatoleum aromaticum EbN1]
 gi|62287381|sp|Q5P337|RS12_AZOSE RecName: Full=30S ribosomal protein S12
          Length = 125

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR+ +    +KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRQLAV-IKSKVPALDACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|307297399|ref|ZP_07577205.1| ribosomal protein S12 [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306916659|gb|EFN47041.1| ribosomal protein S12 [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 124

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  RK   +  +   AL  NPQKRGVC+RV T+TPKKPNSALRK+ + RL++
Sbjct: 1   MPTINQLIRHGRK-QLKQKSASPALENNPQKRGVCVRVSTMTPKKPNSALRKIARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y+++RG LDA+GV NRKQ+RSRYGA
Sbjct: 60  GTEVTAYIPGEGHNLQEHSVVLVRGGRVKDLPGVRYKIVRGTLDAEGVANRKQSRSRYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|41410238|ref|NP_963074.1| 30S ribosomal protein S12 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118466566|ref|YP_883626.1| 30S ribosomal protein S12 [Mycobacterium avium 104]
 gi|183981032|ref|YP_001849323.1| 30S ribosomal protein S12, RpsL [Mycobacterium marinum M]
 gi|254776928|ref|ZP_05218444.1| 30S ribosomal protein S12 [Mycobacterium avium subsp. avium ATCC
           25291]
 gi|14424463|sp|P51999|RS12_MYCAV RecName: Full=30S ribosomal protein S12
 gi|52783374|sp|Q73SD4|RS12_MYCPA RecName: Full=30S ribosomal protein S12
 gi|158512446|sp|A0QL38|RS12_MYCA1 RecName: Full=30S ribosomal protein S12
 gi|226712622|sp|B2HSL0|RS12_MYCMM RecName: Full=30S ribosomal protein S12
 gi|1911626|gb|AAB50769.1| ribosomal S12 protein, rpsL product [Mycobacterium avium, strain
           35713, Peptide, 124 aa]
 gi|41399072|gb|AAS06690.1| RpsL [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|118167853|gb|ABK68750.1| ribosomal protein S12 [Mycobacterium avium 104]
 gi|183174358|gb|ACC39468.1| 30S ribosomal protein S12, RpsL [Mycobacterium marinum M]
          Length = 124

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRRDKI-GKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|16127432|ref|NP_421996.1| 30S ribosomal protein S12 [Caulobacter crescentus CB15]
 gi|221236241|ref|YP_002518678.1| 30S ribosomal protein S12 [Caulobacter crescentus NA1000]
 gi|295688184|ref|YP_003591877.1| 30S ribosomal protein S12 [Caulobacter segnis ATCC 21756]
 gi|20140206|sp|Q9A3K2|RS12_CAUCR RecName: Full=30S ribosomal protein S12
 gi|254811076|sp|B8H416|RS12_CAUCN RecName: Full=30S ribosomal protein S12
 gi|13424880|gb|AAK25164.1| ribosomal protein S12 [Caulobacter crescentus CB15]
 gi|220965414|gb|ACL96770.1| SSU ribosomal protein S12P [Caulobacter crescentus NA1000]
 gi|295430087|gb|ADG09259.1| ribosomal protein S12 [Caulobacter segnis ATCC 21756]
          Length = 123

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR        KV AL+G PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKPRSPKP-VRNKVPALKGCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+E + Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS YGA
Sbjct: 60  GIEAVCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSLYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|154507869|ref|ZP_02043511.1| hypothetical protein ACTODO_00351 [Actinomyces odontolyticus ATCC
           17982]
 gi|293190265|ref|ZP_06608761.1| ribosomal protein S12 [Actinomyces odontolyticus F0309]
 gi|315605894|ref|ZP_07880925.1| 30S ribosomal protein S12 [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|153797503|gb|EDN79923.1| hypothetical protein ACTODO_00351 [Actinomyces odontolyticus ATCC
           17982]
 gi|292821081|gb|EFF80034.1| ribosomal protein S12 [Actinomyces odontolyticus F0309]
 gi|315312176|gb|EFU60262.1| 30S ribosomal protein S12 [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 124

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R  S RA  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIQQLVRKGRV-SKRAKVKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+YR++RG LD QGV+ R+QARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYRIVRGSLDTQGVRGRQQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|257054465|ref|YP_003132297.1| 30S ribosomal protein S12 [Saccharomonospora viridis DSM 43017]
 gi|256584337|gb|ACU95470.1| SSU ribosomal protein S12P [Saccharomonospora viridis DSM 43017]
          Length = 124

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +L++
Sbjct: 1   MPTIQQLVRKGRQDKA-AKQKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|311896587|dbj|BAJ28995.1| putative ribosomal protein S12 [Kitasatospora setae KM-6054]
          Length = 123

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+   +   K  AL  +PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRQDKVQKT-KTPALEASPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD Q VKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDTQAVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|84515201|ref|ZP_01002564.1| 30S ribosomal protein S12 [Loktanella vestfoldensis SKA53]
 gi|84511360|gb|EAQ07814.1| 30S ribosomal protein S12 [Loktanella vestfoldensis SKA53]
          Length = 123

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+      +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKI-VKSKSQHLESCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y V+RGVLD QGVKNRKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHVLRGVLDTQGVKNRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|154253172|ref|YP_001413996.1| 30S ribosomal protein S12 [Parvibaculum lavamentivorans DS-1]
 gi|171769623|sp|A7HWQ6|RS12_PARL1 RecName: Full=30S ribosomal protein S12
 gi|154157122|gb|ABS64339.1| ribosomal protein S12 [Parvibaculum lavamentivorans DS-1]
          Length = 123

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRKPRK   +   KV A++  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTVNQLIRKPRKPLVKR-NKVPAMQACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EV +Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y +IRGVLD QGVK+R+Q RS+YGA
Sbjct: 60  QFEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGVLDTQGVKDRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|320094585|ref|ZP_08026351.1| 30S ribosomal protein S12 [Actinomyces sp. oral taxon 178 str.
           F0338]
 gi|319978500|gb|EFW10077.1| 30S ribosomal protein S12 [Actinomyces sp. oral taxon 178 str.
           F0338]
          Length = 124

 Score =  178 bits (451), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R  S RA  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIQQLVRKGRV-SKRAKVKTRALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+YR++RG LD QGV+ R+QARSRYGA
Sbjct: 60  GVEVTAYIPGEGHNLQEHSIVLVRGGRVRDLPGVRYRIVRGSLDTQGVRGRQQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|319942166|ref|ZP_08016483.1| 30S ribosomal protein S12 [Sutterella wadsworthensis 3_1_45B]
 gi|319804301|gb|EFW01190.1| 30S ribosomal protein S12 [Sutterella wadsworthensis 3_1_45B]
          Length = 125

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR+ +    +K  AL+  PQKRGVC RVY  TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRELTHDK-SKSPALKNCPQKRGVCTRVYATTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDTQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|284034007|ref|YP_003383938.1| 30S ribosomal protein S12 [Kribbella flavida DSM 17836]
 gi|283813300|gb|ADB35139.1| ribosomal protein S12 [Kribbella flavida DSM 17836]
          Length = 124

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    +  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRQDKV-SKNKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|256785861|ref|ZP_05524292.1| 30S ribosomal protein S12 [Streptomyces lividans TK24]
 gi|289769753|ref|ZP_06529131.1| 30S ribosomal protein S12 [Streptomyces lividans TK24]
 gi|289699952|gb|EFD67381.1| 30S ribosomal protein S12 [Streptomyces lividans TK24]
          Length = 123

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL G+PQ+RGVC RV+T TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRQDKVEK-NKTPALEGSPQRRGVCTRVFTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVEDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|213964879|ref|ZP_03393078.1| ribosomal protein S12 [Corynebacterium amycolatum SK46]
 gi|213952415|gb|EEB63798.1| ribosomal protein S12 [Corynebacterium amycolatum SK46]
          Length = 123

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R    +A     AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRHDK-KAKVATAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGSLDTQGVKDRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|300779857|ref|ZP_07089713.1| 30S ribosomal protein S12 [Corynebacterium genitalium ATCC 33030]
 gi|300533967|gb|EFK55026.1| 30S ribosomal protein S12 [Corynebacterium genitalium ATCC 33030]
          Length = 123

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/122 (69%), Positives = 103/122 (84%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R    +A     AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRHDK-KAKVATAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGALDTQGVKDRKQARSRYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|294010608|ref|YP_003544068.1| ribosomal protein S12 [Sphingobium japonicum UT26S]
 gi|307294969|ref|ZP_07574811.1| ribosomal protein S12 [Sphingobium chlorophenolicum L-1]
 gi|292673938|dbj|BAI95456.1| ribosomal protein S12 [Sphingobium japonicum UT26S]
 gi|306879443|gb|EFN10661.1| ribosomal protein S12 [Sphingobium chlorophenolicum L-1]
          Length = 123

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   +  +KV A+  NPQKRGVC RVYT TPKKPNSALRKV K RL +
Sbjct: 1   MPTINQLVRKGRELQ-KTKSKVPAMEANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI Y+PGEGHNLQEHSVV++ GGRV+DLPGV+Y V+RGVLD QGVK+RKQ+RS+YGA
Sbjct: 60  QREVITYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDTQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|19551736|ref|NP_599738.1| 30S ribosomal protein S12 [Corynebacterium glutamicum ATCC 13032]
 gi|62389391|ref|YP_224793.1| 30S ribosomal protein S12 [Corynebacterium glutamicum ATCC 13032]
 gi|145294645|ref|YP_001137466.1| 30S ribosomal protein S12 [Corynebacterium glutamicum R]
 gi|23822076|sp|Q8NT21|RS12_CORGL RecName: Full=30S ribosomal protein S12
 gi|158513583|sp|A4QBG7|RS12_CORGB RecName: Full=30S ribosomal protein S12
 gi|21323258|dbj|BAB97886.1| Ribosomal protein S12 [Corynebacterium glutamicum ATCC 13032]
 gi|41324725|emb|CAF19207.1| RIBOSOMAL PROTEIN S12 [Corynebacterium glutamicum ATCC 13032]
 gi|140844565|dbj|BAF53564.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 122

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/122 (69%), Positives = 102/122 (83%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R       A   AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRHDKSAKVA-TAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGALDTQGVKDRKQARSRYGA 119

Query: 121 ER 122
           +R
Sbjct: 120 KR 121


>gi|24429939|gb|AAN52765.1| ribosomal protein S12 [Mycobacterium tuberculosis]
 gi|309753218|gb|ADO85632.1| ribosomal protein S12 [Mycobacterium tuberculosis]
          Length = 124

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    +  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRRDKI-SKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVRDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|15077867|gb|AAK83385.1|AF398879_1 ribosomal protein S12 [Mycobacterium tuberculosis]
 gi|15077871|gb|AAK83387.1|AF398881_1 ribosomal protein S12 [Mycobacterium tuberculosis]
 gi|24429933|gb|AAN52762.1| ribosomal protein S12 [Mycobacterium tuberculosis]
 gi|309753214|gb|ADO85630.1| ribosomal protein S12 [Mycobacterium tuberculosis]
 gi|309753216|gb|ADO85631.1| ribosomal protein S12 [Mycobacterium tuberculosis]
 gi|326905096|gb|EGE52029.1| 30S ribosomal protein S12 rpsL [Mycobacterium tuberculosis W-148]
          Length = 124

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    +  K  AL+G+PQ+RGVC RVYT TP+KPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRRDKI-SKVKTAALKGSPQRRGVCTRVYTTTPRKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|269796262|ref|YP_003315717.1| 30S ribosomal protein S12P [Sanguibacter keddieii DSM 10542]
 gi|269098447|gb|ACZ22883.1| SSU ribosomal protein S12P [Sanguibacter keddieii DSM 10542]
          Length = 124

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R     + +K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +L+S
Sbjct: 1   MPTIQQLVRKGRTSKV-SKSKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+VIRG LD QGVKNRKQARSRYGA
Sbjct: 60  GVEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKVIRGALDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|126737170|ref|ZP_01752905.1| 30S ribosomal protein S12 [Roseobacter sp. SK209-2-6]
 gi|254465108|ref|ZP_05078519.1| ribosomal protein S12 [Rhodobacterales bacterium Y4I]
 gi|126721755|gb|EBA18458.1| 30S ribosomal protein S12 [Roseobacter sp. SK209-2-6]
 gi|206686016|gb|EDZ46498.1| ribosomal protein S12 [Rhodobacterales bacterium Y4I]
          Length = 123

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   R  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPK-RKVSKSQHLEQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|15077869|gb|AAK83386.1|AF398880_1 ribosomal protein S12 [Mycobacterium tuberculosis]
          Length = 124

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    +  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRRDKI-SKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVQDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|255263068|ref|ZP_05342410.1| 30S ribosomal protein S12 [Thalassiobium sp. R2A62]
 gi|255105403|gb|EET48077.1| 30S ribosomal protein S12 [Thalassiobium sp. R2A62]
          Length = 123

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   R  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPK-RKISKSQHLEQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|119718145|ref|YP_925110.1| 30S ribosomal protein S12 [Nocardioides sp. JS614]
 gi|158513106|sp|A1SNN8|RS12_NOCSJ RecName: Full=30S ribosomal protein S12
 gi|119538806|gb|ABL83423.1| SSU ribosomal protein S12P [Nocardioides sp. JS614]
          Length = 124

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    +  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIQQLVRKGRQDKV-SKNKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  GVEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGTLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|227832206|ref|YP_002833913.1| 30S ribosomal protein S12 [Corynebacterium aurimucosum ATCC 700975]
 gi|262183940|ref|ZP_06043361.1| 30S ribosomal protein S12 [Corynebacterium aurimucosum ATCC 700975]
 gi|254811079|sp|C3PKN9|RS12_CORA7 RecName: Full=30S ribosomal protein S12
 gi|227453222|gb|ACP31975.1| 30S ribosomal protein S12 [Corynebacterium aurimucosum ATCC 700975]
          Length = 123

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/122 (69%), Positives = 103/122 (84%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R  S +A      L+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRH-SKKAKVATAGLKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGALDTQGVKDRKQARSRYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|225020360|ref|ZP_03709552.1| hypothetical protein CORMATOL_00367 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305679697|ref|ZP_07402507.1| 30S ribosomal protein S12 [Corynebacterium matruchotii ATCC 14266]
 gi|224946749|gb|EEG27958.1| hypothetical protein CORMATOL_00367 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305660317|gb|EFM49814.1| 30S ribosomal protein S12 [Corynebacterium matruchotii ATCC 14266]
          Length = 123

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R     A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRHDKT-AKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGV++RKQ RSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGALDTQGVRDRKQGRSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|317123101|ref|YP_004103104.1| 30S ribosomal protein S12P [Thermaerobacter marianensis DSM 12885]
 gi|315593081|gb|ADU52377.1| SSU ribosomal protein S12P [Thermaerobacter marianensis DSM 12885]
          Length = 124

 Score =  177 bits (450), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   R      ALRGNPQKRGVCL+V T TPKKPNSALRK+ + RLT+
Sbjct: 1   MPTINQLVRKGRQRVTRRTG-APALRGNPQKRGVCLQVRTTTPKKPNSALRKIARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA GV+ R+Q RS+YGA
Sbjct: 60  GVEVTAYIPGEGHNLQEHSVVLVHGGRVKDLPGVRYQIIRGALDAAGVEKRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|319443076|ref|ZP_07992232.1| 30S ribosomal protein S12 [Corynebacterium variabile DSM 44702]
          Length = 123

 Score =  177 bits (450), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R       A   AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRHDKTAKVA-TAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGSLDTQGVKDRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|23013729|ref|ZP_00053593.1| COG0048: Ribosomal protein S12 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 123

 Score =  177 bits (450), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR+    A  KV A+   PQKRGVC RVYT TPKKP+SALRKV + RLT+
Sbjct: 1   MPTINQLIRKPRQ-PVAARNKVPAMEACPQKRGVCTRVYTTTPKKPSSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+PGEGHNLQEHSVVM+ GGRV+DLPGV+Y +IRG LD QGVK+R+Q RS+YGA
Sbjct: 60  GFEVTSYIPGEGHNLQEHSVVMIRGGRVRDLPGVRYHIIRGTLDTQGVKDRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|313903156|ref|ZP_07836550.1| SSU ribosomal protein S12P [Thermaerobacter subterraneus DSM 13965]
 gi|313466658|gb|EFR62178.1| SSU ribosomal protein S12P [Thermaerobacter subterraneus DSM 13965]
          Length = 124

 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   R      ALRGNPQKRGVCL+V T TPKKPNSALRK+ + RLT+
Sbjct: 1   MPTINQLVRKGRERVTRRTG-APALRGNPQKRGVCLQVRTTTPKKPNSALRKIARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA GV+ R+Q RS+YGA
Sbjct: 60  GVEVTAYIPGEGHNLQEHSVVLVHGGRVKDLPGVRYQIIRGALDAAGVEKRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|297537526|ref|YP_003673295.1| 30S ribosomal protein S12 [Methylotenera sp. 301]
 gi|297256873|gb|ADI28718.1| ribosomal protein S12 [Methylotenera sp. 301]
          Length = 128

 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR       +KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKPR-AKVVTKSKVPALESCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD  GVK+RKQ+RS+YGA
Sbjct: 60  GYEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGSLDTAGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|126734501|ref|ZP_01750247.1| 30S ribosomal protein S12 [Roseobacter sp. CCS2]
 gi|126715056|gb|EBA11921.1| 30S ribosomal protein S12 [Roseobacter sp. CCS2]
          Length = 123

 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+      +K   + G PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKV-TKSKSQHMEGCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|17547743|ref|NP_521145.1| 30S ribosomal protein S12 [Ralstonia solanacearum GMI1000]
 gi|83749346|ref|ZP_00946342.1| SSU ribosomal protein S12P [Ralstonia solanacearum UW551]
 gi|187930369|ref|YP_001900856.1| 30S ribosomal protein S12 [Ralstonia pickettii 12J]
 gi|207721904|ref|YP_002252342.1| 30s ribosomal protein s12 [Ralstonia solanacearum MolK2]
 gi|207744582|ref|YP_002260974.1| 30s ribosomal protein s12 [Ralstonia solanacearum IPO1609]
 gi|241664537|ref|YP_002982897.1| 30S ribosomal protein S12 [Ralstonia pickettii 12D]
 gi|300690155|ref|YP_003751150.1| 30S ribosomal subunit protein S12 [Ralstonia solanacearum PSI07]
 gi|300702775|ref|YP_003744376.1| 30S ribosomal protein S12 [Ralstonia solanacearum CFBP2957]
 gi|309782829|ref|ZP_07677549.1| ribosomal protein S12 [Ralstonia sp. 5_7_47FAA]
 gi|20140043|sp|Q8XV08|RS12_RALSO RecName: Full=30S ribosomal protein S12
 gi|226712638|sp|B2UEM4|RS12_RALPJ RecName: Full=30S ribosomal protein S12
 gi|17430048|emb|CAD16733.1| probable 30s ribosomal protein s12 [Ralstonia solanacearum GMI1000]
 gi|83723971|gb|EAP71153.1| SSU ribosomal protein S12P [Ralstonia solanacearum UW551]
 gi|187727259|gb|ACD28424.1| ribosomal protein S12 [Ralstonia pickettii 12J]
 gi|206587073|emb|CAQ17657.1| 30s ribosomal protein s12 [Ralstonia solanacearum MolK2]
 gi|206595988|emb|CAQ62915.1| 30s ribosomal protein s12 [Ralstonia solanacearum IPO1609]
 gi|240866564|gb|ACS64225.1| ribosomal protein S12 [Ralstonia pickettii 12D]
 gi|299065410|emb|CBJ36579.1| 30S ribosomal subunit protein S12 [Ralstonia solanacearum CMR15]
 gi|299070437|emb|CBJ41732.1| 30S ribosomal subunit protein S12 [Ralstonia solanacearum CFBP2957]
 gi|299077215|emb|CBJ49841.1| 30S ribosomal subunit protein S12 [Ralstonia solanacearum PSI07]
 gi|308918253|gb|EFP63930.1| ribosomal protein S12 [Ralstonia sp. 5_7_47FAA]
          Length = 125

 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR  S +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRV-SEKLKSKSPALENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|317125878|ref|YP_004099990.1| 30S ribosomal protein S12P [Intrasporangium calvum DSM 43043]
 gi|315589966|gb|ADU49263.1| SSU ribosomal protein S12P [Intrasporangium calvum DSM 43043]
          Length = 124

 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+      AK  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTINQLVRKGREDKA-TKAKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK RKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGTLDTQGVKGRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|74316418|ref|YP_314158.1| 30S ribosomal protein S12 [Thiobacillus denitrificans ATCC 25259]
 gi|90111827|sp|Q3SLQ4|RS12_THIDA RecName: Full=30S ribosomal protein S12
 gi|74055913|gb|AAZ96353.1| Ribosomal protein S12m [Thiobacillus denitrificans ATCC 25259]
          Length = 125

 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR+      +KV AL+  PQ+RGVC RVYT TPKKPNSALRKV K +LTS
Sbjct: 1   MPTINQLIRKPRQAPVEK-SKVPALKACPQRRGVCTRVYTTTPKKPNSALRKVCKVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|227549813|ref|ZP_03979862.1| 30S ribosomal protein S12 [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227078068|gb|EEI16031.1| 30S ribosomal protein S12 [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 122

 Score =  177 bits (449), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 85/122 (69%), Positives = 102/122 (83%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R    R      AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRHDK-RTKVATAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGALDTQGVKDRKQARSRYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|323136081|ref|ZP_08071164.1| ribosomal protein S12 [Methylocystis sp. ATCC 49242]
 gi|322399172|gb|EFY01691.1| ribosomal protein S12 [Methylocystis sp. ATCC 49242]
          Length = 123

 Score =  177 bits (449), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 104/125 (83%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRK-GSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT++QLIRKPR   ++R  A+   L   PQKRGVC RVYT TPKKPNSALRKV K RLT
Sbjct: 1   MPTISQLIRKPRHPKTYREKAR--HLGACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLT 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YG
Sbjct: 59  NGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYG 118

Query: 120 AERPK 124
           A+RPK
Sbjct: 119 AKRPK 123


>gi|114778829|ref|ZP_01453636.1| Ribosomal protein S12 [Mariprofundus ferrooxydans PV-1]
 gi|114550960|gb|EAU53524.1| Ribosomal protein S12 [Mariprofundus ferrooxydans PV-1]
          Length = 123

 Score =  177 bits (449), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQLIRK RK   R   KV AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTVNQLIRKSRKDK-RKINKVPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGH LQEHSVV++ GGRVKDLPGV+Y ++RGVLD  GV++RKQARS+YGA
Sbjct: 60  GQEVTAYIPGEGHKLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTTGVESRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|24429935|gb|AAN52763.1| ribosomal protein S12 [Mycobacterium tuberculosis]
          Length = 124

 Score =  177 bits (448), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    +  K  AL+G+PQ+RGVC RVYT TP KPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRRDKI-SKVKTAALKGSPQRRGVCTRVYTTTPTKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|237747361|ref|ZP_04577841.1| small subunit ribosomal protein S12 [Oxalobacter formigenes HOxBLS]
 gi|229378712|gb|EEO28803.1| small subunit ribosomal protein S12 [Oxalobacter formigenes HOxBLS]
          Length = 127

 Score =  177 bits (448), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR+PR  + +  +K  AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRQPRV-TVKTKSKSPALENCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|311744815|ref|ZP_07718611.1| 30S ribosomal protein S12 [Aeromicrobium marinum DSM 15272]
 gi|311311932|gb|EFQ81853.1| 30S ribosomal protein S12 [Aeromicrobium marinum DSM 15272]
          Length = 124

 Score =  177 bits (448), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+ S    +   AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +L+S
Sbjct: 1   MPTINQLVRKGRQ-SKAVKSNTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK RKQARSRYGA
Sbjct: 60  GTEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDTQGVKGRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|171462874|ref|YP_001796987.1| ribosomal protein S12 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|226712631|sp|B1XSP6|RS12_POLNS RecName: Full=30S ribosomal protein S12
 gi|171192412|gb|ACB43373.1| ribosomal protein S12 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 126

 Score =  177 bits (448), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR       +K  A++ +PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKPR-ARLTVKSKSPAMQNSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|302521314|ref|ZP_07273656.1| ribosomal protein S23 (S12) [Streptomyces sp. SPB78]
 gi|302430209|gb|EFL02025.1| ribosomal protein S23 (S12) [Streptomyces sp. SPB78]
          Length = 139

 Score =  177 bits (448), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+ QL+RK R+       K  AL G+PQ+RGVC RV+T TPKKPNSALRKV + RLTS
Sbjct: 17  VPTIQQLVRKGRQDKVEK-NKTPALDGSPQRRGVCTRVFTTTPKKPNSALRKVARVRLTS 75

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 76  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 135

Query: 121 ERPK 124
           ++ K
Sbjct: 136 KKEK 139


>gi|254383178|ref|ZP_04998532.1| ribosomal protein S12 [Streptomyces sp. Mg1]
 gi|302536244|ref|ZP_07288586.1| ribosomal protein S12 [Streptomyces sp. C]
 gi|194342077|gb|EDX23043.1| ribosomal protein S12 [Streptomyces sp. Mg1]
 gi|302445139|gb|EFL16955.1| ribosomal protein S12 [Streptomyces sp. C]
          Length = 123

 Score =  177 bits (448), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL  +PQ+RGVC RV+T TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRQDKVEKT-KTPALEASPQRRGVCTRVFTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD Q VKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDTQAVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|110681141|ref|YP_684148.1| 30S ribosomal protein S12 [Roseobacter denitrificans OCh 114]
 gi|163732883|ref|ZP_02140328.1| 30S ribosomal protein S12 [Roseobacter litoralis Och 149]
 gi|119366802|sp|Q160Y1|RS12_ROSDO RecName: Full=30S ribosomal protein S12
 gi|109457257|gb|ABG33462.1| ribosomal protein S12 [Roseobacter denitrificans OCh 114]
 gi|161394243|gb|EDQ18567.1| 30S ribosomal protein S12 [Roseobacter litoralis Och 149]
          Length = 123

 Score =  177 bits (448), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L+  PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKIKR-SKSMHLQECPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|44388|emb|CAA78671.1| ribosomal protein S7 [Mycobacterium leprae]
          Length = 153

 Score =  177 bits (448), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL+GNPQ+RGVC RVYT TPKKPNS LRKV + +LTS
Sbjct: 30  MPTIQQLVRKGRRDKI-GKVKTAALKGNPQRRGVCTRVYTSTPKKPNSRLRKVARVKLTS 88

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 89  QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 148

Query: 121 ERPK 124
           ++ K
Sbjct: 149 KKEK 152


>gi|296445415|ref|ZP_06887373.1| ribosomal protein S12 [Methylosinus trichosporium OB3b]
 gi|296257176|gb|EFH04245.1| ribosomal protein S12 [Methylosinus trichosporium OB3b]
          Length = 123

 Score =  177 bits (448), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 104/125 (83%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRK-GSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT++QLIRKPR+  ++R   K   L   PQKRGVC RVYT TPKKPNSALRKV K RLT
Sbjct: 1   MPTISQLIRKPRQPKTYRE--KSRHLGACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLT 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G EVI Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YG
Sbjct: 59  NGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYG 118

Query: 120 AERPK 124
           A+RPK
Sbjct: 119 AKRPK 123


>gi|253998009|ref|YP_003050072.1| 30S ribosomal protein S12 [Methylovorus sp. SIP3-4]
 gi|253984688|gb|ACT49545.1| ribosomal protein S12 [Methylovorus sp. SIP3-4]
          Length = 125

 Score =  177 bits (448), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR+      +KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRQKVVTK-SKVPALESCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD  GVK+RKQ+RS+YGA
Sbjct: 60  GYEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGSLDTAGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|126724856|ref|ZP_01740699.1| 30S ribosomal protein S12 [Rhodobacterales bacterium HTCC2150]
 gi|159042827|ref|YP_001531621.1| 30S ribosomal protein S12 [Dinoroseobacter shibae DFL 12]
 gi|189040457|sp|A8LM43|RS12_DINSH RecName: Full=30S ribosomal protein S12
 gi|126706020|gb|EBA05110.1| 30S ribosomal protein S12 [Rhodobacterales bacterium HTCC2150]
 gi|157910587|gb|ABV92020.1| 30S ribosomal protein S12 [Dinoroseobacter shibae DFL 12]
          Length = 123

 Score =  177 bits (448), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKVKR-SKSQHLESCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|291613231|ref|YP_003523388.1| ribosomal protein S12 [Sideroxydans lithotrophicus ES-1]
 gi|291583343|gb|ADE11001.1| ribosomal protein S12 [Sideroxydans lithotrophicus ES-1]
          Length = 125

 Score =  177 bits (448), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  R       +KV AL G+PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRTGRTAEV-TKSKVPALAGSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD  GVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGSLDTAGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|188996244|ref|YP_001930495.1| ribosomal protein S12 [Sulfurihydrogenibium sp. YO3AOP1]
 gi|226712661|sp|B2V7L8|RS12_SULSY RecName: Full=30S ribosomal protein S12
 gi|188931311|gb|ACD65941.1| ribosomal protein S12 [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 135

 Score =  177 bits (448), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+      +K  AL+GNPQKRGVC+RVYT TPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLVRKGRE-KVEKKSKAPALQGNPQKRGVCVRVYTTTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV  Y+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LDA GVK+RKQ+RS+YGA
Sbjct: 60  GYEVTCYIPGIGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAAGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|302877796|ref|YP_003846360.1| 30S ribosomal protein S12 [Gallionella capsiferriformans ES-2]
 gi|302580585|gb|ADL54596.1| ribosomal protein S12 [Gallionella capsiferriformans ES-2]
          Length = 124

 Score =  176 bits (447), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR       +KV AL  +PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKPRVAIVEK-SKVPALGSSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD  GVK+RKQ+RS+YG 
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGSLDTAGVKDRKQSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|89053066|ref|YP_508517.1| 30S ribosomal protein S12 [Jannaschia sp. CCS1]
 gi|119366778|sp|Q28UX0|RS12_JANSC RecName: Full=30S ribosomal protein S12
 gi|88862615|gb|ABD53492.1| SSU ribosomal protein S12P [Jannaschia sp. CCS1]
          Length = 123

 Score =  176 bits (447), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   + G PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKIKR-SKSQHMEGCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+R+Q RS+YGA
Sbjct: 60  GYEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|237755891|ref|ZP_04584484.1| ribosomal protein S12 [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691941|gb|EEP60956.1| ribosomal protein S12 [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 135

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+      +K  AL+GNPQKRGVC+RVYT TPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLVRKGRE-KVEKKSKAPALQGNPQKRGVCVRVYTTTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV  Y+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LDA GVK+RKQ+RS+YGA
Sbjct: 60  GYEVTCYIPGIGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAAGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|86137192|ref|ZP_01055770.1| 30S ribosomal protein S12 [Roseobacter sp. MED193]
 gi|85826516|gb|EAQ46713.1| 30S ribosomal protein S12 [Roseobacter sp. MED193]
          Length = 123

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKIKR-SKSMHLEQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|218885183|ref|YP_002434504.1| 30S ribosomal protein S12 [Desulfovibrio vulgaris str. 'Miyazaki
           F']
 gi|226708490|sp|B8DN92|RS12_DESVM RecName: Full=30S ribosomal protein S12
 gi|218756137|gb|ACL07036.1| ribosomal protein S12 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 123

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK   +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKERKAVLKR-KKTPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RG LD  GV++R+Q RS+YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIVRGTLDTAGVQDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|161986618|ref|YP_251638.2| 30S ribosomal protein S12 [Corynebacterium jeikeium K411]
 gi|260579278|ref|ZP_05847161.1| 30S ribosomal protein S12 [Corynebacterium jeikeium ATCC 43734]
 gi|90111776|sp|Q4JT37|RS12_CORJK RecName: Full=30S ribosomal protein S12
 gi|258602577|gb|EEW15871.1| 30S ribosomal protein S12 [Corynebacterium jeikeium ATCC 43734]
          Length = 123

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R       A   AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRHDKSTKVA-TAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y+++RG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVRDLPGVRYKIVRGSLDTQGVKDRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|254460296|ref|ZP_05073712.1| ribosomal protein S12 [Rhodobacterales bacterium HTCC2083]
 gi|206676885|gb|EDZ41372.1| ribosomal protein S12 [Rhodobacteraceae bacterium HTCC2083]
          Length = 123

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKIKR-SKSQHLEQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|114764150|ref|ZP_01443388.1| 30S ribosomal protein S12 [Pelagibaca bermudensis HTCC2601]
 gi|163745531|ref|ZP_02152891.1| 30S ribosomal protein S12 [Oceanibulbus indolifex HEL-45]
 gi|114543302|gb|EAU46318.1| 30S ribosomal protein S12 [Roseovarius sp. HTCC2601]
 gi|161382349|gb|EDQ06758.1| 30S ribosomal protein S12 [Oceanibulbus indolifex HEL-45]
          Length = 123

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L+  PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKVKR-SKSMHLQECPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|258651355|ref|YP_003200511.1| 30S ribosomal protein S12 [Nakamurella multipartita DSM 44233]
 gi|258554580|gb|ACV77522.1| ribosomal protein S12 [Nakamurella multipartita DSM 44233]
          Length = 124

 Score =  176 bits (447), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R        K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRTDKI-GKTKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVKNRKQARSRYGA
Sbjct: 60  LVEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|255324719|ref|ZP_05365833.1| ribosomal protein S12 [Corynebacterium tuberculostearicum SK141]
 gi|311740093|ref|ZP_07713927.1| 30S ribosomal protein S12 [Corynebacterium pseudogenitalium ATCC
           33035]
 gi|255298194|gb|EET77497.1| ribosomal protein S12 [Corynebacterium tuberculostearicum SK141]
 gi|311305166|gb|EFQ81235.1| 30S ribosomal protein S12 [Corynebacterium pseudogenitalium ATCC
           33035]
          Length = 123

 Score =  176 bits (446), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 84/122 (68%), Positives = 102/122 (83%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R    R      AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTIQQLVRKGRHDK-RKEVSTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGALDTQGVKDRKQARSRYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|227494540|ref|ZP_03924856.1| ribosomal protein S12 [Actinomyces coleocanis DSM 15436]
 gi|226832274|gb|EEH64657.1| ribosomal protein S12 [Actinomyces coleocanis DSM 15436]
          Length = 124

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R  + RA A   AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIQQLVRKGRS-TKRAKAATPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+YR+IRG LD QGV+ R+Q RS YGA
Sbjct: 60  GVEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYRIIRGALDTQGVRGRQQGRSHYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|84685442|ref|ZP_01013340.1| 30S ribosomal protein S12 [Maritimibacter alkaliphilus HTCC2654]
 gi|84666599|gb|EAQ13071.1| 30S ribosomal protein S12 [Rhodobacterales bacterium HTCC2654]
          Length = 123

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKVKR-SKSQHLESCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GYEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|113869441|ref|YP_727930.1| 30S ribosomal protein S12 [Ralstonia eutropha H16]
 gi|194291032|ref|YP_002006939.1| 30S ribosomal protein s12 [Cupriavidus taiwanensis LMG 19424]
 gi|122946534|sp|Q0K609|RS12_RALEH RecName: Full=30S ribosomal protein S12
 gi|226708483|sp|B3R7T3|RS12_CUPTR RecName: Full=30S ribosomal protein S12
 gi|113528217|emb|CAJ94562.1| SSU ribosomal protein S12 [Ralstonia eutropha H16]
 gi|193224867|emb|CAQ70878.1| 30S ribosomal subunit protein S12 [Cupriavidus taiwanensis LMG
           19424]
          Length = 125

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR       +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRVSEV-VKSKSPALENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|307328020|ref|ZP_07607201.1| ribosomal protein S12 [Streptomyces violaceusniger Tu 4113]
 gi|306886325|gb|EFN17330.1| ribosomal protein S12 [Streptomyces violaceusniger Tu 4113]
          Length = 123

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL G+PQ+RG C RV+T TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIQQLVRKGRQDKVEK-NKTPALAGSPQRRGTCTRVFTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AYVPGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYVPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|114771274|ref|ZP_01448694.1| 30S ribosomal protein S12 [alpha proteobacterium HTCC2255]
 gi|114548199|gb|EAU51086.1| 30S ribosomal protein S12 [alpha proteobacterium HTCC2255]
          Length = 123

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKIKR-SKSQHLESCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|117927510|ref|YP_872061.1| 30S ribosomal protein S12 [Acidothermus cellulolyticus 11B]
 gi|158512361|sp|A0LRL5|RS12_ACIC1 RecName: Full=30S ribosomal protein S12
 gi|117647973|gb|ABK52075.1| SSU ribosomal protein S12P [Acidothermus cellulolyticus 11B]
          Length = 124

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    +  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRQAKA-SKTKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGV+NRKQ RSRYGA
Sbjct: 60  GVEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDTQGVRNRKQGRSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|99080080|ref|YP_612234.1| 30S ribosomal protein S12 [Ruegeria sp. TM1040]
 gi|163739430|ref|ZP_02146840.1| 30S ribosomal protein S12 [Phaeobacter gallaeciensis BS107]
 gi|163740224|ref|ZP_02147618.1| 30S ribosomal protein S12 [Phaeobacter gallaeciensis 2.10]
 gi|259415902|ref|ZP_05739822.1| 30S ribosomal protein S12 [Silicibacter sp. TrichCH4B]
 gi|119366809|sp|Q1GK44|RS12_SILST RecName: Full=30S ribosomal protein S12
 gi|99036360|gb|ABF62972.1| SSU ribosomal protein S12P [Ruegeria sp. TM1040]
 gi|161386082|gb|EDQ10457.1| 30S ribosomal protein S12 [Phaeobacter gallaeciensis 2.10]
 gi|161387183|gb|EDQ11542.1| 30S ribosomal protein S12 [Phaeobacter gallaeciensis BS107]
 gi|259347341|gb|EEW59118.1| 30S ribosomal protein S12 [Silicibacter sp. TrichCH4B]
          Length = 123

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKVKR-SKSMHLEQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|289548396|ref|YP_003473384.1| ribosomal protein S12 [Thermocrinis albus DSM 14484]
 gi|289182013|gb|ADC89257.1| ribosomal protein S12 [Thermocrinis albus DSM 14484]
          Length = 132

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 107/124 (86%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT NQL+++ R+   +  +K  AL+GNPQKRGVC+RVYTVTPKKPNSALRKV + RL++
Sbjct: 1   MPTFNQLVKQGRE-KKKKKSKAPALQGNPQKRGVCVRVYTVTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LDA GV NR+Q+RS+YG 
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAAGVANRRQSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|295837033|ref|ZP_06823966.1| ribosomal protein S12 [Streptomyces sp. SPB74]
 gi|295826328|gb|EDY45900.2| ribosomal protein S12 [Streptomyces sp. SPB74]
          Length = 185

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+ QL+RK R+       K  AL G+PQ+RGVC RV+T TPKKPNSALRKV + RLTS
Sbjct: 63  VPTIQQLVRKGRQDKVEK-NKTPALDGSPQRRGVCTRVFTTTPKKPNSALRKVARVRLTS 121

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 122 GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 181

Query: 121 ERPK 124
           ++ K
Sbjct: 182 KKEK 185


>gi|260425714|ref|ZP_05779694.1| ribosomal protein S12 [Citreicella sp. SE45]
 gi|260423654|gb|EEX16904.1| ribosomal protein S12 [Citreicella sp. SE45]
          Length = 123

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKVKR-SKSQHLEQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|256831822|ref|YP_003160549.1| 30S ribosomal protein S12 [Jonesia denitrificans DSM 20603]
 gi|256685353|gb|ACV08246.1| ribosomal protein S12 [Jonesia denitrificans DSM 20603]
          Length = 124

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R       +K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +L+S
Sbjct: 1   MPTIQQLVRKGRTSKV-GKSKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|73542869|ref|YP_297389.1| 30S ribosomal protein S12 [Ralstonia eutropha JMP134]
 gi|90111797|sp|Q46WD8|RS12_RALEJ RecName: Full=30S ribosomal protein S12
 gi|72120282|gb|AAZ62545.1| SSU ribosomal protein S12P [Ralstonia eutropha JMP134]
          Length = 125

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR       +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRVSEV-IKSKSPALENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|325294391|ref|YP_004280905.1| ribosomal protein S12 [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325064839|gb|ADY72846.1| ribosomal protein S12 [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 126

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   +  +K  AL+GNPQKRGVC+RV+T TPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLVRKGREKKVKR-SKAPALQGNPQKRGVCVRVFTTTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA GV+ RKQ+RS+YG 
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDAAGVEGRKQSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|15077873|gb|AAK83388.1|AF398882_1 ribosomal protein S12 [Mycobacterium tuberculosis]
          Length = 124

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    +  K  AL+G+PQ+RGVC RVYT TP+KPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRRDKI-SKVKTAALKGSPQRRGVCTRVYTTTPRKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRV DLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVTDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|317488576|ref|ZP_07947121.1| ribosomal protein S12 [Eggerthella sp. 1_3_56FAA]
 gi|325832040|ref|ZP_08165137.1| ribosomal protein S12 [Eggerthella sp. HGA1]
 gi|316912318|gb|EFV33882.1| ribosomal protein S12 [Eggerthella sp. 1_3_56FAA]
 gi|325486361|gb|EGC88813.1| ribosomal protein S12 [Eggerthella sp. HGA1]
          Length = 123

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK +    +K  AL+GNPQKRGVC RV+T TPKKPNSALRKV + RL +
Sbjct: 1   MPTINQLVRKGRKKAVDK-SKTPALKGNPQKRGVCTRVFTTTPKKPNSALRKVCRVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V+L GGRVKDLPGV+Y+VIR  LD   V NRKQARSRYGA
Sbjct: 60  GMEVTAYIPGVGHNLQEHSMVLLRGGRVKDLPGVRYKVIRAALDCAAVDNRKQARSRYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|254510049|ref|ZP_05122116.1| ribosomal protein S12 [Rhodobacteraceae bacterium KLH11]
 gi|221533760|gb|EEE36748.1| ribosomal protein S12 [Rhodobacteraceae bacterium KLH11]
          Length = 132

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 10  MPTIQQLIRKPRQPKVKR-SKSMHLEQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 68

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 69  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 128

Query: 121 ERPK 124
           +RPK
Sbjct: 129 KRPK 132


>gi|83854985|ref|ZP_00948515.1| 30S ribosomal protein S12 [Sulfitobacter sp. NAS-14.1]
 gi|83941507|ref|ZP_00953969.1| 30S ribosomal protein S12 [Sulfitobacter sp. EE-36]
 gi|254485533|ref|ZP_05098738.1| ribosomal protein S12 [Roseobacter sp. GAI101]
 gi|83842828|gb|EAP81995.1| 30S ribosomal protein S12 [Sulfitobacter sp. NAS-14.1]
 gi|83847327|gb|EAP85202.1| 30S ribosomal protein S12 [Sulfitobacter sp. EE-36]
 gi|214042402|gb|EEB83040.1| ribosomal protein S12 [Roseobacter sp. GAI101]
          Length = 123

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L+  PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKIKR-SKSMHLQECPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|296392975|ref|YP_003657859.1| 30S ribosomal protein S12 [Segniliparus rotundus DSM 44985]
 gi|296180122|gb|ADG97028.1| ribosomal protein S12 [Segniliparus rotundus DSM 44985]
          Length = 124

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 105/126 (83%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPR--KGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           MPT+NQL+RK R  KG+     K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +L
Sbjct: 1   MPTINQLVRKGRQPKGNR---VKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           TS VEV AY+PGE HNLQEHS+V++ GGRV+DLPGV+Y++IRG LD QGVKNRKQARSRY
Sbjct: 58  TSQVEVTAYIPGEKHNLQEHSMVLVRGGRVRDLPGVRYKIIRGALDTQGVKNRKQARSRY 117

Query: 119 GAERPK 124
           GA+R K
Sbjct: 118 GAKREK 123


>gi|83949802|ref|ZP_00958535.1| 30S ribosomal protein S12 [Roseovarius nubinhibens ISM]
 gi|89070563|ref|ZP_01157852.1| 30S ribosomal protein S12 [Oceanicola granulosus HTCC2516]
 gi|260432424|ref|ZP_05786395.1| ribosomal protein S12 [Silicibacter lacuscaerulensis ITI-1157]
 gi|83837701|gb|EAP76997.1| 30S ribosomal protein S12 [Roseovarius nubinhibens ISM]
 gi|89043870|gb|EAR50068.1| 30S ribosomal protein S12 [Oceanicola granulosus HTCC2516]
 gi|260416252|gb|EEX09511.1| ribosomal protein S12 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 123

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKVKR-SKSMHLEQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GYEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|329890194|ref|ZP_08268537.1| ribosomal protein S12 [Brevundimonas diminuta ATCC 11568]
 gi|328845495|gb|EGF95059.1| ribosomal protein S12 [Brevundimonas diminuta ATCC 11568]
          Length = 124

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 103/125 (82%), Gaps = 2/125 (1%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT- 59
           MPT+NQLIRKPRK       KV AL G+PQ+RGVC RVYT TPKKPNSALRKV K RL  
Sbjct: 1   MPTINQLIRKPRKPKP-VRNKVPALEGSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLAK 59

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +GVE + Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS YG
Sbjct: 60  NGVEAVCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSHYG 119

Query: 120 AERPK 124
           A+RPK
Sbjct: 120 AKRPK 124


>gi|56698323|ref|YP_168696.1| 30S ribosomal protein S12 [Ruegeria pomeroyi DSS-3]
 gi|84499866|ref|ZP_00998132.1| ribosomal protein S12 [Oceanicola batsensis HTCC2597]
 gi|126732281|ref|ZP_01748081.1| 30S ribosomal protein S12 [Sagittula stellata E-37]
 gi|62287365|sp|Q5LMR2|RS12_SILPO RecName: Full=30S ribosomal protein S12
 gi|56680060|gb|AAV96726.1| ribosomal protein S12 [Ruegeria pomeroyi DSS-3]
 gi|84391800|gb|EAQ04068.1| ribosomal protein S12 [Oceanicola batsensis HTCC2597]
 gi|126707150|gb|EBA06216.1| 30S ribosomal protein S12 [Sagittula stellata E-37]
          Length = 123

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKVKR-SKSQHLEQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS+YGA
Sbjct: 60  GYEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|296130500|ref|YP_003637750.1| ribosomal protein S12 [Cellulomonas flavigena DSM 20109]
 gi|296022315|gb|ADG75551.1| ribosomal protein S12 [Cellulomonas flavigena DSM 20109]
          Length = 122

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 103/122 (84%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+      +K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIQQLVRKGRQAKTNK-SKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQGVKNRKQARSRYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|145588237|ref|YP_001154834.1| 30S ribosomal protein S12 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|189040471|sp|A4SUV6|RS12_POLSQ RecName: Full=30S ribosomal protein S12
 gi|145046643|gb|ABP33270.1| SSU ribosomal protein S12P [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 126

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPR       +K  AL  +PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKPR-SRLIVKSKSPALENSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|253995713|ref|YP_003047777.1| 30S ribosomal protein S12 [Methylotenera mobilis JLW8]
 gi|253982392|gb|ACT47250.1| ribosomal protein S12 [Methylotenera mobilis JLW8]
          Length = 128

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR       +KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRVKVVTK-SKVPALEACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD  GVK+RKQ+RS+YGA
Sbjct: 60  GYEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGSLDTAGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|296137311|ref|YP_003644553.1| ribosomal protein S12 [Thiomonas intermedia K12]
 gi|294341615|emb|CAZ90032.1| 30S ribosomal protein S12 [Thiomonas sp. 3As]
 gi|295797433|gb|ADG32223.1| ribosomal protein S12 [Thiomonas intermedia K12]
          Length = 124

 Score =  175 bits (444), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R PR  S R  +K  A+  +PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRSPRV-SERIKSKSPAMENSPQRRGVCTRVYTTTPKKPNSALRKVAKIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD Q VK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDLQAVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|68264532|emb|CAI38020.1| 30S ribosomal protein S12 [Corynebacterium jeikeium K411]
          Length = 181

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R       A   AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 59  MPTIQQLVRKGRHDKSTKVA-TAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 117

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y+++RG LD QGVK+RKQARSRYGA
Sbjct: 118 GIEVSAYIPGEGHNLQEHSMVLVRGGRVRDLPGVRYKIVRGSLDTQGVKDRKQARSRYGA 177

Query: 121 ERPK 124
           ++ K
Sbjct: 178 KKEK 181


>gi|163796925|ref|ZP_02190882.1| Ribosomal protein S12 [alpha proteobacterium BAL199]
 gi|159177914|gb|EDP62463.1| Ribosomal protein S12 [alpha proteobacterium BAL199]
          Length = 123

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI   RK   +   KV AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLINHGRKVPVKR-NKVPALQACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD QGVK+R+Q RS+YGA
Sbjct: 60  GFEVISYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTQGVKDRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|77462254|ref|YP_351758.1| 30S ribosomal protein S12 [Rhodobacter sphaeroides 2.4.1]
 gi|126461116|ref|YP_001042230.1| 30S ribosomal protein S12 [Rhodobacter sphaeroides ATCC 17029]
 gi|126461130|ref|YP_001042244.1| 30S ribosomal protein S12 [Rhodobacter sphaeroides ATCC 17029]
 gi|146278573|ref|YP_001168732.1| 30S ribosomal protein S12 [Rhodobacter sphaeroides ATCC 17025]
 gi|90111798|sp|Q3J5S7|RS12_RHOS4 RecName: Full=30S ribosomal protein S12
 gi|158513429|sp|A3PGJ2|RS12_RHOS1 RecName: Full=30S ribosomal protein S12
 gi|166231880|sp|A4WVL3|RS12_RHOS5 RecName: Full=30S ribosomal protein S12
 gi|77386672|gb|ABA77857.1| SSU ribosomal protein S12P [Rhodobacter sphaeroides 2.4.1]
 gi|126102780|gb|ABN75458.1| SSU ribosomal protein S12P [Rhodobacter sphaeroides ATCC 17029]
 gi|126102794|gb|ABN75472.1| SSU ribosomal protein S12P [Rhodobacter sphaeroides ATCC 17029]
 gi|145556814|gb|ABP71427.1| SSU ribosomal protein S12P [Rhodobacter sphaeroides ATCC 17025]
          Length = 123

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   R  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPREPK-RVRSKSQHLESCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+R+Q RS+YGA
Sbjct: 60  GFEVISYIPGEKHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|152964651|ref|YP_001360435.1| 30S ribosomal protein S12 [Kineococcus radiotolerans SRS30216]
 gi|189040464|sp|A6W5T2|RS12_KINRD RecName: Full=30S ribosomal protein S12
 gi|151359168|gb|ABS02171.1| ribosomal protein S12 [Kineococcus radiotolerans SRS30216]
          Length = 124

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGREDKV-VKTKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|118616547|ref|YP_904879.1| 30S ribosomal protein S12 [Mycobacterium ulcerans Agy99]
 gi|158512377|sp|A0PM39|RS12_MYCUA RecName: Full=30S ribosomal protein S12
 gi|118568657|gb|ABL03408.1| 30S ribosomal protein S12, RpsL [Mycobacterium ulcerans Agy99]
          Length = 124

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL+ +PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRRDKI-GKVKTAALKRSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|320531952|ref|ZP_08032854.1| ribosomal protein S12 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|325068021|ref|ZP_08126694.1| ribosomal protein S12 [Actinomyces oris K20]
 gi|326773955|ref|ZP_08233237.1| ribosomal protein S12 [Actinomyces viscosus C505]
 gi|329945677|ref|ZP_08293407.1| ribosomal protein S12 [Actinomyces sp. oral taxon 170 str. F0386]
 gi|320135831|gb|EFW27877.1| ribosomal protein S12 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|326636094|gb|EGE36998.1| ribosomal protein S12 [Actinomyces viscosus C505]
 gi|328528485|gb|EGF55459.1| ribosomal protein S12 [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 124

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R  + R+ +K  AL+ +PQ+RGVC RVYT TPKKPNSALRKV + RL++
Sbjct: 1   MPTIQQLVRKGR-STKRSASKTPALKASPQRRGVCTRVYTTTPKKPNSALRKVARVRLST 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGVK R+QARS+YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVKGRQQARSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|296119196|ref|ZP_06837766.1| ribosomal protein S12 [Corynebacterium ammoniagenes DSM 20306]
 gi|295967822|gb|EFG81077.1| ribosomal protein S12 [Corynebacterium ammoniagenes DSM 20306]
          Length = 123

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 103/122 (84%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R  + R      AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTIQQLVRKGRN-TPRTKVATAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGSLDTQGVKDRKQARSRYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|33575063|emb|CAE30526.1| 30S ribosomal protein S12 [Bordetella bronchiseptica RB50]
          Length = 146

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RKPR+ S    +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 22  MPTISQLVRKPREVSI-IKSKSPALENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 80

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 81  GYEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 140

Query: 121 ERPK 124
           +RPK
Sbjct: 141 KRPK 144


>gi|33594474|ref|NP_882118.1| 30S ribosomal protein S12 [Bordetella pertussis Tohama I]
 gi|33594746|ref|NP_882389.1| 30S ribosomal protein S12 [Bordetella parapertussis 12822]
 gi|161609284|ref|NP_886577.2| 30S ribosomal protein S12 [Bordetella bronchiseptica RB50]
 gi|187476534|ref|YP_784558.1| 30S ribosomal protein S12 [Bordetella avium 197N]
 gi|293602640|ref|ZP_06685082.1| 30S ribosomal protein S12 [Achromobacter piechaudii ATCC 43553]
 gi|311109617|ref|YP_003982470.1| 30S ribosomal protein S12 [Achromobacter xylosoxidans A8]
 gi|52783396|sp|Q7VTD7|RS12_BORPE RecName: Full=30S ribosomal protein S12
 gi|52783397|sp|Q7W2G0|RS12_BORPA RecName: Full=30S ribosomal protein S12
 gi|52783398|sp|Q7WRC9|RS12_BORBR RecName: Full=30S ribosomal protein S12
 gi|110825781|sp|Q2L2H8|RS12_BORA1 RecName: Full=30S ribosomal protein S12
 gi|33564549|emb|CAE43866.1| 30S ribosomal protein S12 [Bordetella pertussis Tohama I]
 gi|33564822|emb|CAE39765.1| 30S ribosomal protein S12 [Bordetella parapertussis]
 gi|115421120|emb|CAJ47604.1| 30S ribosomal protein S12 [Bordetella avium 197N]
 gi|292818950|gb|EFF77989.1| 30S ribosomal protein S12 [Achromobacter piechaudii ATCC 43553]
 gi|310764306|gb|ADP19755.1| ribosomal protein S12 [Achromobacter xylosoxidans A8]
 gi|317401584|gb|EFV82212.1| 30S ribosomal protein S12 [Achromobacter xylosoxidans C54]
          Length = 125

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RKPR+ S    +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTISQLVRKPREVSI-IKSKSPALENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GYEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|225850730|ref|YP_002730964.1| ribosomal protein S12 [Persephonella marina EX-H1]
 gi|254811100|sp|C0QQL8|RS12_PERMH RecName: Full=30S ribosomal protein S12
 gi|225644934|gb|ACO03120.1| ribosomal protein S12 [Persephonella marina EX-H1]
          Length = 125

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   +  +K  AL GNPQKRGVC+RVYT TPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLVRKGRE-KVKKKSKAPALEGNPQKRGVCVRVYTTTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV  Y+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LDA GVK+RKQ+RS+YG 
Sbjct: 60  GYEVTCYIPGIGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAAGVKDRKQSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|119383505|ref|YP_914561.1| 30S ribosomal protein S12 [Paracoccus denitrificans PD1222]
 gi|294675851|ref|YP_003576466.1| 30S ribosomal protein S12 [Rhodobacter capsulatus SB 1003]
 gi|158512587|sp|A1B021|RS12_PARDP RecName: Full=30S ribosomal protein S12
 gi|119373272|gb|ABL68865.1| SSU ribosomal protein S12P [Paracoccus denitrificans PD1222]
 gi|294474671|gb|ADE84059.1| 30S ribosomal protein S12 [Rhodobacter capsulatus SB 1003]
          Length = 123

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   +  +K   L+  PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPRQPKVQR-SKSQHLQSCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGE HNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+R+Q RS+YGA
Sbjct: 60  GFEVISYIPGEKHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|217077278|ref|YP_002334996.1| 30S ribosomal protein S12 [Thermosipho africanus TCF52B]
 gi|226712663|sp|B7IHU1|RS12_THEAB RecName: Full=30S ribosomal protein S12
 gi|217037133|gb|ACJ75655.1| ribosomal protein S12 [Thermosipho africanus TCF52B]
          Length = 124

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 107/124 (86%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  RK   +  +K  AL+G+PQKRGVC+RV T+TPKKPNSALRK+ + RL++
Sbjct: 1   MPTINQLVRHGRK-VIKEKSKSPALQGHPQKRGVCVRVSTMTPKKPNSALRKIARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPG++Y++IRG LDA GV+NRKQ+RS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGIRYKIIRGALDAAGVENRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|149179536|ref|ZP_01858077.1| 30S ribosomal protein S12 [Planctomyces maris DSM 8797]
 gi|148841624|gb|EDL56046.1| 30S ribosomal protein S12 [Planctomyces maris DSM 8797]
          Length = 123

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPRK    + +K   L G PQKRGVCL+V TVTPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLIRKPRKKQI-SKSKTPLLEGCPQKRGVCLQVKTVTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y+VIRGVLD  GV +R+QARSRYG 
Sbjct: 60  GKELTAYIPGEGHNLQEHSIVLVRGGRVRDLPGVRYKVIRGVLDTLGVNDRRQARSRYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|34499646|ref|NP_903861.1| 30S ribosomal protein S12 [Chromobacterium violaceum ATCC 12472]
 gi|52783386|sp|Q7NQE8|RS12_CHRVO RecName: Full=30S ribosomal protein S12
 gi|34105496|gb|AAQ61851.1| 30S ribosomal protein S12 [Chromobacterium violaceum ATCC 12472]
          Length = 123

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R  +  A +KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRV-AITAKSKVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|94312258|ref|YP_585468.1| 30S ribosomal protein S12 [Cupriavidus metallidurans CH34]
 gi|119366793|sp|Q1LI27|RS12_RALME RecName: Full=30S ribosomal protein S12
 gi|93356110|gb|ABF10199.1| 30S ribosomal subunit protein S12 [Cupriavidus metallidurans CH34]
          Length = 125

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPR       +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKPRVSEV-IKSKSPALENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+R+QARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRRQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|309812305|ref|ZP_07706060.1| ribosomal protein S12 [Dermacoccus sp. Ellin185]
 gi|308433610|gb|EFP57487.1| ribosomal protein S12 [Dermacoccus sp. Ellin185]
          Length = 124

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+      A   AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTINQLVRKGRQDKA-TKASTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVK R QARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDTQGVKGRNQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|312200025|ref|YP_004020086.1| ribosomal protein S12 [Frankia sp. EuI1c]
 gi|311231361|gb|ADP84216.1| ribosomal protein S12 [Frankia sp. EuI1c]
          Length = 124

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIQQLVRKGRQDKVEKT-KTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGV+NRKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGALDTQGVRNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|163859278|ref|YP_001633576.1| 30S ribosomal protein S12 [Bordetella petrii DSM 12804]
 gi|226708466|sp|A9IJ10|RS12_BORPD RecName: Full=30S ribosomal protein S12
 gi|163263006|emb|CAP45309.1| 30S ribosomal protein S12 [Bordetella petrii]
          Length = 125

 Score =  174 bits (442), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RKPR+ S    +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTISQLVRKPREVSV-IKSKSPALENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GYEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|319789233|ref|YP_004150866.1| ribosomal protein S12 [Thermovibrio ammonificans HB-1]
 gi|317113735|gb|ADU96225.1| ribosomal protein S12 [Thermovibrio ammonificans HB-1]
          Length = 126

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   +  +K  AL+GNPQKRGVC+RV+T TPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLVRKGREKKVKR-SKAPALQGNPQKRGVCVRVFTTTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA GV+ R+Q+RS+YG 
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDAAGVEGRRQSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|254294445|ref|YP_003060468.1| ribosomal protein S12 [Hirschia baltica ATCC 49814]
 gi|254042976|gb|ACT59771.1| ribosomal protein S12 [Hirschia baltica ATCC 49814]
          Length = 123

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+   R   KV AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTIQQLIRKPRQDKARR-NKVPALKACPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E I Y+PGEGHNLQEHSVV++ GGRV+DLPGV+Y ++RGVLD QGVK+RK+ RS YG 
Sbjct: 60  GYESICYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYTILRGVLDTQGVKDRKKRRSHYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|269219014|ref|ZP_06162868.1| ribosomal protein S12 [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269212125|gb|EEZ78465.1| ribosomal protein S12 [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 144

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+ QL+RK R       +K  AL+G+PQ+RGVC RV+T TPKKPNSALRKV + RL+S
Sbjct: 21  VPTIQQLVRKGRSSKV-GKSKTPALKGSPQRRGVCTRVFTTTPKKPNSALRKVARVRLSS 79

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y+++RG LD QGVKNR+QARSRYGA
Sbjct: 80  GIEVTAYIPGEGHNLQEHSIVLVRGGRVRDLPGVRYKIVRGALDTQGVKNRQQARSRYGA 139

Query: 121 ERPK 124
           ++ K
Sbjct: 140 KKEK 143


>gi|226939181|ref|YP_002794252.1| 30S ribosomal protein S12 [Laribacter hongkongensis HLHK9]
 gi|254811091|sp|C1DAR2|RS12_LARHH RecName: Full=30S ribosomal protein S12
 gi|226714105|gb|ACO73243.1| RpsL [Laribacter hongkongensis HLHK9]
          Length = 123

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R  + +A +KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRL-AIKAKSKVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|86739290|ref|YP_479690.1| 30S ribosomal protein S12 [Frankia sp. CcI3]
 gi|158317796|ref|YP_001510304.1| 30S ribosomal protein S12 [Frankia sp. EAN1pec]
 gi|162139920|ref|YP_711335.2| 30S ribosomal protein S12 [Frankia alni ACN14a]
 gi|108884797|sp|Q2JFI1|RS12_FRASC RecName: Full=30S ribosomal protein S12
 gi|158564086|sp|Q0RRS6|RS12_FRAAA RecName: Full=30S ribosomal protein S12
 gi|226708505|sp|A8LC61|RS12_FRASN RecName: Full=30S ribosomal protein S12
 gi|86566152|gb|ABD09961.1| SSU ribosomal protein S12P [Frankia sp. CcI3]
 gi|158113201|gb|ABW15398.1| ribosomal protein S12 [Frankia sp. EAN1pec]
          Length = 124

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL S
Sbjct: 1   MPTIQQLVRKGRQDKVEKT-KTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLNS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGV+NRKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQGVRNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|257790713|ref|YP_003181319.1| 30S ribosomal protein S12 [Eggerthella lenta DSM 2243]
 gi|257474610|gb|ACV54930.1| ribosomal protein S12 [Eggerthella lenta DSM 2243]
          Length = 123

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK +    +K  AL+GNPQKRGVC RV+T TPKKPNSALRKV + RL +
Sbjct: 1   MPTINQLVRKGRKKAVDK-SKTPALKGNPQKRGVCTRVFTTTPKKPNSALRKVCRVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V+L GGRV+DLPGV+Y+VIR  LD   V NRKQARSRYGA
Sbjct: 60  GMEVTAYIPGVGHNLQEHSMVLLRGGRVRDLPGVRYKVIRAALDCAAVDNRKQARSRYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|30249995|ref|NP_842065.1| 30S ribosomal protein S12 [Nitrosomonas europaea ATCC 19718]
 gi|52783401|sp|Q82T68|RS12_NITEU RecName: Full=30S ribosomal protein S12
 gi|30139102|emb|CAD85966.1| Ribosomal protein S12 [Nitrosomonas europaea ATCC 19718]
          Length = 125

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RKPRK   R  +KV AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLVRKPRKAK-RTKSKVPALESCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG+
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQARSKYGS 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|72163050|ref|YP_290707.1| 30S ribosomal protein S12 [Thermobifida fusca YX]
 gi|90111826|sp|Q47LI8|RS12_THEFY RecName: Full=30S ribosomal protein S12
 gi|71916782|gb|AAZ56684.1| SSU ribosomal protein S12P [Thermobifida fusca YX]
          Length = 123

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK RK    +  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIQQLVRKGRKTKV-SKNKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+YR++RG LD QGV+NRKQARSRYGA
Sbjct: 60  QIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYRIVRGALDTQGVRNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|227505191|ref|ZP_03935240.1| 30S ribosomal protein S12 [Corynebacterium striatum ATCC 6940]
 gi|227198219|gb|EEI78267.1| 30S ribosomal protein S12 [Corynebacterium striatum ATCC 6940]
          Length = 123

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/122 (68%), Positives = 102/122 (83%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R    R+     AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRHDK-RSKVATAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQE S+V++ GGRVKDLPGV+Y++IRG LD QGVK+RKQARSRYGA
Sbjct: 60  GIEVSAYIPGEGHNLQERSMVLVRGGRVKDLPGVRYKIIRGALDTQGVKDRKQARSRYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|206901860|ref|YP_002250696.1| ribosomal protein S12 [Dictyoglomus thermophilum H-6-12]
 gi|226708491|sp|B5YDT8|RS12_DICT6 RecName: Full=30S ribosomal protein S12
 gi|206740963|gb|ACI20021.1| ribosomal protein S12 [Dictyoglomus thermophilum H-6-12]
          Length = 128

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R+   R  +K  AL GNPQKRGVC+RV T+TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKGREPKERK-SKSPALMGNPQKRGVCIRVTTMTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDA GV+ RKQ RS+YG 
Sbjct: 60  GVEVWAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGALDAAGVEGRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|238928160|ref|ZP_04659920.1| ribosomal protein S12 [Selenomonas flueggei ATCC 43531]
 gi|304438357|ref|ZP_07398298.1| 30S ribosomal protein S12 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|238884120|gb|EEQ47758.1| ribosomal protein S12 [Selenomonas flueggei ATCC 43531]
 gi|304368723|gb|EFM22407.1| 30S ribosomal protein S12 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 125

 Score =  174 bits (441), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK S    +K  AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKSRK-SLEEKSKAPALKNSPQKRGVCTRVYTSTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV++R QARS+YGA
Sbjct: 60  SIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGSLDTAGVQDRAQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|254418803|ref|ZP_05032527.1| ribosomal protein S12 [Brevundimonas sp. BAL3]
 gi|196184980|gb|EDX79956.1| ribosomal protein S12 [Brevundimonas sp. BAL3]
          Length = 124

 Score =  174 bits (441), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 102/125 (81%), Gaps = 2/125 (1%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT- 59
           MPT+NQLIRKPRK       KV AL G+PQ+RGVC RVYT TPKKPNSALRKV K RL  
Sbjct: 1   MPTINQLIRKPRKPKP-TRNKVPALEGSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLAK 59

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G E + Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS YG
Sbjct: 60  NGYEAVCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSHYG 119

Query: 120 AERPK 124
           A+RPK
Sbjct: 120 AKRPK 124


>gi|63020534|gb|AAY26150.1| ribosomal protein S12 [Streptomyces fradiae]
          Length = 132

 Score =  174 bits (441), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+ QL+RK R+       K  AL G+PQ+RGVC RV+T TPKKPNSALRKV + RLTS
Sbjct: 10  VPTIQQLVRKGRQDKVEK-NKTPALEGSPQRRGVCTRVFTTTPKKPNSALRKVARVRLTS 68

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GG VKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 69  GIEVTAYIPGEGHNLQEHSIVLVRGGGVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGA 128

Query: 121 ERPK 124
           ++ K
Sbjct: 129 KKEK 132


>gi|217967364|ref|YP_002352870.1| 30S ribosomal protein S12 [Dictyoglomus turgidum DSM 6724]
 gi|226708492|sp|B8E1C8|RS12_DICTD RecName: Full=30S ribosomal protein S12
 gi|217336463|gb|ACK42256.1| ribosomal protein S12 [Dictyoglomus turgidum DSM 6724]
          Length = 128

 Score =  174 bits (441), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R+   R  +K  AL GNPQKRGVC+RV T+TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKGREPKERK-SKSPALMGNPQKRGVCIRVTTMTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDA GV+ R+Q RS+YGA
Sbjct: 60  GIEVWAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGALDAAGVEGRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|124268632|ref|YP_001022636.1| 30S ribosomal protein S12 [Methylibium petroleiphilum PM1]
 gi|158512809|sp|A2SLG2|RS12_METPP RecName: Full=30S ribosomal protein S12
 gi|124261407|gb|ABM96401.1| SSU ribosomal protein S12P [Methylibium petroleiphilum PM1]
          Length = 125

 Score =  174 bits (441), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  R+      +K  A++G PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRHGRQTEV-TKSKSPAMQGGPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|20808665|ref|NP_623836.1| 30S ribosomal protein S12 [Thermoanaerobacter tengcongensis MB4]
 gi|22096100|sp|Q8R7U9|RS12_THETN RecName: Full=30S ribosomal protein S12
 gi|20517300|gb|AAM25440.1| Ribosomal protein S12 [Thermoanaerobacter tengcongensis MB4]
          Length = 124

 Score =  174 bits (441), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQL+R  R+ S +  +   AL+GNPQKRGVC+ V T TPKKPNSALRK+ + RLT+
Sbjct: 1   MPTVNQLVRFGRQ-SVKKKSAAPALQGNPQKRGVCVVVRTTTPKKPNSALRKIARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA GV NRKQARSRYGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDAAGVANRKQARSRYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|302382902|ref|YP_003818725.1| ribosomal protein S12 [Brevundimonas subvibrioides ATCC 15264]
 gi|302193530|gb|ADL01102.1| ribosomal protein S12 [Brevundimonas subvibrioides ATCC 15264]
          Length = 124

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 101/125 (80%), Gaps = 2/125 (1%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT- 59
           MPT+NQLIRKPRK       KV AL G+PQ+RGVC RVYT TPKKPNSALRKV K RL  
Sbjct: 1   MPTINQLIRKPRKPKP-VRNKVPALEGSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLAK 59

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           SG E + Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGVK+RKQ RS YG
Sbjct: 60  SGYEAVCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSHYG 119

Query: 120 AERPK 124
            +RPK
Sbjct: 120 TKRPK 124


>gi|258542023|ref|YP_003187456.1| 30S ribosomal protein S12 [Acetobacter pasteurianus IFO 3283-01]
 gi|329114220|ref|ZP_08242982.1| 30S ribosomal protein S12 [Acetobacter pomorum DM001]
 gi|256633101|dbj|BAH99076.1| SSU ribosomal protein S12P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636158|dbj|BAI02127.1| SSU ribosomal protein S12P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639213|dbj|BAI05175.1| SSU ribosomal protein S12P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642267|dbj|BAI08222.1| SSU ribosomal protein S12P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645322|dbj|BAI11270.1| SSU ribosomal protein S12P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648377|dbj|BAI14318.1| SSU ribosomal protein S12P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651430|dbj|BAI17364.1| SSU ribosomal protein S12P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654421|dbj|BAI20348.1| SSU ribosomal protein S12P [Acetobacter pasteurianus IFO 3283-12]
 gi|326696296|gb|EGE47975.1| 30S ribosomal protein S12 [Acetobacter pomorum DM001]
          Length = 123

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI K RK + +   KV AL+G PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIAKGRKPAVKR-NKVPALQGCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV++Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QG+  R+Q RS YGA
Sbjct: 60  GYEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGIAKRRQRRSLYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|302344361|ref|YP_003808890.1| ribosomal protein S12 [Desulfarculus baarsii DSM 2075]
 gi|301640974|gb|ADK86296.1| ribosomal protein S12 [Desulfarculus baarsii DSM 2075]
          Length = 123

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  R+   RA     AL+ +PQKRGVC+RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRNGRERQ-RAKNNTPALQKSPQKRGVCIRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDA GV NR+Q RS+YG 
Sbjct: 60  GIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAVGVDNRRQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|86608398|ref|YP_477160.1| 30S ribosomal protein S12 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|110825786|sp|Q2JMY0|RS12_SYNJB RecName: Full=30S ribosomal protein S12
 gi|86556940|gb|ABD01897.1| ribosomal protein S12 [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 135

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR+ R  + R   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIREERSVAARKT-KSPALKACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LDA GVK+RKQ RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDAAGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|269955430|ref|YP_003325219.1| 30S ribosomal protein S12 [Xylanimonas cellulosilytica DSM 15894]
 gi|269304111|gb|ACZ29661.1| ribosomal protein S12 [Xylanimonas cellulosilytica DSM 15894]
          Length = 124

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R  +    +K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +L+S
Sbjct: 1   MPTIQQLVRKGRT-TKPGKSKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|224827273|ref|ZP_03700367.1| ribosomal protein S12 [Lutiella nitroferrum 2002]
 gi|224600562|gb|EEG06751.1| ribosomal protein S12 [Lutiella nitroferrum 2002]
          Length = 123

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R    +A +KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRLAE-QAKSKVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|271962627|ref|YP_003336823.1| 30S ribosomal protein S12 [Streptosporangium roseum DSM 43021]
 gi|270505802|gb|ACZ84080.1| ribosomal protein S12 [Streptosporangium roseum DSM 43021]
          Length = 123

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL+ +PQ+RG C+RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTIQQLVRKGRQDKV-TKTKTPALKASPQRRGTCMRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGV+NRKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDTQGVRNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|269128521|ref|YP_003301891.1| 30S ribosomal protein S12 [Thermomonospora curvata DSM 43183]
 gi|268313479|gb|ACY99853.1| ribosomal protein S12 [Thermomonospora curvata DSM 43183]
          Length = 139

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+ QL+RK R+       K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 17  VPTIQQLVRKGRQDKV-TKNKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 75

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGV+NRKQARSRYGA
Sbjct: 76  GIEVTAYIPGVGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVRNRKQARSRYGA 135

Query: 121 ERPK 124
           ++ K
Sbjct: 136 KKEK 139


>gi|220935497|ref|YP_002514396.1| 30S ribosomal protein S12 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254811115|sp|B8GV63|RS12_THISH RecName: Full=30S ribosomal protein S12
 gi|219996807|gb|ACL73409.1| 30S ribosomal protein S12 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 125

 Score =  173 bits (439), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK      A V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRKVEKSA-VPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD QGV+NRKQARS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTQGVQNRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|317507929|ref|ZP_07965625.1| ribosomal protein S12 [Segniliparus rugosus ATCC BAA-974]
 gi|316253794|gb|EFV13168.1| ribosomal protein S12 [Segniliparus rugosus ATCC BAA-974]
          Length = 124

 Score =  173 bits (439), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 104/126 (82%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPR--KGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           MPT+ QL+RK R  KG+     K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +L
Sbjct: 1   MPTIQQLVRKGRQPKGNR---VKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           TS VEV AY+PGE HNLQEHS+V++ GGRV+DLPGV+Y++IRG LD QGVKNRKQARSRY
Sbjct: 58  TSQVEVTAYIPGEKHNLQEHSMVLVRGGRVRDLPGVRYKIIRGALDTQGVKNRKQARSRY 117

Query: 119 GAERPK 124
           GA+R K
Sbjct: 118 GAKREK 123


>gi|239905853|ref|YP_002952592.1| 30S ribosomal protein S12 [Desulfovibrio magneticus RS-1]
 gi|259494647|sp|C4XLW8|RS12_DESMR RecName: Full=30S ribosomal protein S12
 gi|239795717|dbj|BAH74706.1| 30S ribosomal protein S12 [Desulfovibrio magneticus RS-1]
          Length = 123

 Score =  173 bits (439), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 87/125 (69%), Positives = 103/125 (82%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPR-KGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT+NQLIRK R K S R   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT
Sbjct: 1   MPTINQLIRKERAKVSKRR--KTPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLT 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G+EV +Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GV +R+Q+RS+YG
Sbjct: 59  NGIEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTSGVSDRRQSRSKYG 118

Query: 120 AERPK 124
           A+RPK
Sbjct: 119 AKRPK 123


>gi|114327214|ref|YP_744371.1| 30S ribosomal protein S12 [Granulibacter bethesdensis CGDNIH1]
 gi|119366773|sp|Q0BUQ4|RS12_GRABC RecName: Full=30S ribosomal protein S12
 gi|114315388|gb|ABI61448.1| SSU ribosomal protein S12P [Granulibacter bethesdensis CGDNIH1]
          Length = 123

 Score =  173 bits (439), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI K R+ + +A  KV AL+G PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIAKGREPN-KARNKVPALQGCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV++Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QG+  R+Q RS YGA
Sbjct: 60  GYEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGIAKRRQRRSLYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|152990019|ref|YP_001355741.1| 30S ribosomal protein S12 [Nitratiruptor sp. SB155-2]
 gi|166231873|sp|A6Q1M5|RS12_NITSB RecName: Full=30S ribosomal protein S12
 gi|151421880|dbj|BAF69384.1| 30S ribosomal protein S12 [Nitratiruptor sp. SB155-2]
          Length = 124

 Score =  173 bits (439), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK   +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLVRKERKKVIKK-SKSPALVKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGEGHNLQEHS+V++ GGRVKDLPGVKY +IRG LD  GV NRK++RS+YG 
Sbjct: 60  GYEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIIRGALDTAGVANRKKSRSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|158520721|ref|YP_001528591.1| 30S ribosomal protein S12 [Desulfococcus oleovorans Hxd3]
 gi|226708489|sp|A8ZV53|RS12_DESOH RecName: Full=30S ribosomal protein S12
 gi|158509547|gb|ABW66514.1| ribosomal protein S12 [Desulfococcus oleovorans Hxd3]
          Length = 123

 Score =  173 bits (439), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 102/126 (80%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVT--ALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           MPT+NQL+R  RK   RA  K T  AL+G PQKRGVC+RVYT TPKKPNSALRKV + RL
Sbjct: 1   MPTINQLVRNGRK---RATKKTTTPALKGAPQKRGVCVRVYTTTPKKPNSALRKVARVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           T+G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV +RKQ RS+Y
Sbjct: 58  TTGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDTLGVSDRKQGRSKY 117

Query: 119 GAERPK 124
           G +RPK
Sbjct: 118 GTKRPK 123


>gi|328951241|ref|YP_004368576.1| ribosomal protein S12 [Marinithermus hydrothermalis DSM 14884]
 gi|328451565|gb|AEB12466.1| ribosomal protein S12 [Marinithermus hydrothermalis DSM 14884]
          Length = 127

 Score =  173 bits (439), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+NQL+RK RK + +  +KV AL+G+P +RGVC  V TVTPKKPNSALRKV K RLTS
Sbjct: 4   LPTINQLLRKGRKAT-KKKSKVPALKGSPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTS 62

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGV D QGVK+RK++RS+YG 
Sbjct: 63  GYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDTQGVKDRKKSRSKYGT 122

Query: 121 ERPK 124
           +RPK
Sbjct: 123 KRPK 126


>gi|256390130|ref|YP_003111694.1| 30S ribosomal protein S12 [Catenulispora acidiphila DSM 44928]
 gi|256356356|gb|ACU69853.1| ribosomal protein S12 [Catenulispora acidiphila DSM 44928]
          Length = 124

 Score =  173 bits (439), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+      +   AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +L+S
Sbjct: 1   MPTIQQLVRKGRQDKV-VKSNTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVKNRKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|332040597|gb|EGI76972.1| 30S ribosomal protein S12 [Hylemonella gracilis ATCC 19624]
          Length = 125

 Score =  173 bits (439), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R+      +K  A++ +PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRQGREVET-TKSKSPAMQNSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|288917225|ref|ZP_06411594.1| ribosomal protein S12 [Frankia sp. EUN1f]
 gi|288351416|gb|EFC85624.1| ribosomal protein S12 [Frankia sp. EUN1f]
          Length = 124

 Score =  173 bits (438), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL S
Sbjct: 1   MPTIQQLVRKGRQDKVEKT-KTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLNS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GG+VKDLPGV+Y+++RG LD QGV+NRKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSIVLVRGGQVKDLPGVRYKIVRGALDTQGVRNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|192359064|ref|YP_001981203.1| 30S ribosomal protein S12 [Cellvibrio japonicus Ueda107]
 gi|190685229|gb|ACE82907.1| ribosomal protein S12 [Cellvibrio japonicus Ueda107]
          Length = 128

 Score =  173 bits (438), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPRK      + V AL+GNPQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 6   MPTINQLVRKPRK-RIVDKSDVPALQGNPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 64

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV  RKQ RS+YGA
Sbjct: 65  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVAKRKQGRSKYGA 124

Query: 121 ERPK 124
           +RPK
Sbjct: 125 KRPK 128


>gi|111148073|emb|CAJ59741.1| 30S ribosomal subunit protein S12 [Frankia alni ACN14a]
          Length = 139

 Score =  173 bits (438), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+ QL+RK R+       K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL S
Sbjct: 16  LPTIQQLVRKGRQDKVEKT-KTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLNS 74

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGV+NRKQARSRYGA
Sbjct: 75  GIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQGVRNRKQARSRYGA 134

Query: 121 ERPK 124
           ++ K
Sbjct: 135 KKEK 138


>gi|269122974|ref|YP_003305551.1| 30S ribosomal protein S12 [Streptobacillus moniliformis DSM 12112]
 gi|268314300|gb|ACZ00674.1| ribosomal protein S12 [Streptobacillus moniliformis DSM 12112]
          Length = 123

 Score =  173 bits (438), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  R  S +   K  AL+GNPQKRGVC+RVYT TPKKPNSALRKV + +L +
Sbjct: 1   MPTINQLVRFGRSTSEKK-KKSPALKGNPQKRGVCVRVYTTTPKKPNSALRKVARVKLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGR KDLPGV+Y++IRG LD  GV NRKQARSRYG 
Sbjct: 60  GIEVTAYIPGIGHNLQEHSIVLIRGGRTKDLPGVRYKIIRGALDTAGVVNRKQARSRYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|172039987|ref|YP_001799701.1| 30S ribosomal protein S12 [Corynebacterium urealyticum DSM 7109]
 gi|171851291|emb|CAQ04267.1| 30S ribosomal protein S12 [Corynebacterium urealyticum DSM 7109]
          Length = 148

 Score =  173 bits (438), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRK R       A    L+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 26  MPTIQQLIRKGRHDKPSNVA-TAGLKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 84

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y+++RG LD QGVK+RKQARSRYG 
Sbjct: 85  GIEVSAYIPGEGHNLQEHSMVLVRGGRVRDLPGVRYKIVRGALDTQGVKDRKQARSRYGV 144

Query: 121 ERPK 124
           ++ K
Sbjct: 145 KKEK 148


>gi|22299290|ref|NP_682537.1| 30S ribosomal protein S12 [Thermosynechococcus elongatus BP-1]
 gi|27151675|sp|P59168|RS12_THEEB RecName: Full=30S ribosomal protein S12
 gi|22295473|dbj|BAC09299.1| 30S ribosomal protein S12 [Thermosynechococcus elongatus BP-1]
          Length = 134

 Score =  173 bits (438), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR+ R+   +   K  AL+G PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRQERE-LLKRKTKSPALKGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+RKQ RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|256827420|ref|YP_003151379.1| 30S ribosomal protein S12P [Cryptobacterium curtum DSM 15641]
 gi|256583563|gb|ACU94697.1| SSU ribosomal protein S12P [Cryptobacterium curtum DSM 15641]
          Length = 124

 Score =  173 bits (438), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+       K  AL+GNPQKRGVC RVYT TPKKPNSALRKV + RL +
Sbjct: 1   MPTINQLVRKGRRNLVEK-KKTPALKGNPQKRGVCTRVYTTTPKKPNSALRKVARVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+VIR  LD   V +RKQARSRYGA
Sbjct: 60  GMEVTAYIPGEGHNLQEHSMVLIRGGRVKDLPGVRYKVIRAALDCAPVNDRKQARSRYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|297618389|ref|YP_003703548.1| ribosomal protein S12 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146226|gb|ADI02983.1| ribosomal protein S12 [Syntrophothermus lipocalidus DSM 12680]
          Length = 126

 Score =  173 bits (438), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RK R+   +      AL+GNPQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MTTINQLVRKGRQQVVKKST-APALKGNPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD+ GV+NR Q RS+YG 
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDSSGVQNRNQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|78357306|ref|YP_388755.1| 30S ribosomal protein S12 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|90111780|sp|Q30Z36|RS12_DESDG RecName: Full=30S ribosomal protein S12
 gi|78219711|gb|ABB39060.1| SSU ribosomal protein S12P [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 123

 Score =  173 bits (438), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK   +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKERKKVAKR-KKTPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RG LD  GV++R+Q RS+YGA
Sbjct: 60  AIEVTAYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIVRGTLDTAGVQDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|238025927|ref|YP_002910158.1| 30S ribosomal protein S12 [Burkholderia glumae BGR1]
 gi|330815244|ref|YP_004358949.1| 30S ribosomal protein S12 [Burkholderia gladioli BSR3]
 gi|237875121|gb|ACR27454.1| 30S ribosomal protein S12 [Burkholderia glumae BGR1]
 gi|327367637|gb|AEA58993.1| 30S ribosomal protein S12 [Burkholderia gladioli BSR3]
          Length = 126

 Score =  173 bits (438), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+ S    +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRE-SETTKSKSPALQNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|78064919|ref|YP_367688.1| 30S ribosomal protein S12 [Burkholderia sp. 383]
 gi|107024308|ref|YP_622635.1| 30S ribosomal protein S12 [Burkholderia cenocepacia AU 1054]
 gi|115350317|ref|YP_772156.1| 30S ribosomal protein S12 [Burkholderia ambifaria AMMD]
 gi|116688367|ref|YP_833990.1| 30S ribosomal protein S12 [Burkholderia cenocepacia HI2424]
 gi|134294438|ref|YP_001118173.1| 30S ribosomal protein S12 [Burkholderia vietnamiensis G4]
 gi|161523424|ref|YP_001578436.1| 30S ribosomal protein S12 [Burkholderia multivorans ATCC 17616]
 gi|167587776|ref|ZP_02380164.1| ribosomal protein S12 [Burkholderia ubonensis Bu]
 gi|170701423|ref|ZP_02892381.1| ribosomal protein S12 [Burkholderia ambifaria IOP40-10]
 gi|170731677|ref|YP_001763624.1| 30S ribosomal protein S12 [Burkholderia cenocepacia MC0-3]
 gi|171319363|ref|ZP_02908473.1| ribosomal protein S12 [Burkholderia ambifaria MEX-5]
 gi|172059336|ref|YP_001806988.1| 30S ribosomal protein S12 [Burkholderia ambifaria MC40-6]
 gi|189351803|ref|YP_001947431.1| 30S ribosomal protein S12 [Burkholderia multivorans ATCC 17616]
 gi|206558636|ref|YP_002229396.1| 30S ribosomal protein S12 [Burkholderia cenocepacia J2315]
 gi|221201560|ref|ZP_03574598.1| 30S ribosomal protein S12 [Burkholderia multivorans CGD2M]
 gi|221207365|ref|ZP_03580375.1| 30S ribosomal protein S12 [Burkholderia multivorans CGD2]
 gi|221213503|ref|ZP_03586478.1| 30S ribosomal protein S12 [Burkholderia multivorans CGD1]
 gi|254253521|ref|ZP_04946839.1| 30S ribosomal protein S12 [Burkholderia dolosa AUO158]
 gi|90111771|sp|Q39KH2|RS12_BURS3 RecName: Full=30S ribosomal protein S12
 gi|119366758|sp|Q1BRU3|RS12_BURCA RecName: Full=30S ribosomal protein S12
 gi|122324271|sp|Q0BJ51|RS12_BURCM RecName: Full=30S ribosomal protein S12
 gi|158512276|sp|A0K3M0|RS12_BURCH RecName: Full=30S ribosomal protein S12
 gi|166231852|sp|A4JAN5|RS12_BURVG RecName: Full=30S ribosomal protein S12
 gi|226708469|sp|B1YRC5|RS12_BURA4 RecName: Full=30S ribosomal protein S12
 gi|226708470|sp|B1JU17|RS12_BURCC RecName: Full=30S ribosomal protein S12
 gi|226708471|sp|B4E5B5|RS12_BURCJ RecName: Full=30S ribosomal protein S12
 gi|226708472|sp|A9ADI8|RS12_BURM1 RecName: Full=30S ribosomal protein S12
 gi|77965664|gb|ABB07044.1| SSU ribosomal protein S12P [Burkholderia sp. 383]
 gi|86370996|gb|ABC94636.1| ribosomal S12 protein [Burkholderia cenocepacia]
 gi|105894497|gb|ABF77662.1| SSU ribosomal protein S12P [Burkholderia cenocepacia AU 1054]
 gi|115280305|gb|ABI85822.1| SSU ribosomal protein S12P [Burkholderia ambifaria AMMD]
 gi|116646456|gb|ABK07097.1| SSU ribosomal protein S12P [Burkholderia cenocepacia HI2424]
 gi|124896130|gb|EAY70010.1| 30S ribosomal protein S12 [Burkholderia dolosa AUO158]
 gi|134137595|gb|ABO53338.1| SSU ribosomal protein S12P [Burkholderia vietnamiensis G4]
 gi|160340853|gb|ABX13939.1| ribosomal protein S12 [Burkholderia multivorans ATCC 17616]
 gi|169814919|gb|ACA89502.1| ribosomal protein S12 [Burkholderia cenocepacia MC0-3]
 gi|170133675|gb|EDT02045.1| ribosomal protein S12 [Burkholderia ambifaria IOP40-10]
 gi|171095434|gb|EDT40406.1| ribosomal protein S12 [Burkholderia ambifaria MEX-5]
 gi|171991853|gb|ACB62772.1| ribosomal protein S12 [Burkholderia ambifaria MC40-6]
 gi|189335825|dbj|BAG44895.1| small subunit ribosomal protein S12 [Burkholderia multivorans ATCC
           17616]
 gi|198034673|emb|CAR50540.1| 30S ribosomal protein S12 [Burkholderia cenocepacia J2315]
 gi|221166955|gb|EED99426.1| 30S ribosomal protein S12 [Burkholderia multivorans CGD1]
 gi|221172953|gb|EEE05390.1| 30S ribosomal protein S12 [Burkholderia multivorans CGD2]
 gi|221178376|gb|EEE10785.1| 30S ribosomal protein S12 [Burkholderia multivorans CGD2M]
          Length = 126

 Score =  173 bits (438), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+ S    +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRQ-SETTKSKSPALQDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|224370695|ref|YP_002604859.1| RpsL [Desulfobacterium autotrophicum HRM2]
 gi|259494646|sp|C0Q9X7|RS12_DESAH RecName: Full=30S ribosomal protein S12
 gi|223693412|gb|ACN16695.1| RpsL [Desulfobacterium autotrophicum HRM2]
          Length = 123

 Score =  173 bits (438), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK + +  +   AL+G PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRKKAEKKQS-TPALKGGPQKRGVCTRVYTSTPKKPNSALRKVARVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV++RKQ RS+YGA
Sbjct: 60  GMEVAAYIPGMGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDTLGVEDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|325526975|gb|EGD04425.1| 30S ribosomal protein S12 [Burkholderia sp. TJI49]
          Length = 126

 Score =  173 bits (438), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+ S    +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRE-SETTKSKSPALQDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|187925621|ref|YP_001897263.1| 30S ribosomal protein S12 [Burkholderia phytofirmans PsJN]
 gi|226708474|sp|B2T756|RS12_BURPP RecName: Full=30S ribosomal protein S12
 gi|187716815|gb|ACD18039.1| ribosomal protein S12 [Burkholderia phytofirmans PsJN]
          Length = 126

 Score =  173 bits (438), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+ S    +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRQ-SETTKSKSPALQDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|297564032|ref|YP_003683005.1| ribosomal protein S12 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296848481|gb|ADH70499.1| ribosomal protein S12 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 123

 Score =  173 bits (438), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +L+S
Sbjct: 1   MPTIQQLVRKGRQDKV-AKNKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+YR++RG LD QGV+NRKQARSRYGA
Sbjct: 60  QIEVTAYIPGIGHNLQEHSIVLVRGGRVKDLPGVRYRIVRGSLDTQGVRNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|319778758|ref|YP_004129671.1| SSU ribosomal protein S12p (S23e) [Taylorella equigenitalis MCE9]
 gi|317108782|gb|ADU91528.1| SSU ribosomal protein S12p (S23e) [Taylorella equigenitalis MCE9]
          Length = 124

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RKPR+ +    +K  AL   PQ+RGVC RVYT TP+KPNSA+RKV K RLT+
Sbjct: 1   MPTISQLVRKPRETAVMK-SKSPALENCPQRRGVCTRVYTTTPRKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GYEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|297625772|ref|YP_003687535.1| 30S ribosomal protein S12 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296921537|emb|CBL56091.1| 30S ribosomal protein S12 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 123

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R     + +K  AL+G+PQ+RGVC RVYT TPKKPNSA+RKV + RL+S
Sbjct: 1   MPTIQQLVRKGRSDKV-SQSKTPALKGSPQRRGVCTRVYTTTPKKPNSAMRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK RKQARSRYGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGSLDTQGVKGRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|313680520|ref|YP_004058259.1| SSU ribosomal protein s12p [Oceanithermus profundus DSM 14977]
 gi|313153235|gb|ADR37086.1| SSU ribosomal protein S12P [Oceanithermus profundus DSM 14977]
          Length = 124

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK + +   KV AL+G+P +RGVC  V TVTPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLLRKGRK-AVKKKTKVPALKGSPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGV D QGV++RK++RS+YG 
Sbjct: 60  GYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDTQGVQDRKKSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|256825892|ref|YP_003149852.1| 30S ribosomal protein S12P [Kytococcus sedentarius DSM 20547]
 gi|256689285|gb|ACV07087.1| SSU ribosomal protein S12P [Kytococcus sedentarius DSM 20547]
          Length = 124

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   +      AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTINQLVRKGRRDKVKKL-DAPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GG VKDLPGV+Y++IRG LDAQGVK+R QARS YGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSIVLVRGGGVKDLPGVRYKIIRGALDAQGVKDRNQARSHYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|325267292|ref|ZP_08133954.1| 30S ribosomal protein S12 [Kingella denitrificans ATCC 33394]
 gi|324981229|gb|EGC16879.1| 30S ribosomal protein S12 [Kingella denitrificans ATCC 33394]
          Length = 123

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK       KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRKKPVYV-NKVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|284929373|ref|YP_003421895.1| 30S ribosomal protein S12P [cyanobacterium UCYN-A]
 gi|284809817|gb|ADB95514.1| SSU ribosomal protein S12P [cyanobacterium UCYN-A]
          Length = 124

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R  + +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSERSKAKKK-TKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDAQGVK+RKQ RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAQGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|258646770|ref|ZP_05734239.1| ribosomal protein S12 [Dialister invisus DSM 15470]
 gi|260404196|gb|EEW97743.1| ribosomal protein S12 [Dialister invisus DSM 15470]
          Length = 126

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+      AK  AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRE-VLATKAKTPALKQSPQKRGVCTRVYTATPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV  R+QARS+YGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTVGVSGRQQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KREK 123


>gi|53720826|ref|YP_109812.1| 30S ribosomal protein S12 [Burkholderia pseudomallei K96243]
 gi|76809886|ref|YP_335146.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1710b]
 gi|83719839|ref|YP_443577.1| 30S ribosomal protein S12 [Burkholderia thailandensis E264]
 gi|126439365|ref|YP_001060755.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 668]
 gi|126454808|ref|YP_001068039.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1106a]
 gi|134283192|ref|ZP_01769893.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 305]
 gi|167582627|ref|ZP_02375501.1| 30S ribosomal protein S12 [Burkholderia thailandensis TXDOH]
 gi|167620741|ref|ZP_02389372.1| 30S ribosomal protein S12 [Burkholderia thailandensis Bt4]
 gi|167721581|ref|ZP_02404817.1| 30S ribosomal protein S12 [Burkholderia pseudomallei DM98]
 gi|167740555|ref|ZP_02413329.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 14]
 gi|167817760|ref|ZP_02449440.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 91]
 gi|167826157|ref|ZP_02457628.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 9]
 gi|167838216|ref|ZP_02465075.1| 30S ribosomal protein S12 [Burkholderia thailandensis MSMB43]
 gi|167847669|ref|ZP_02473177.1| 30S ribosomal protein S12 [Burkholderia pseudomallei B7210]
 gi|167896241|ref|ZP_02483643.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 7894]
 gi|167904623|ref|ZP_02491828.1| 30S ribosomal protein S12 [Burkholderia pseudomallei NCTC 13177]
 gi|167912888|ref|ZP_02499979.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 112]
 gi|167920848|ref|ZP_02507939.1| 30S ribosomal protein S12 [Burkholderia pseudomallei BCC215]
 gi|217424713|ref|ZP_03456210.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 576]
 gi|226198176|ref|ZP_03793747.1| 30S ribosomal protein S12 [Burkholderia pseudomallei Pakistan 9]
 gi|237814150|ref|YP_002898601.1| ribosomal protein S12 [Burkholderia pseudomallei MSHR346]
 gi|242315070|ref|ZP_04814086.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1106b]
 gi|254180336|ref|ZP_04886934.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1655]
 gi|254190299|ref|ZP_04896807.1| 30S ribosomal protein S12 [Burkholderia pseudomallei Pasteur 52237]
 gi|254198523|ref|ZP_04904944.1| 30S ribosomal protein S12 [Burkholderia pseudomallei S13]
 gi|254259564|ref|ZP_04950618.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1710a]
 gi|254300575|ref|ZP_04968020.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 406e]
 gi|257137640|ref|ZP_05585902.1| 30S ribosomal protein S12 [Burkholderia thailandensis E264]
 gi|60390787|sp|Q63Q06|RS12_BURPS RecName: Full=30S ribosomal protein S12
 gi|90111770|sp|Q3JMQ7|RS12_BURP1 RecName: Full=30S ribosomal protein S12
 gi|115305655|sp|Q2SU22|RS12_BURTA RecName: Full=30S ribosomal protein S12
 gi|158513538|sp|A3P0B8|RS12_BURP0 RecName: Full=30S ribosomal protein S12
 gi|166231851|sp|A3NEI4|RS12_BURP6 RecName: Full=30S ribosomal protein S12
 gi|52211240|emb|CAH37229.1| 30S ribosomal protein S12 [Burkholderia pseudomallei K96243]
 gi|76579339|gb|ABA48814.1| ribosomal protein S12 [Burkholderia pseudomallei 1710b]
 gi|83653664|gb|ABC37727.1| ribosomal protein S12 [Burkholderia thailandensis E264]
 gi|126218858|gb|ABN82364.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 668]
 gi|126228450|gb|ABN91990.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1106a]
 gi|134245387|gb|EBA45480.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 305]
 gi|157810594|gb|EDO87764.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 406e]
 gi|157937975|gb|EDO93645.1| 30S ribosomal protein S12 [Burkholderia pseudomallei Pasteur 52237]
 gi|169655263|gb|EDS87956.1| 30S ribosomal protein S12 [Burkholderia pseudomallei S13]
 gi|184210875|gb|EDU07918.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1655]
 gi|217392169|gb|EEC32194.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 576]
 gi|225929696|gb|EEH25712.1| 30S ribosomal protein S12 [Burkholderia pseudomallei Pakistan 9]
 gi|237504286|gb|ACQ96604.1| ribosomal protein S12 [Burkholderia pseudomallei MSHR346]
 gi|242138309|gb|EES24711.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1106b]
 gi|254218253|gb|EET07637.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1710a]
          Length = 126

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R  S    +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGR-ASETTKSKSPALQDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|219683626|ref|YP_002470009.1| 30S ribosomal protein S12 [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|254811068|sp|B8DTV4|RS12_BIFA0 RecName: Full=30S ribosomal protein S12
 gi|219621276|gb|ACL29433.1| ribosomal protein S12 [Bifidobacterium animalis subsp. lactis
           AD011]
          Length = 123

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+G  +  +K  AL+G+P +RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIEQLVRKGRRGKPKK-SKTLALKGSPLRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ RS YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVKDRKQGRSLYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|313836006|gb|EFS73720.1| ribosomal protein S12 [Propionibacterium acnes HL037PA2]
 gi|314929682|gb|EFS93513.1| ribosomal protein S12 [Propionibacterium acnes HL044PA1]
 gi|314970495|gb|EFT14593.1| ribosomal protein S12 [Propionibacterium acnes HL037PA3]
 gi|328906248|gb|EGG26023.1| 30S ribosomal protein S12 [Propionibacterium sp. P08]
          Length = 123

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R     +  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIQQLVRKGRTDKI-SKNKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK RKQARSRYGA
Sbjct: 60  GVEVTAYIPGVGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGSLDTQGVKGRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|296268545|ref|YP_003651177.1| 30S ribosomal protein S12 [Thermobispora bispora DSM 43833]
 gi|296091332|gb|ADG87284.1| ribosomal protein S12 [Thermobispora bispora DSM 43833]
          Length = 124

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL+G+PQ RG C+RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRKGRQDKV-TKTKTPALKGSPQLRGHCVRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LDAQGV+ RKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAQGVRGRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|241766089|ref|ZP_04764002.1| ribosomal protein S12 [Acidovorax delafieldii 2AN]
 gi|241363893|gb|EER59199.1| ribosomal protein S12 [Acidovorax delafieldii 2AN]
          Length = 125

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R+      +K  A++ +PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRQGRQVET-TNSKSPAMQNSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|220906148|ref|YP_002481459.1| 30S ribosomal protein S12 [Cyanothece sp. PCC 7425]
 gi|254811081|sp|B8HVS0|RS12_CYAP4 RecName: Full=30S ribosomal protein S12
 gi|219862759|gb|ACL43098.1| ribosomal protein S12 [Cyanothece sp. PCC 7425]
          Length = 136

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSERQ-ELKKKTKSPALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+RKQ RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|225025525|ref|ZP_03714717.1| hypothetical protein EIKCOROL_02425 [Eikenella corrodens ATCC
           23834]
 gi|224941809|gb|EEG23018.1| hypothetical protein EIKCOROL_02425 [Eikenella corrodens ATCC
           23834]
          Length = 123

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK       KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRKKP-EYVNKVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|91785470|ref|YP_560676.1| 30S ribosomal protein S12 [Burkholderia xenovorans LB400]
 gi|296163256|ref|ZP_06846020.1| ribosomal protein S12 [Burkholderia sp. Ch1-1]
 gi|119366759|sp|Q13TG5|RS12_BURXL RecName: Full=30S ribosomal protein S12
 gi|91689424|gb|ABE32624.1| SSU ribosomal protein S12P [Burkholderia xenovorans LB400]
 gi|295886492|gb|EFG66346.1| ribosomal protein S12 [Burkholderia sp. Ch1-1]
          Length = 126

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R  S    +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGR-ASETTKSKSPALQDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|312115682|ref|YP_004013278.1| ribosomal protein S12 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220811|gb|ADP72179.1| ribosomal protein S12 [Rhodomicrobium vannielii ATCC 17100]
          Length = 123

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR    +   KV A+   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTIQQLIRKPRVAPVKR-NKVPAMTECPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y +IRGVLD QGV  R+Q RS+YGA
Sbjct: 60  GFEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGVLDTQGVAKRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|269215709|ref|ZP_06159563.1| ribosomal protein S12 [Slackia exigua ATCC 700122]
 gi|269131196|gb|EEZ62271.1| ribosomal protein S12 [Slackia exigua ATCC 700122]
          Length = 123

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R        K  AL+GNPQKRGVC RVYT TPKKPNSALRKV + RL +
Sbjct: 1   MPTINQLVRKGRAKQVDK-KKTPALKGNPQKRGVCTRVYTTTPKKPNSALRKVARVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IR  LD   V  R+QARSRYGA
Sbjct: 60  GMEVTAYIPGEGHNLQEHSMVLIRGGRVKDLPGVRYKIIRAALDCSAVDKRRQARSRYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|167039515|ref|YP_001662500.1| 30S ribosomal protein S12 [Thermoanaerobacter sp. X514]
 gi|166853755|gb|ABY92164.1| ribosomal protein S12 [Thermoanaerobacter sp. X514]
          Length = 133

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ RK   +  +   AL GNPQKRGVC+ V T TPKKPNSALRK+ + RLT+
Sbjct: 10  MPTINQLVRQGRK-PVKYKSAAPALEGNPQKRGVCVVVKTTTPKKPNSALRKIARVRLTN 68

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA GV NRKQARSRYGA
Sbjct: 69  GTEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDAAGVANRKQARSRYGA 128

Query: 121 ERPK 124
           ++PK
Sbjct: 129 KKPK 132


>gi|291533627|emb|CBL06740.1| SSU ribosomal protein S12P [Megamonas hypermegale ART12/1]
          Length = 127

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R+ S +  +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKSRQ-SMQEKSTAPALKNCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV+NR+Q RS+YGA
Sbjct: 60  SIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGSLDTAGVQNREQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|28493644|ref|NP_787805.1| 30S ribosomal protein S12 [Tropheryma whipplei str. Twist]
 gi|28572837|ref|NP_789617.1| 30S ribosomal protein S12 [Tropheryma whipplei TW08/27]
 gi|52783404|sp|Q83FN9|RS12_TROWT RecName: Full=30S ribosomal protein S12
 gi|52783405|sp|Q83HC7|RS12_TROW8 RecName: Full=30S ribosomal protein S12
 gi|28410970|emb|CAD67355.1| 30S ribosomal protein S12 [Tropheryma whipplei TW08/27]
 gi|28476686|gb|AAO44774.1| 30S ribosomal protein S12 [Tropheryma whipplei str. Twist]
          Length = 124

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  ALRGNPQ+RGVC RVYT TPKKPNSALRKV + +L++
Sbjct: 1   MPTIQQLVRKGRRPKVNKT-KSPALRGNPQQRGVCSRVYTTTPKKPNSALRKVARVKLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV  Y+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+V+RG LDAQ VK+RKQARSRYGA
Sbjct: 60  GTEVTVYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKVVRGALDAQAVKDRKQARSRYGA 119

Query: 121 ERPK 124
           +  K
Sbjct: 120 KMEK 123


>gi|331005651|ref|ZP_08329019.1| SSU ribosomal protein S12p (S23e) [gamma proteobacterium IMCC1989]
 gi|330420540|gb|EGG94838.1| SSU ribosomal protein S12p (S23e) [gamma proteobacterium IMCC1989]
          Length = 123

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK   +  + V AL+GNPQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRKVQK-SDVPALQGNPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RKQ RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVADRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|256830543|ref|YP_003159271.1| ribosomal protein S12 [Desulfomicrobium baculatum DSM 4028]
 gi|256579719|gb|ACU90855.1| ribosomal protein S12 [Desulfomicrobium baculatum DSM 4028]
          Length = 123

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 106/128 (82%), Gaps = 9/128 (7%)

Query: 1   MPTVNQLIRKPR----KGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKA 56
           MPT+NQL+RK R    KG  RA     AL+  PQ+RGVC+RVYT TPKKPNSALRKV + 
Sbjct: 1   MPTINQLVRKARVIQVKGKKRA-----ALQECPQRRGVCVRVYTTTPKKPNSALRKVARV 55

Query: 57  RLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARS 116
           RLT+G+EV +Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LDA GV++R+++RS
Sbjct: 56  RLTNGIEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYTIIRGTLDAAGVQDRRKSRS 115

Query: 117 RYGAERPK 124
           +YGA+RPK
Sbjct: 116 KYGAKRPK 123


>gi|260577187|ref|ZP_05845163.1| ribosomal protein S12 [Rhodobacter sp. SW2]
 gi|259020567|gb|EEW23887.1| ribosomal protein S12 [Rhodobacter sp. SW2]
          Length = 123

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRKPR+ + R  +K   L   PQKRGVC RVYT TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTIQQLIRKPREPNVRR-SKSQHLESCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI Y+PGE HNLQEHSVV++ GGR+KDLPGV+Y ++RGVLD QGVK R+Q RS+YGA
Sbjct: 60  AFEVICYIPGEKHNLQEHSVVLIRGGRIKDLPGVRYHILRGVLDTQGVKERRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|325110958|ref|YP_004272026.1| ribosomal protein S12 [Planctomyces brasiliensis DSM 5305]
 gi|324971226|gb|ADY62004.1| ribosomal protein S12 [Planctomyces brasiliensis DSM 5305]
          Length = 193

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPRK    A +K   L G PQKRGVCL+V T+TPKKPNSALRKV + RL++
Sbjct: 71  MPTINQLVRKPRKKQ-TAKSKTPLLEGCPQKRGVCLQVKTMTPKKPNSALRKVARVRLSN 129

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AYVPGEGHNLQEHS+V++ GGRV+DLPGV+Y+++RGVLD   V  RKQARSRYGA
Sbjct: 130 GKEVTAYVPGEGHNLQEHSIVLVRGGRVRDLPGVRYKIVRGVLDTLAVNGRKQARSRYGA 189

Query: 121 ERPK 124
           +RPK
Sbjct: 190 KRPK 193


>gi|167564421|ref|ZP_02357337.1| 30S ribosomal protein S12 [Burkholderia oklahomensis EO147]
 gi|167571567|ref|ZP_02364441.1| 30S ribosomal protein S12 [Burkholderia oklahomensis C6786]
          Length = 126

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R  S    +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRT-SETTKSKSPALQDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|167036796|ref|YP_001664374.1| 30S ribosomal protein S12 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256752782|ref|ZP_05493627.1| ribosomal protein S12 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915234|ref|ZP_07132549.1| ribosomal protein S12 [Thermoanaerobacter sp. X561]
 gi|307267197|ref|ZP_07548703.1| ribosomal protein S12 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307725158|ref|YP_003904909.1| 30S ribosomal protein S12 [Thermoanaerobacter sp. X513]
 gi|320115218|ref|YP_004185377.1| 30S ribosomal protein S12 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|326390666|ref|ZP_08212221.1| ribosomal protein S12 [Thermoanaerobacter ethanolicus JW 200]
 gi|226712664|sp|B0KCJ5|RS12_THEP3 RecName: Full=30S ribosomal protein S12
 gi|166855630|gb|ABY94038.1| ribosomal protein S12 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256748343|gb|EEU61402.1| ribosomal protein S12 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888958|gb|EFK84105.1| ribosomal protein S12 [Thermoanaerobacter sp. X561]
 gi|306917776|gb|EFN48044.1| ribosomal protein S12 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307582219|gb|ADN55618.1| ribosomal protein S12 [Thermoanaerobacter sp. X513]
 gi|319928309|gb|ADV78994.1| ribosomal protein S12 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|325993344|gb|EGD51781.1| ribosomal protein S12 [Thermoanaerobacter ethanolicus JW 200]
          Length = 124

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ RK   +  +   AL GNPQKRGVC+ V T TPKKPNSALRK+ + RLT+
Sbjct: 1   MPTINQLVRQGRK-PVKYKSAAPALEGNPQKRGVCVVVKTTTPKKPNSALRKIARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA GV NRKQARSRYGA
Sbjct: 60  GTEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDAAGVANRKQARSRYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|162149178|ref|YP_001603639.1| 30S ribosomal protein S12 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545078|ref|YP_002277307.1| 30S ribosomal protein S12 [Gluconacetobacter diazotrophicus PAl 5]
 gi|296116733|ref|ZP_06835342.1| 30S ribosomal protein S12 [Gluconacetobacter hansenii ATCC 23769]
 gi|189040462|sp|A9H3R9|RS12_GLUDA RecName: Full=30S ribosomal protein S12
 gi|161787755|emb|CAP57351.1| putative 30S ribosomal protein S12 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532755|gb|ACI52692.1| ribosomal protein S12 [Gluconacetobacter diazotrophicus PAl 5]
 gi|295976717|gb|EFG83486.1| 30S ribosomal protein S12 [Gluconacetobacter hansenii ATCC 23769]
          Length = 123

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI K R+ + +   KV AL+G PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIAKGREPAAKR-NKVPALQGCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV++Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QG+  R+Q RS YGA
Sbjct: 60  GYEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGIAKRRQRRSLYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|170696807|ref|ZP_02887913.1| ribosomal protein S12 [Burkholderia graminis C4D1M]
 gi|186477593|ref|YP_001859063.1| 30S ribosomal protein S12 [Burkholderia phymatum STM815]
 gi|209520985|ref|ZP_03269721.1| ribosomal protein S12 [Burkholderia sp. H160]
 gi|295677937|ref|YP_003606461.1| ribosomal protein S12 [Burkholderia sp. CCGE1002]
 gi|307731260|ref|YP_003908484.1| 30S ribosomal protein S12 [Burkholderia sp. CCGE1003]
 gi|323527607|ref|YP_004229760.1| 30S ribosomal protein S12 [Burkholderia sp. CCGE1001]
 gi|226708473|sp|B2JIH1|RS12_BURP8 RecName: Full=30S ribosomal protein S12
 gi|170138285|gb|EDT06507.1| ribosomal protein S12 [Burkholderia graminis C4D1M]
 gi|184194052|gb|ACC72017.1| ribosomal protein S12 [Burkholderia phymatum STM815]
 gi|209498587|gb|EDZ98706.1| ribosomal protein S12 [Burkholderia sp. H160]
 gi|295437780|gb|ADG16950.1| ribosomal protein S12 [Burkholderia sp. CCGE1002]
 gi|307585795|gb|ADN59193.1| ribosomal protein S12 [Burkholderia sp. CCGE1003]
 gi|323384609|gb|ADX56700.1| ribosomal protein S12 [Burkholderia sp. CCGE1001]
          Length = 126

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R  S    +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRT-SETTKSKSPALQDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|157363437|ref|YP_001470204.1| 30S ribosomal protein S12 [Thermotoga lettingae TMO]
 gi|166991594|sp|A8F4Q6|RS12_THELT RecName: Full=30S ribosomal protein S12
 gi|157314041|gb|ABV33140.1| ribosomal protein S12 [Thermotoga lettingae TMO]
          Length = 124

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  R+       K  AL+GNPQKRGVC+RV T+TPKKPNSALRK+ + RL++
Sbjct: 1   MPTINQLIRLGRERKVEK-PKAPALQGNPQKRGVCVRVTTMTPKKPNSALRKIARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPG++Y++IRG LD  GV+NRKQ+RS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGIRYKIIRGTLDTAGVENRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|303232448|ref|ZP_07319140.1| ribosomal protein S12 [Atopobium vaginae PB189-T1-4]
 gi|302481532|gb|EFL44600.1| ribosomal protein S12 [Atopobium vaginae PB189-T1-4]
          Length = 124

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R  + +A +K  AL+ NPQKRGVC RV+T TPKKPNSALRKV + RL +
Sbjct: 1   MPTINQLVRQGRV-THKAKSKNAALQHNPQKRGVCTRVFTTTPKKPNSALRKVARVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y++IRG  D   V++RK+ARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLIRGGRVRDLPGVRYKIIRGAFDCAAVQDRKKARSRYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|150020840|ref|YP_001306194.1| 30S ribosomal protein S12 [Thermosipho melanesiensis BI429]
 gi|166231893|sp|A6LLK8|RS12_THEM4 RecName: Full=30S ribosomal protein S12
 gi|149793361|gb|ABR30809.1| ribosomal protein S12 [Thermosipho melanesiensis BI429]
          Length = 124

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  RK   +  +K  AL+G+PQKRGVC+RV T+TPKKPNSALRK+ + RL++
Sbjct: 1   MPTINQLVRHGRK-VIKEKSKSPALQGHPQKRGVCVRVSTMTPKKPNSALRKIARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPG++Y++IRG LD  GV+NRKQ+RS+YG 
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGIRYKIIRGALDTDGVENRKQSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|161621792|ref|YP_056559.2| 30S ribosomal protein S12 [Propionibacterium acnes KPA171202]
 gi|282855223|ref|ZP_06264555.1| ribosomal protein S12 [Propionibacterium acnes J139]
 gi|289427641|ref|ZP_06429353.1| ribosomal protein S12 [Propionibacterium acnes J165]
 gi|295131404|ref|YP_003582067.1| ribosomal protein S12 [Propionibacterium acnes SK137]
 gi|60390805|sp|Q6A6L2|RS12_PROAC RecName: Full=30S ribosomal protein S12
 gi|282581811|gb|EFB87196.1| ribosomal protein S12 [Propionibacterium acnes J139]
 gi|289159132|gb|EFD07324.1| ribosomal protein S12 [Propionibacterium acnes J165]
 gi|291375652|gb|ADD99506.1| ribosomal protein S12 [Propionibacterium acnes SK137]
 gi|313763095|gb|EFS34459.1| ribosomal protein S12 [Propionibacterium acnes HL013PA1]
 gi|313773040|gb|EFS39006.1| ribosomal protein S12 [Propionibacterium acnes HL074PA1]
 gi|313794074|gb|EFS42096.1| ribosomal protein S12 [Propionibacterium acnes HL110PA1]
 gi|313800955|gb|EFS42229.1| ribosomal protein S12 [Propionibacterium acnes HL110PA2]
 gi|313807833|gb|EFS46317.1| ribosomal protein S12 [Propionibacterium acnes HL087PA2]
 gi|313812055|gb|EFS49769.1| ribosomal protein S12 [Propionibacterium acnes HL083PA1]
 gi|313812119|gb|EFS49833.1| ribosomal protein S12 [Propionibacterium acnes HL025PA1]
 gi|313816865|gb|EFS54579.1| ribosomal protein S12 [Propionibacterium acnes HL059PA1]
 gi|313819400|gb|EFS57114.1| ribosomal protein S12 [Propionibacterium acnes HL046PA2]
 gi|313819775|gb|EFS57489.1| ribosomal protein S12 [Propionibacterium acnes HL036PA1]
 gi|313823293|gb|EFS61007.1| ribosomal protein S12 [Propionibacterium acnes HL036PA2]
 gi|313827224|gb|EFS64938.1| ribosomal protein S12 [Propionibacterium acnes HL063PA1]
 gi|313828446|gb|EFS66160.1| ribosomal protein S12 [Propionibacterium acnes HL063PA2]
 gi|313830041|gb|EFS67755.1| ribosomal protein S12 [Propionibacterium acnes HL007PA1]
 gi|313833501|gb|EFS71215.1| ribosomal protein S12 [Propionibacterium acnes HL056PA1]
 gi|313838105|gb|EFS75819.1| ribosomal protein S12 [Propionibacterium acnes HL086PA1]
 gi|314914574|gb|EFS78405.1| ribosomal protein S12 [Propionibacterium acnes HL005PA4]
 gi|314919181|gb|EFS83012.1| ribosomal protein S12 [Propionibacterium acnes HL050PA1]
 gi|314920616|gb|EFS84447.1| ribosomal protein S12 [Propionibacterium acnes HL050PA3]
 gi|314924085|gb|EFS87916.1| ribosomal protein S12 [Propionibacterium acnes HL001PA1]
 gi|314925966|gb|EFS89797.1| ribosomal protein S12 [Propionibacterium acnes HL036PA3]
 gi|314931388|gb|EFS95219.1| ribosomal protein S12 [Propionibacterium acnes HL067PA1]
 gi|314957034|gb|EFT01140.1| ribosomal protein S12 [Propionibacterium acnes HL027PA1]
 gi|314957848|gb|EFT01951.1| ribosomal protein S12 [Propionibacterium acnes HL002PA1]
 gi|314960660|gb|EFT04761.1| ribosomal protein S12 [Propionibacterium acnes HL002PA2]
 gi|314963384|gb|EFT07484.1| ribosomal protein S12 [Propionibacterium acnes HL082PA1]
 gi|314965007|gb|EFT09106.1| ribosomal protein S12 [Propionibacterium acnes HL082PA2]
 gi|314969751|gb|EFT13849.1| ribosomal protein S12 [Propionibacterium acnes HL037PA1]
 gi|314973109|gb|EFT17205.1| ribosomal protein S12 [Propionibacterium acnes HL053PA1]
 gi|314975630|gb|EFT19725.1| ribosomal protein S12 [Propionibacterium acnes HL045PA1]
 gi|314979113|gb|EFT23207.1| ribosomal protein S12 [Propionibacterium acnes HL072PA2]
 gi|314983129|gb|EFT27221.1| ribosomal protein S12 [Propionibacterium acnes HL110PA3]
 gi|314985822|gb|EFT29914.1| ribosomal protein S12 [Propionibacterium acnes HL005PA1]
 gi|314988424|gb|EFT32515.1| ribosomal protein S12 [Propionibacterium acnes HL005PA2]
 gi|314988848|gb|EFT32939.1| ribosomal protein S12 [Propionibacterium acnes HL005PA3]
 gi|315077089|gb|EFT49164.1| ribosomal protein S12 [Propionibacterium acnes HL053PA2]
 gi|315079781|gb|EFT51757.1| ribosomal protein S12 [Propionibacterium acnes HL078PA1]
 gi|315084882|gb|EFT56858.1| ribosomal protein S12 [Propionibacterium acnes HL027PA2]
 gi|315086985|gb|EFT58961.1| ribosomal protein S12 [Propionibacterium acnes HL002PA3]
 gi|315088983|gb|EFT60959.1| ribosomal protein S12 [Propionibacterium acnes HL072PA1]
 gi|315090626|gb|EFT62602.1| ribosomal protein S12 [Propionibacterium acnes HL110PA4]
 gi|315093822|gb|EFT65798.1| ribosomal protein S12 [Propionibacterium acnes HL060PA1]
 gi|315096831|gb|EFT68807.1| ribosomal protein S12 [Propionibacterium acnes HL038PA1]
 gi|315097830|gb|EFT69806.1| ribosomal protein S12 [Propionibacterium acnes HL059PA2]
 gi|315100561|gb|EFT72537.1| ribosomal protein S12 [Propionibacterium acnes HL046PA1]
 gi|315104038|gb|EFT76014.1| ribosomal protein S12 [Propionibacterium acnes HL050PA2]
 gi|315106032|gb|EFT78008.1| ribosomal protein S12 [Propionibacterium acnes HL030PA1]
 gi|315109368|gb|EFT81344.1| ribosomal protein S12 [Propionibacterium acnes HL030PA2]
 gi|327325018|gb|EGE66827.1| ribosomal protein S12 [Propionibacterium acnes HL096PA3]
 gi|327325511|gb|EGE67311.1| ribosomal protein S12 [Propionibacterium acnes HL096PA2]
 gi|327326449|gb|EGE68238.1| ribosomal protein S12 [Propionibacterium acnes HL103PA1]
 gi|327333065|gb|EGE74795.1| ribosomal protein S12 [Propionibacterium acnes HL097PA1]
 gi|327444109|gb|EGE90763.1| ribosomal protein S12 [Propionibacterium acnes HL013PA2]
 gi|327444320|gb|EGE90974.1| ribosomal protein S12 [Propionibacterium acnes HL043PA1]
 gi|327444581|gb|EGE91235.1| ribosomal protein S12 [Propionibacterium acnes HL043PA2]
 gi|327451382|gb|EGE98036.1| ribosomal protein S12 [Propionibacterium acnes HL092PA1]
 gi|327452619|gb|EGE99273.1| ribosomal protein S12 [Propionibacterium acnes HL087PA3]
 gi|327452650|gb|EGE99304.1| ribosomal protein S12 [Propionibacterium acnes HL083PA2]
 gi|328751928|gb|EGF65544.1| ribosomal protein S12 [Propionibacterium acnes HL087PA1]
 gi|328752487|gb|EGF66103.1| ribosomal protein S12 [Propionibacterium acnes HL025PA2]
 gi|328755554|gb|EGF69170.1| ribosomal protein S12 [Propionibacterium acnes HL020PA1]
 gi|328761271|gb|EGF74800.1| ribosomal protein S12 [Propionibacterium acnes HL099PA1]
          Length = 123

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R     +  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIQQLVRKGRTDKI-SKNKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK RKQARSRYGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGSLDTQGVKGRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|113474341|ref|YP_720402.1| 30S ribosomal protein S12 [Trichodesmium erythraeum IMS101]
 gi|119366817|sp|Q118Z5|RS12_TRIEI RecName: Full=30S ribosomal protein S12
 gi|110165389|gb|ABG49929.1| SSU ribosomal protein S12P [Trichodesmium erythraeum IMS101]
          Length = 124

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ + +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSARQDTEKQ-TKSPALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+RKQ+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|239817880|ref|YP_002946790.1| ribosomal protein S12 [Variovorax paradoxus S110]
 gi|319796224|ref|YP_004157864.1| ribosomal protein s12 [Variovorax paradoxus EPS]
 gi|259494666|sp|C5CP60|RS12_VARPS RecName: Full=30S ribosomal protein S12
 gi|239804457|gb|ACS21524.1| ribosomal protein S12 [Variovorax paradoxus S110]
 gi|315598687|gb|ADU39753.1| ribosomal protein S12 [Variovorax paradoxus EPS]
          Length = 125

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R    +  +K  A++ +PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRQGRTVE-KINSKSPAMQNSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|163783786|ref|ZP_02178770.1| 30S ribosomal protein S12 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880939|gb|EDP74459.1| 30S ribosomal protein S12 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 128

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI K  +   +  +K  AL GNPQKRGVC+RVYTVTPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLI-KYGREKRKKKSKSPALEGNPQKRGVCVRVYTVTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+VIRG LDA GV+ R+Q+RS+YGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKVIRGTLDAAGVQGRRQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|308272983|emb|CBX29587.1| 30S ribosomal protein S12 [uncultured Desulfobacterium sp.]
          Length = 123

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 103/126 (81%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVT--ALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           MPT+NQL+RK   G  +   KVT  AL+G PQKRGVC RVYT TPKKPNSALRKV + RL
Sbjct: 1   MPTINQLVRK---GRSKIAKKVTTPALKGAPQKRGVCTRVYTSTPKKPNSALRKVARVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           TSG EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV++RK++RS+Y
Sbjct: 58  TSGAEVTAYIPGVGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDTLGVEDRKKSRSKY 117

Query: 119 GAERPK 124
           GA+RPK
Sbjct: 118 GAKRPK 123


>gi|294670621|ref|ZP_06735499.1| hypothetical protein NEIELOOT_02345 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307660|gb|EFE48903.1| hypothetical protein NEIELOOT_02345 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 139

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+       KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 17  MPTINQLVRKGRQKPVYV-NKVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCKVRLTN 75

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YGA
Sbjct: 76  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQARSKYGA 135

Query: 121 ERPK 124
           +RPK
Sbjct: 136 KRPK 139


>gi|289209334|ref|YP_003461400.1| ribosomal protein S12 [Thioalkalivibrio sp. K90mix]
 gi|288944965|gb|ADC72664.1| ribosomal protein S12 [Thioalkalivibrio sp. K90mix]
          Length = 125

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK      + V AL+G+PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRPVEK-SDVPALQGSPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD QGV+NR Q RS+YG 
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTQGVQNRTQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|262037253|ref|ZP_06010735.1| ribosomal protein S12 [Leptotrichia goodfellowii F0264]
 gi|261748725|gb|EEY36082.1| ribosomal protein S12 [Leptotrichia goodfellowii F0264]
          Length = 128

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 100/123 (81%), Gaps = 1/123 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  R  S +   K  AL+GNPQKRGVC+RVYT TPKKPNSALRKV + +L +
Sbjct: 1   MPTINQLVRFGRSTSEKK-KKSPALKGNPQKRGVCVRVYTTTPKKPNSALRKVARVKLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V+L GGR KDLPGV+Y++IRG LD  GV NRKQ RSRYGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSIVLLRGGRTKDLPGVRYKIIRGALDTAGVVNRKQGRSRYGA 119

Query: 121 ERP 123
           ++P
Sbjct: 120 KKP 122


>gi|317485851|ref|ZP_07944714.1| ribosomal protein S12 [Bilophila wadsworthia 3_1_6]
 gi|316922893|gb|EFV44116.1| ribosomal protein S12 [Bilophila wadsworthia 3_1_6]
          Length = 124

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  RK   +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRVARKKVVKH-KKTPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RG LD  GV++R+Q RS+YGA
Sbjct: 60  GLEVTAYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIVRGTLDTSGVQDRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|57547702|gb|AAW52541.1| RpsL [Micromonospora sp. ATCC 39149]
          Length = 124

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    +  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +L+S
Sbjct: 1   MPTIQQLVRKGRQAKT-SKTKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGV+NRKQARSRYGA
Sbjct: 60  QIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGSLDTQGVRNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|120609036|ref|YP_968714.1| 30S ribosomal protein S12 [Acidovorax citrulli AAC00-1]
 gi|326315219|ref|YP_004232891.1| 30S ribosomal protein S12 [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|158513022|sp|A1TJ02|RS12_ACIAC RecName: Full=30S ribosomal protein S12
 gi|120587500|gb|ABM30940.1| SSU ribosomal protein S12P [Acidovorax citrulli AAC00-1]
 gi|323372055|gb|ADX44324.1| ribosomal protein S12 [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 125

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R+      +K  A++ +PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRQGREVET-TKSKSPAMQNSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|218246377|ref|YP_002371748.1| 30S ribosomal protein S12 [Cyanothece sp. PCC 8801]
 gi|257059421|ref|YP_003137309.1| 30S ribosomal protein S12 [Cyanothece sp. PCC 8802]
 gi|226708485|sp|B7JUP8|RS12_CYAP8 RecName: Full=30S ribosomal protein S12
 gi|218166855|gb|ACK65592.1| ribosomal protein S12 [Cyanothece sp. PCC 8801]
 gi|256589587|gb|ACV00474.1| ribosomal protein S12 [Cyanothece sp. PCC 8802]
          Length = 125

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R    +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSER-SKLKKKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDAQGVK+RKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAQGVKDRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|292669867|ref|ZP_06603293.1| 30S ribosomal protein S12 [Selenomonas noxia ATCC 43541]
 gi|313895174|ref|ZP_07828731.1| ribosomal protein S12 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|292648664|gb|EFF66636.1| 30S ribosomal protein S12 [Selenomonas noxia ATCC 43541]
 gi|312976069|gb|EFR41527.1| ribosomal protein S12 [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 125

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK S    +K  AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKSRK-SLEEKSKAPALKNSPQKRGVCTRVYTSTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV++R Q RS+YGA
Sbjct: 60  SIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGSLDTAGVQDRAQGRSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|239918206|ref|YP_002957764.1| SSU ribosomal protein S12P [Micrococcus luteus NCTC 2665]
 gi|281415603|ref|ZP_06247345.1| 30S ribosomal protein S12 [Micrococcus luteus NCTC 2665]
 gi|289705073|ref|ZP_06501484.1| ribosomal protein S12 [Micrococcus luteus SK58]
 gi|259494657|sp|C5CC69|RS12_MICLC RecName: Full=30S ribosomal protein S12
 gi|239839413|gb|ACS31210.1| SSU ribosomal protein S12P [Micrococcus luteus NCTC 2665]
 gi|289558236|gb|EFD51516.1| ribosomal protein S12 [Micrococcus luteus SK58]
          Length = 124

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R        K  AL+GNP +RGVC RVYT TPKKPNSALRKV + RL  
Sbjct: 1   MPTIQQLVRKGRSPKV-VNTKAPALQGNPMRRGVCTRVYTTTPKKPNSALRKVARVRLNG 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVKNR QARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQGVKNRGQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|88854692|ref|ZP_01129358.1| 30S ribosomal protein S12 [marine actinobacterium PHSC20C1]
 gi|88815853|gb|EAR25709.1| 30S ribosomal protein S12 [marine actinobacterium PHSC20C1]
          Length = 124

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R        K  AL+ NPQ+RGVC RVYT TPKKPNSALRKV + +L++
Sbjct: 1   MPTIQQLVRKGRTPKV-VKTKAPALKSNPQQRGVCTRVYTTTPKKPNSALRKVARVKLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD Q VKNRKQARSRYGA
Sbjct: 60  GTEVTAYIPGEGHNLQEHSMVLIRGGRVKDLPGVRYKIVRGALDTQAVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKDK 123


>gi|261854945|ref|YP_003262228.1| ribosomal protein S12 [Halothiobacillus neapolitanus c2]
 gi|261835414|gb|ACX95181.1| ribosomal protein S12 [Halothiobacillus neapolitanus c2]
          Length = 125

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPRK       KV AL G PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MATVNQLVRKPRK-RLVEKTKVPALEGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV  Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y V+RG LD QGV  R+Q RS+YGA
Sbjct: 60  GFEVTGYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGSLDTQGVDKRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|330470178|ref|YP_004407921.1| 30S ribosomal protein S12 [Verrucosispora maris AB-18-032]
 gi|328813149|gb|AEB47321.1| 30S ribosomal protein S12 [Verrucosispora maris AB-18-032]
          Length = 124

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +L+S
Sbjct: 1   MPTIQQLVRKGRQAKT-TKTKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGV+NRKQARSRYGA
Sbjct: 60  QVEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGSLDTQGVRNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|261338052|ref|ZP_05965936.1| ribosomal protein S12 [Bifidobacterium gallicum DSM 20093]
 gi|270276665|gb|EFA22519.1| ribosomal protein S12 [Bifidobacterium gallicum DSM 20093]
          Length = 123

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK RK   +  +K  AL+G+P +RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIEQLVRKGRKAKPKK-SKTLALKGSPLRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ RS YGA
Sbjct: 60  GVEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVKDRKQGRSLYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|283852738|ref|ZP_06370003.1| ribosomal protein S12 [Desulfovibrio sp. FW1012B]
 gi|283571916|gb|EFC19911.1| ribosomal protein S12 [Desulfovibrio sp. FW1012B]
          Length = 123

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R        K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKER-AQVAKRRKTPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GV +R+Q RS+YGA
Sbjct: 60  GIEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVSDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|300865130|ref|ZP_07109955.1| 30S ribosomal protein S12 [Oscillatoria sp. PCC 6506]
 gi|300336901|emb|CBN55105.1| 30S ribosomal protein S12 [Oscillatoria sp. PCC 6506]
          Length = 129

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ + +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSAREETQKK-TKSPALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+RKQ RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|157325554|ref|YP_001468287.1| ribosomal protein S12 [Ipomoea purpurea]
 gi|157325593|ref|YP_001468332.1| ribosomal protein S12 [Ipomoea purpurea]
 gi|157056782|gb|ABV02372.1| ribosomal protein S12 [Ipomoea purpurea]
 gi|157056821|gb|ABV02411.1| ribosomal protein S12 [Ipomoea purpurea]
          Length = 123

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR PR+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNPRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|13518462|ref|NP_084777.1| ribosomal protein S12 [Lotus japonicus]
 gi|18202718|sp|Q9B133|RR12_LOTJA RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|13359003|dbj|BAB33220.1| ribosomal protein S12 [Lotus japonicus]
 gi|13359024|dbj|BAB33241.1| ribosomal protein S12 [Lotus japonicus]
          Length = 123

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRK R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTMKQLIRKTRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YGA
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|91786162|ref|YP_547114.1| 30S ribosomal protein S12 [Polaromonas sp. JS666]
 gi|119366790|sp|Q12GX6|RS12_POLSJ RecName: Full=30S ribosomal protein S12
 gi|91695387|gb|ABE42216.1| SSU ribosomal protein S12P [Polaromonas sp. JS666]
          Length = 125

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R+   +  +K  A+  +PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRQGREVE-KIKSKSPAMENSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+I+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEIISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|121603115|ref|YP_980444.1| 30S ribosomal protein S12 [Polaromonas naphthalenivorans CJ2]
 gi|158513919|sp|A1VIP5|RS12_POLNA RecName: Full=30S ribosomal protein S12
 gi|120592084|gb|ABM35523.1| SSU ribosomal protein S12P [Polaromonas naphthalenivorans CJ2]
          Length = 125

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R+   +  +K  A+  +PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRQGREVE-KIKSKSPAMENSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+I+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEIISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|303246988|ref|ZP_07333264.1| ribosomal protein S12 [Desulfovibrio fructosovorans JJ]
 gi|302491695|gb|EFL51578.1| ribosomal protein S12 [Desulfovibrio fructosovorans JJ]
          Length = 123

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R        K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKER-AQVTKRRKTPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GV +R+Q RS+YGA
Sbjct: 60  GIEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVADRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|332108090|gb|EGJ09314.1| 30S ribosomal protein S12 [Rubrivivax benzoatilyticus JA2]
          Length = 125

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R+      +K  A++  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRQGRQAEV-TKSKSPAMQNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|262197192|ref|YP_003268401.1| ribosomal protein S12 [Haliangium ochraceum DSM 14365]
 gi|262080539|gb|ACY16508.1| ribosomal protein S12 [Haliangium ochraceum DSM 14365]
          Length = 123

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   +      AL+  PQKRGVC+RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRQ-KVKKKGTAPALKACPQKRGVCVRVYTSTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV NRKQ+RS+YG 
Sbjct: 60  GIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTTGVANRKQSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|320529791|ref|ZP_08030868.1| ribosomal protein S12 [Selenomonas artemidis F0399]
 gi|320137809|gb|EFW29714.1| ribosomal protein S12 [Selenomonas artemidis F0399]
          Length = 143

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK S    +K  AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 19  MPTINQLIRKSRK-SLEEKSKAPALKNSPQKRGVCTRVYTSTPKKPNSALRKVARVRLTN 77

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV++R Q RS+YGA
Sbjct: 78  SIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGSLDTAGVQDRAQGRSKYGA 137

Query: 121 ERPK 124
           +R K
Sbjct: 138 KRAK 141


>gi|289178396|gb|ADC85642.1| SSU ribosomal protein S12P [Bifidobacterium animalis subsp. lactis
           BB-12]
          Length = 123

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK RK   +  +K  AL+G+P +RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIEQLVRKGRKAKPKK-SKTLALKGSPLRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ RS YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVKDRKQGRSLYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|120553647|ref|YP_957998.1| 30S ribosomal protein S12 [Marinobacter aquaeolei VT8]
 gi|158513042|sp|A1TYJ2|RS12_MARAV RecName: Full=30S ribosomal protein S12
 gi|120323496|gb|ABM17811.1| SSU ribosomal protein S12P [Marinobacter aquaeolei VT8]
          Length = 124

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK    A + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRKV-AKSDVPALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD QGV+NRKQ RS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTQGVQNRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|119485453|ref|ZP_01619781.1| 30S ribosomal protein S12 [Lyngbya sp. PCC 8106]
 gi|119457209|gb|EAW38335.1| 30S ribosomal protein S12 [Lyngbya sp. PCC 8106]
          Length = 123

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ + +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSAREKALKK-TKSPALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+R+Q RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|114800161|ref|YP_761534.1| 30S ribosomal protein S12 [Hyphomonas neptunium ATCC 15444]
 gi|119366777|sp|Q0BYA9|RS12_HYPNA RecName: Full=30S ribosomal protein S12
 gi|114740335|gb|ABI78460.1| ribosomal protein S12 [Hyphomonas neptunium ATCC 15444]
          Length = 123

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR PR+   R   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K R+TS
Sbjct: 1   MPTIQQLIRNPREPK-RTRTKTPALKACPQRRGVCTRVYTTTPKKPNSALRKVAKVRMTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E + Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD Q VKNRKQ RS YGA
Sbjct: 60  GFESLCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTQPVKNRKQRRSHYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|145596439|ref|YP_001160736.1| 30S ribosomal protein S12 [Salinispora tropica CNB-440]
 gi|159039839|ref|YP_001539092.1| 30S ribosomal protein S12 [Salinispora arenicola CNS-205]
 gi|302869977|ref|YP_003838614.1| 30S ribosomal protein S12 [Micromonospora aurantiaca ATCC 27029]
 gi|315501438|ref|YP_004080325.1| ribosomal protein s12 [Micromonospora sp. L5]
 gi|189040476|sp|A8M534|RS12_SALAI RecName: Full=30S ribosomal protein S12
 gi|189040477|sp|A4XBQ1|RS12_SALTO RecName: Full=30S ribosomal protein S12
 gi|145305776|gb|ABP56358.1| SSU ribosomal protein S12P [Salinispora tropica CNB-440]
 gi|157918674|gb|ABW00102.1| ribosomal protein S12 [Salinispora arenicola CNS-205]
 gi|302572836|gb|ADL49038.1| ribosomal protein S12 [Micromonospora aurantiaca ATCC 27029]
 gi|315408057|gb|ADU06174.1| ribosomal protein S12 [Micromonospora sp. L5]
          Length = 124

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +L+S
Sbjct: 1   MPTIQQLVRKGRQAKT-TKTKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGV+NRKQARSRYGA
Sbjct: 60  QIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGSLDTQGVRNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|319957691|ref|YP_004168954.1| SSU ribosomal protein s12p [Nitratifractor salsuginis DSM 16511]
 gi|319420095|gb|ADV47205.1| SSU ribosomal protein S12P [Nitratifractor salsuginis DSM 16511]
          Length = 123

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK   +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLIRKERKKVIKK-SKSPALVNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LDA GV NRK +RS+YG 
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDAAGVANRKVSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|53723859|ref|YP_104171.1| 30S ribosomal protein S12 [Burkholderia mallei ATCC 23344]
 gi|121601470|ref|YP_994461.1| 30S ribosomal protein S12 [Burkholderia mallei SAVP1]
 gi|124385891|ref|YP_001027890.1| 30S ribosomal protein S12 [Burkholderia mallei NCTC 10229]
 gi|126450225|ref|YP_001082985.1| 30S ribosomal protein S12 [Burkholderia mallei NCTC 10247]
 gi|167003559|ref|ZP_02269345.1| 30S ribosomal protein S12 [Burkholderia mallei PRL-20]
 gi|238563283|ref|ZP_00439106.2| 30S ribosomal protein S12 [Burkholderia mallei GB8 horse 4]
 gi|254175136|ref|ZP_04881797.1| 30S ribosomal protein S12 [Burkholderia mallei ATCC 10399]
 gi|254201242|ref|ZP_04907606.1| 30S ribosomal protein S12 [Burkholderia mallei FMH]
 gi|254206583|ref|ZP_04912934.1| 30S ribosomal protein S12 [Burkholderia mallei JHU]
 gi|254357121|ref|ZP_04973395.1| 30S ribosomal protein S12 [Burkholderia mallei 2002721280]
 gi|60390783|sp|Q62GK0|RS12_BURMA RecName: Full=30S ribosomal protein S12
 gi|166231848|sp|A3MRU9|RS12_BURM7 RecName: Full=30S ribosomal protein S12
 gi|166231849|sp|A2S7H1|RS12_BURM9 RecName: Full=30S ribosomal protein S12
 gi|166231850|sp|A1V8A8|RS12_BURMS RecName: Full=30S ribosomal protein S12
 gi|52427282|gb|AAU47875.1| ribosomal protein S12 [Burkholderia mallei ATCC 23344]
 gi|121230280|gb|ABM52798.1| 30S ribosomal protein S12 [Burkholderia mallei SAVP1]
 gi|124293911|gb|ABN03180.1| 30S ribosomal protein S12 [Burkholderia mallei NCTC 10229]
 gi|126243095|gb|ABO06188.1| 30S ribosomal protein S12 [Burkholderia mallei NCTC 10247]
 gi|147747136|gb|EDK54212.1| 30S ribosomal protein S12 [Burkholderia mallei FMH]
 gi|147752125|gb|EDK59191.1| 30S ribosomal protein S12 [Burkholderia mallei JHU]
 gi|148026185|gb|EDK84270.1| 30S ribosomal protein S12 [Burkholderia mallei 2002721280]
 gi|160696181|gb|EDP86151.1| 30S ribosomal protein S12 [Burkholderia mallei ATCC 10399]
 gi|238520988|gb|EEP84443.1| 30S ribosomal protein S12 [Burkholderia mallei GB8 horse 4]
 gi|243060918|gb|EES43104.1| 30S ribosomal protein S12 [Burkholderia mallei PRL-20]
          Length = 126

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R  S    +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGR-ASETTKSKSPALQDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+R+QARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRRQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|227825095|ref|ZP_03989927.1| 30S ribosomal protein S12 [Acidaminococcus sp. D21]
 gi|226905594|gb|EEH91512.1| 30S ribosomal protein S12 [Acidaminococcus sp. D21]
          Length = 127

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R+      +   AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKGRQ-VVTQKSTAPALKNSPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV +R QARS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVADRAQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|18860335|ref|NP_569606.1| ribosomal protein S12 [Psilotum nudum]
 gi|18860359|ref|NP_569605.1| ribosomal protein S12 [Psilotum nudum]
 gi|22654085|sp|Q8W8R9|RR12_PSINU RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|18389488|dbj|BAB84240.1| ribosomal protein S12 [Psilotum nudum]
 gi|18389512|dbj|BAB84264.1| ribosomal protein S12 [Psilotum nudum]
          Length = 123

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R+  K  ALRG PQ+RGVC+RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRNARQ-PIRSRTKSPALRGCPQRRGVCIRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV + GGRVKDLPGV+Y ++RG LDA GVK+RKQ RSRYG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVSVRGGRVKDLPGVRYHIVRGTLDAVGVKDRKQGRSRYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|15676064|ref|NP_273194.1| 30S ribosomal protein S12 [Neisseria meningitidis MC58]
 gi|121634011|ref|YP_974256.1| 30S ribosomal protein S12 [Neisseria meningitidis FAM18]
 gi|161870921|ref|YP_001600101.1| 30S ribosomal protein S12 [Neisseria meningitidis 053442]
 gi|218767176|ref|YP_002341688.1| 30S ribosomal protein S12 [Neisseria meningitidis Z2491]
 gi|225076439|ref|ZP_03719638.1| hypothetical protein NEIFLAOT_01485 [Neisseria flavescens
           NRL30031/H210]
 gi|238021682|ref|ZP_04602108.1| hypothetical protein GCWU000324_01585 [Kingella oralis ATCC 51147]
 gi|239997920|ref|ZP_04717844.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae 35/02]
 gi|240015101|ref|ZP_04722014.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae DGI18]
 gi|240017550|ref|ZP_04724090.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae FA6140]
 gi|240081693|ref|ZP_04726236.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae FA19]
 gi|240122173|ref|ZP_04735135.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae PID24-1]
 gi|240124465|ref|ZP_04737421.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae PID332]
 gi|240124667|ref|ZP_04737553.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae SK-92-679]
 gi|240129139|ref|ZP_04741800.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae SK-93-1035]
 gi|241758471|ref|ZP_04756592.1| ribosomal protein S12 [Neisseria flavescens SK114]
 gi|254805819|ref|YP_003084040.1| 30S ribosomal protein S12 [Neisseria meningitidis alpha14]
 gi|260439536|ref|ZP_05793352.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae DGI2]
 gi|261401765|ref|ZP_05987890.1| ribosomal protein S12 [Neisseria lactamica ATCC 23970]
 gi|268593770|ref|ZP_06127937.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae 35/02]
 gi|268597791|ref|ZP_06131958.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae FA19]
 gi|268683095|ref|ZP_06149957.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae PID332]
 gi|268683242|ref|ZP_06150104.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae SK-92-679]
 gi|268687522|ref|ZP_06154384.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae SK-93-1035]
 gi|291042771|ref|ZP_06568512.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae DGI2]
 gi|293398209|ref|ZP_06642414.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae F62]
 gi|294788098|ref|ZP_06753342.1| ribosomal protein S12 [Simonsiella muelleri ATCC 29453]
 gi|298370596|ref|ZP_06981911.1| ribosomal protein S12 [Neisseria sp. oral taxon 014 str. F0314]
 gi|313667434|ref|YP_004047718.1| 30S ribosomal protein S12 [Neisseria lactamica ST-640]
 gi|319639544|ref|ZP_07994291.1| 30S ribosomal protein S12 [Neisseria mucosa C102]
 gi|329118781|ref|ZP_08247479.1| 30S ribosomal protein S12 [Neisseria bacilliformis ATCC BAA-1200]
 gi|54039344|sp|P66375|RS12_NEIMB RecName: Full=30S ribosomal protein S12
 gi|54042117|sp|P66374|RS12_NEIMA RecName: Full=30S ribosomal protein S12
 gi|158513129|sp|A1KRG8|RS12_NEIMF RecName: Full=30S ribosomal protein S12
 gi|189040468|sp|A9M3X2|RS12_NEIM0 RecName: Full=30S ribosomal protein S12
 gi|7225354|gb|AAF40595.1| 30S ribosomal protein S12 [Neisseria meningitidis MC58]
 gi|120865717|emb|CAM09444.1| 30S ribosomal protein S12 [Neisseria meningitidis FAM18]
 gi|121051184|emb|CAM07455.1| 30S ribosomal protein S12 [Neisseria meningitidis Z2491]
 gi|161596474|gb|ABX74134.1| 30S ribosomal protein S12 [Neisseria meningitidis 053442]
 gi|224952239|gb|EEG33448.1| hypothetical protein NEIFLAOT_01485 [Neisseria flavescens
           NRL30031/H210]
 gi|237866296|gb|EEP67338.1| hypothetical protein GCWU000324_01585 [Kingella oralis ATCC 51147]
 gi|241321399|gb|EER57534.1| ribosomal protein S12 [Neisseria flavescens SK114]
 gi|254669361|emb|CBA08460.1| 30S ribosomal protein S12 [Neisseria meningitidis alpha14]
 gi|254671122|emb|CBA08126.1| 30S ribosomal protein S12 [Neisseria meningitidis alpha153]
 gi|254672714|emb|CBA06653.1| 30S ribosomal protein S12 [Neisseria meningitidis alpha275]
 gi|261391673|emb|CAX49121.1| 30S ribosomal protein S12 [Neisseria meningitidis 8013]
 gi|268547159|gb|EEZ42577.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae 35/02]
 gi|268551579|gb|EEZ46598.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae FA19]
 gi|268623379|gb|EEZ55779.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae PID332]
 gi|268623526|gb|EEZ55926.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae SK-92-679]
 gi|268627806|gb|EEZ60206.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae SK-93-1035]
 gi|269208108|gb|EEZ74563.1| ribosomal protein S12 [Neisseria lactamica ATCC 23970]
 gi|291013205|gb|EFE05171.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae DGI2]
 gi|291611472|gb|EFF40542.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae F62]
 gi|294484391|gb|EFG32074.1| ribosomal protein S12 [Simonsiella muelleri ATCC 29453]
 gi|298281206|gb|EFI22696.1| ribosomal protein S12 [Neisseria sp. oral taxon 014 str. F0314]
 gi|308388353|gb|ADO30673.1| 30S ribosomal protein S12 [Neisseria meningitidis alpha710]
 gi|309379166|emb|CBX22297.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313004896|emb|CBN86322.1| 30S ribosomal protein S12 [Neisseria lactamica 020-06]
 gi|317399115|gb|EFV79789.1| 30S ribosomal protein S12 [Neisseria mucosa C102]
 gi|319411381|emb|CBY91792.1| 30S ribosomal protein S12 [Neisseria meningitidis WUE 2594]
 gi|325127131|gb|EGC50085.1| ribosomal protein S12 [Neisseria meningitidis N1568]
 gi|325131078|gb|EGC53801.1| ribosomal protein S12 [Neisseria meningitidis OX99.30304]
 gi|325133047|gb|EGC55719.1| ribosomal protein S12 [Neisseria meningitidis M6190]
 gi|325135142|gb|EGC57768.1| ribosomal protein S12 [Neisseria meningitidis M13399]
 gi|325137195|gb|EGC59790.1| ribosomal protein S12 [Neisseria meningitidis M0579]
 gi|325139026|gb|EGC61572.1| ribosomal protein S12 [Neisseria meningitidis ES14902]
 gi|325141151|gb|EGC63651.1| ribosomal protein S12 [Neisseria meningitidis CU385]
 gi|325143226|gb|EGC65565.1| ribosomal protein S12 [Neisseria meningitidis 961-5945]
 gi|325145334|gb|EGC67611.1| ribosomal protein S12 [Neisseria meningitidis M01-240013]
 gi|325197422|gb|ADY92878.1| ribosomal protein S12 [Neisseria meningitidis G2136]
 gi|325199349|gb|ADY94804.1| ribosomal protein S12 [Neisseria meningitidis H44/76]
 gi|325203029|gb|ADY98483.1| ribosomal protein S12 [Neisseria meningitidis M01-240149]
 gi|325203256|gb|ADY98709.1| ribosomal protein S12 [Neisseria meningitidis M01-240355]
 gi|325205229|gb|ADZ00682.1| ribosomal protein S12 [Neisseria meningitidis M04-240196]
 gi|325207172|gb|ADZ02624.1| ribosomal protein S12 [Neisseria meningitidis NZ-05/33]
 gi|327465128|gb|EGF11415.1| 30S ribosomal protein S12 [Neisseria bacilliformis ATCC BAA-1200]
          Length = 123

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+       KV AL   PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRQKPVYV-NKVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|121608238|ref|YP_996045.1| 30S ribosomal protein S12 [Verminephrobacter eiseniae EF01-2]
 gi|158513936|sp|A1WHC0|RS12_VEREI RecName: Full=30S ribosomal protein S12
 gi|121552878|gb|ABM57027.1| SSU ribosomal protein S12P [Verminephrobacter eiseniae EF01-2]
          Length = 125

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R+   +  +K  A+  +PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRQGREVE-KIKSKSPAMENSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GSEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|302336388|ref|YP_003801595.1| SSU ribosomal protein S12P [Olsenella uli DSM 7084]
 gi|301320228|gb|ADK68715.1| SSU ribosomal protein S12P [Olsenella uli DSM 7084]
          Length = 124

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R  S +A +K  AL+ NPQKRGVC RV+T TPKKPNSALRKV + RL +
Sbjct: 1   MPTINQLVRQGRV-SHKAKSKNAALQHNPQKRGVCTRVFTTTPKKPNSALRKVARVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y+++RG  D   V++RKQ RSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLIRGGRVRDLPGVRYKIVRGAYDCAAVQDRKQGRSRYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|206889347|ref|YP_002249250.1| ribosomal protein S12 [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|226712666|sp|B5YG52|RS12_THEYD RecName: Full=30S ribosomal protein S12
 gi|206741285|gb|ACI20342.1| ribosomal protein S12 [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 123

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL++K R+       K  AL+  PQKRGVC+RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTISQLVKKGRE-KVEKKTKSPALQSCPQKRGVCVRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEVIAY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD  GV NR+Q+RS+YG 
Sbjct: 60  GVEVIAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDCAGVNNRRQSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|11467742|ref|NP_050794.1| ribosomal protein S12 [Guillardia theta]
 gi|133735|sp|P19461|RR12_GUITH RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|3603067|gb|AAC35728.1| ribosomal protein S12 [Guillardia theta]
          Length = 123

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 100/124 (80%), Gaps = 2/124 (1%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSERQTIQKT--KSPALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 58

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHN+QEHSVV+L GGRVKDLPGV+Y +IRG LDA GVKNRKQ+RS+YGA
Sbjct: 59  GFEVTAYIPGIGHNIQEHSVVLLRGGRVKDLPGVRYHIIRGTLDAAGVKNRKQSRSKYGA 118

Query: 121 ERPK 124
           ++PK
Sbjct: 119 KKPK 122


>gi|257069517|ref|YP_003155772.1| 30S ribosomal protein S12P [Brachybacterium faecium DSM 4810]
 gi|256560335|gb|ACU86182.1| SSU ribosomal protein S12P [Brachybacterium faecium DSM 4810]
          Length = 124

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R  +  + +K  AL+G+PQ+RGVC RVYT TPKKPNSALRK+ + +L++
Sbjct: 1   MPTIQQLVRKGRD-ARSSSSKTPALKGSPQRRGVCTRVYTQTPKKPNSALRKIARVKLST 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD Q VK R+QARSRYGA
Sbjct: 60  GMEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQSVKGRQQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|297571940|ref|YP_003697714.1| ribosomal protein S12 [Arcanobacterium haemolyticum DSM 20595]
 gi|296932287|gb|ADH93095.1| ribosomal protein S12 [Arcanobacterium haemolyticum DSM 20595]
          Length = 124

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R  S  + +   AL+ +PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIQQLVRKGR-SSKASSSNTPALKASPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGVK+R Q RS+YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVKSRNQGRSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|289644510|ref|ZP_06476584.1| ribosomal protein S12 [Frankia symbiont of Datisca glomerata]
 gi|289505672|gb|EFD26697.1| ribosomal protein S12 [Frankia symbiont of Datisca glomerata]
          Length = 124

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+       K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL S
Sbjct: 1   MPTIQQLVRKGRQDKVEKT-KTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLHS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GH+LQEHS+V++ GGRVKDLPGV+Y+++RG LD QGV+NRKQARS+YGA
Sbjct: 60  GIEVTAYIPGVGHSLQEHSIVLVRGGRVKDLPGVRYKIVRGTLDTQGVRNRKQARSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|149376691|ref|ZP_01894450.1| 30S ribosomal protein S12 [Marinobacter algicola DG893]
 gi|149359064|gb|EDM47529.1| 30S ribosomal protein S12 [Marinobacter algicola DG893]
          Length = 124

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK    A + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRKA-AKSDVPALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD QGV+NRKQ RS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTQGVQNRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|294085953|ref|YP_003552713.1| 30S ribosomal protein S12 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665528|gb|ADE40629.1| Ribosomal protein S12 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 123

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  RK       KV A+   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRHGRKRPVER-TKVPAMEACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD QGV +R+Q RS+YGA
Sbjct: 60  GFEVSSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTQGVSDRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|51244971|ref|YP_064855.1| 30S ribosomal protein S12 [Desulfotalea psychrophila LSv54]
 gi|60390807|sp|Q6AP76|RS12_DESPS RecName: Full=30S ribosomal protein S12
 gi|50876008|emb|CAG35848.1| probable 30S ribosomal protein S12 [Desulfotalea psychrophila
           LSv54]
          Length = 124

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 101/123 (82%), Gaps = 1/123 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ RK S +      AL+G PQKRGVC+RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRQGRKKSVKK-TNTPALKGCPQKRGVCVRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVVM+ GGRVKDLPGV+Y VIRG LD  GV +R+Q RS+YGA
Sbjct: 60  GIEVTSYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHVIRGTLDTLGVSDRRQGRSKYGA 119

Query: 121 ERP 123
           ++P
Sbjct: 120 KKP 122


>gi|78221841|ref|YP_383588.1| 30S ribosomal protein S12 [Geobacter metallireducens GS-15]
 gi|115305656|sp|Q39Y11|RS12_GEOMG RecName: Full=30S ribosomal protein S12
 gi|78193096|gb|ABB30863.1| SSU ribosomal protein S12P [Geobacter metallireducens GS-15]
          Length = 123

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  RK S +  +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRIGRK-SKKEKSNSPALKSCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GVK+RKQARS+YGA
Sbjct: 60  GIEVSSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSVGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|154249822|ref|YP_001410647.1| 30S ribosomal protein S12 [Fervidobacterium nodosum Rt17-B1]
 gi|171769381|sp|A7HM57|RS12_FERNB RecName: Full=30S ribosomal protein S12
 gi|154153758|gb|ABS60990.1| ribosomal protein S12 [Fervidobacterium nodosum Rt17-B1]
          Length = 134

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 106/123 (86%), Gaps = 1/123 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL++  R+   +  +K  AL+G+PQKRGVC+RV T+TPKKPNSALRK+ K RL++
Sbjct: 1   MPTINQLVKHGRE-KVKEKSKSPALQGHPQKRGVCVRVSTMTPKKPNSALRKIAKVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LDA GV+NR+Q+RS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAAGVENRRQSRSKYGA 119

Query: 121 ERP 123
           +RP
Sbjct: 120 KRP 122


>gi|28261741|ref|NP_783211.1| ribosomal protein S12 [Atropa belladonna]
 gi|28261764|ref|NP_783210.1| ribosomal protein S12 [Atropa belladonna]
 gi|27151679|sp|Q8RUK6|RR12_ATRBE RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|20068355|emb|CAC88068.1| ribosomal protein S12 [Atropa belladonna]
 gi|20068378|emb|CAC88091.1| ribosomal protein S12 [Atropa belladonna]
          Length = 123

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTINQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|7240599|gb|AAB35201.2| ribosomal protein S12 [Mycobacterium bovis]
          Length = 124

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    +  K  A +G+PQ+R VC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLVRKGRRDKI-SKVKTAAPKGSPQRRRVCNRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA
Sbjct: 60  QVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVQYKIIRGSLDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|119963152|ref|YP_948664.1| 30S ribosomal protein S12 [Arthrobacter aurescens TC1]
 gi|325964172|ref|YP_004242078.1| 30S ribosomal protein S12P [Arthrobacter phenanthrenivorans Sphe3]
 gi|158512967|sp|A1R8V2|RS12_ARTAT RecName: Full=30S ribosomal protein S12
 gi|119950011|gb|ABM08922.1| ribosomal protein S12 [Arthrobacter aurescens TC1]
 gi|323470259|gb|ADX73944.1| SSU ribosomal protein S12P [Arthrobacter phenanthrenivorans Sphe3]
          Length = 124

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R     +  K  AL+G+P +RGVC RVYT TPKKPNSALRKV + RL  
Sbjct: 1   MPTINQLVRKGRTPKV-SKTKAPALKGSPMRRGVCTRVYTTTPKKPNSALRKVARVRLNG 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVKNRKQARSRYGA
Sbjct: 60  GVEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           +  K
Sbjct: 120 KMEK 123


>gi|58038859|ref|YP_190823.1| 30S ribosomal protein S12 [Gluconobacter oxydans 621H]
 gi|62287346|sp|Q5FTX9|RS12_GLUOX RecName: Full=30S ribosomal protein S12
 gi|58001273|gb|AAW60167.1| SSU ribosomal protein S12P [Gluconobacter oxydans 621H]
          Length = 123

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI   R+ + +   KV AL+G PQKRGVC RVYTVTPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIANGREPAAKR-NKVPALQGCPQKRGVCTRVYTVTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV++Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QG+  R+Q RS YGA
Sbjct: 60  GYEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGLAKRRQRRSLYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|291298705|ref|YP_003509983.1| 30S ribosomal protein S12 [Stackebrandtia nassauensis DSM 44728]
 gi|290567925|gb|ADD40890.1| ribosomal protein S12 [Stackebrandtia nassauensis DSM 44728]
          Length = 124

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK RK    +  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL S
Sbjct: 1   MPTIQQLVRKGRKDKV-SKNKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLMS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGV++RKQARS+YGA
Sbjct: 60  GFEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGSLDTQGVRDRKQARSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|184200257|ref|YP_001854464.1| 30S ribosomal protein S12 [Kocuria rhizophila DC2201]
 gi|226708515|sp|B2GIK9|RS12_KOCRD RecName: Full=30S ribosomal protein S12
 gi|183580487|dbj|BAG28958.1| 30S ribosomal protein S12 [Kocuria rhizophila DC2201]
          Length = 124

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R        K  AL+GNP KRGVC RV+T TPKKPNSALRKV + +L  
Sbjct: 1   MPTIQQLVRKGRHSKV-VKTKAPALKGNPMKRGVCTRVFTTTPKKPNSALRKVARVKLNG 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK R+QARSRYGA
Sbjct: 60  GVEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQGVKGRQQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|94266160|ref|ZP_01289872.1| Ribosomal protein S12 [delta proteobacterium MLMS-1]
 gi|93453275|gb|EAT03724.1| Ribosomal protein S12 [delta proteobacterium MLMS-1]
          Length = 123

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ RK   +      A++G PQKRGVC+RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRQGRKTRVKK-TNTPAIKGCPQKRGVCVRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y V+RG LD  GV NRKQ RS+YGA
Sbjct: 60  GIEVTSYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGTLDTLGVANRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|254414706|ref|ZP_05028471.1| ribosomal protein S12 [Microcoleus chthonoplastes PCC 7420]
 gi|196178554|gb|EDX73553.1| ribosomal protein S12 [Microcoleus chthonoplastes PCC 7420]
          Length = 123

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R    +A  K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSER-AKIKAKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+RKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|148260943|ref|YP_001235070.1| 30S ribosomal protein S12 [Acidiphilium cryptum JF-5]
 gi|326404341|ref|YP_004284423.1| 30S ribosomal protein S12 [Acidiphilium multivorum AIU301]
 gi|166231843|sp|A5FZW9|RS12_ACICJ RecName: Full=30S ribosomal protein S12
 gi|146402624|gb|ABQ31151.1| SSU ribosomal protein S12P [Acidiphilium cryptum JF-5]
 gi|325051203|dbj|BAJ81541.1| 30S ribosomal protein S12 [Acidiphilium multivorum AIU301]
          Length = 123

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI K R+   +   KV AL+G PQKRGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIAKGREVRAKR-NKVPALQGCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV++Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QG+  R+Q RS YGA
Sbjct: 60  GYEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGIAKRRQRRSLYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|307635100|gb|ADI85616.2| ribosomal protein S12 [Geobacter sulfurreducens KN400]
          Length = 123

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  R+G  +  +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRSGRQGK-KVKSDSPALKSCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GVK+RKQ RS+YGA
Sbjct: 60  GIEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSVGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|295065707|ref|YP_003587647.1| ribosomal protein S12 [Anomochloa marantoidea]
 gi|295065751|ref|YP_003587691.1| ribosomal protein S12 [Anomochloa marantoidea]
 gi|251765231|gb|ACT15385.1| ribosomal protein S12 [Anomochloa marantoidea]
 gi|251765275|gb|ACT15429.1| ribosomal protein S12 [Anomochloa marantoidea]
          Length = 124

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTV QLIRK R+   R   K  AL+G PQ+RG C+RVYT+ PKKPNSALRKV + RLTS
Sbjct: 1   MPTVKQLIRKARQ-PIRNARKSAALKGCPQRRGTCVRVYTINPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+YR+IRG LDA  VKNR+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDAVAVKNRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|289579150|ref|YP_003477777.1| ribosomal protein S12 [Thermoanaerobacter italicus Ab9]
 gi|289528863|gb|ADD03215.1| ribosomal protein S12 [Thermoanaerobacter italicus Ab9]
          Length = 124

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  RK   +  +   AL GNPQKRGVC+ V T TPKKPNSALRK+ + RLT+
Sbjct: 1   MPTINQLVRYGRK-PVKYKSAAPALEGNPQKRGVCVVVKTTTPKKPNSALRKIARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA GV NRKQARSRYGA
Sbjct: 60  GTEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDAAGVANRKQARSRYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|116671528|ref|YP_832461.1| 30S ribosomal protein S12 [Arthrobacter sp. FB24]
 gi|220913440|ref|YP_002488749.1| 30S ribosomal protein S12 [Arthrobacter chlorophenolicus A6]
 gi|158512271|sp|A0JZ91|RS12_ARTS2 RecName: Full=30S ribosomal protein S12
 gi|254811063|sp|B8HD14|RS12_ARTCA RecName: Full=30S ribosomal protein S12
 gi|116611637|gb|ABK04361.1| SSU ribosomal protein S12P [Arthrobacter sp. FB24]
 gi|219860318|gb|ACL40660.1| ribosomal protein S12 [Arthrobacter chlorophenolicus A6]
          Length = 124

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R    +   K  AL G+P +RGVC RVYT TPKKPNSALRKV + RL  
Sbjct: 1   MPTINQLVRKGRTPKVKKT-KAPALNGSPMRRGVCTRVYTTTPKKPNSALRKVARVRLNG 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVKNRKQARSRYGA
Sbjct: 60  GVEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQGVKNRKQARSRYGA 119

Query: 121 ERPK 124
           +  K
Sbjct: 120 KMEK 123


>gi|51209918|ref|YP_063582.1| ribosomal protein S12 [Gracilaria tenuistipitata var. liui]
 gi|68053121|sp|Q6B8X8|RR12_GRATL RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|50657672|gb|AAT79657.1| 30S ribosomal protein S12 [Gracilaria tenuistipitata var. liui]
          Length = 124

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+R  R  S +   K  AL+G PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRSERHKSSKK-TKSPALKGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHN+QEHSVV++ GGRVKDLPGV+Y ++RG+LDA GVK+RK++RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNIQEHSVVLIRGGRVKDLPGVRYHIVRGILDASGVKDRKKSRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KQPK 123


>gi|50955574|ref|YP_062862.1| 30S ribosomal protein S12 [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|60390806|sp|Q6ACY7|RS12_LEIXX RecName: Full=30S ribosomal protein S12
 gi|50952056|gb|AAT89757.1| 30S ribosomal protein S12 [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 124

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R        K  AL+ NPQ+RGVC RVYT TPKKPNSALRKV + +L++
Sbjct: 1   MPTIQQLVRKGRTPKV-TKTKAPALKANPQQRGVCTRVYTTTPKKPNSALRKVARVKLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD Q VKNRKQARSRYGA
Sbjct: 60  GTEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGALDTQAVKNRKQARSRYGA 119

Query: 121 ERPK 124
           +  K
Sbjct: 120 KMEK 123


>gi|300309451|ref|YP_003773543.1| 30s ribosomal protein S12 [Herbaspirillum seropedicae SmR1]
 gi|300072236|gb|ADJ61635.1| 30s ribosomal subunit S12 protein [Herbaspirillum seropedicae SmR1]
          Length = 127

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 99/121 (81%), Gaps = 5/121 (4%)

Query: 1   MPTVNQLIRKPRKGSFRAC--AKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           MPT+NQLI KPR    RA   +K  AL  +PQKRGVC RVYT TPKKPNSALRKV K RL
Sbjct: 1   MPTINQLISKPR---VRAIVKSKSPALENSPQKRGVCTRVYTTTPKKPNSALRKVAKVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           T+G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+Y
Sbjct: 58  TNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGALDTQGVKDRKQARSKY 117

Query: 119 G 119
           G
Sbjct: 118 G 118


>gi|119025548|ref|YP_909393.1| 30S ribosomal protein S12 [Bifidobacterium adolescentis ATCC 15703]
 gi|154487003|ref|ZP_02028410.1| hypothetical protein BIFADO_00841 [Bifidobacterium adolescentis
           L2-32]
 gi|171740954|ref|ZP_02916761.1| hypothetical protein BIFDEN_00015 [Bifidobacterium dentium ATCC
           27678]
 gi|225350771|ref|ZP_03741794.1| hypothetical protein BIFPSEUDO_02340 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|306823320|ref|ZP_07456695.1| 30S ribosomal protein S12 [Bifidobacterium dentium ATCC 27679]
 gi|309802572|ref|ZP_07696676.1| ribosomal protein S12 [Bifidobacterium dentium JCVIHMP022]
 gi|158512522|sp|A1A0S8|RS12_BIFAA RecName: Full=30S ribosomal protein S12
 gi|118765132|dbj|BAF39311.1| 30S ribosomal protein S12 [Bifidobacterium adolescentis ATCC 15703]
 gi|154084866|gb|EDN83911.1| hypothetical protein BIFADO_00841 [Bifidobacterium adolescentis
           L2-32]
 gi|171276568|gb|EDT44229.1| hypothetical protein BIFDEN_00015 [Bifidobacterium dentium ATCC
           27678]
 gi|225158227|gb|EEG71469.1| hypothetical protein BIFPSEUDO_02340 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|304553027|gb|EFM40939.1| 30S ribosomal protein S12 [Bifidobacterium dentium ATCC 27679]
 gi|308220636|gb|EFO76944.1| ribosomal protein S12 [Bifidobacterium dentium JCVIHMP022]
          Length = 123

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+   +  +K  AL+G+P +RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIEQLVRKGRQAKPKK-SKTLALKGSPLRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ RS YGA
Sbjct: 60  GVEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVKDRKQGRSLYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|220905333|ref|YP_002480645.1| ribosomal protein S12 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254811082|sp|B8J3F7|RS12_DESDA RecName: Full=30S ribosomal protein S12
 gi|219869632|gb|ACL49967.1| ribosomal protein S12 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 123

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  RK   +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRIERKAVLKR-KKTPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV +R+++RS+YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSVVIIRGGRVKDLPGVRYHIVRGTLDTSGVADRRKSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|197294156|ref|YP_002149714.1| ribosomal protein S12 [Cicer arietinum]
 gi|197089844|gb|ACH41114.1| ribosomal protein S12 [Cicer arietinum]
          Length = 123

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNARQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YGA
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|15618463|ref|NP_224748.1| 30S ribosomal protein S12 [Chlamydophila pneumoniae CWL029]
 gi|15836083|ref|NP_300607.1| 30S ribosomal protein S12 [Chlamydophila pneumoniae J138]
 gi|16752489|ref|NP_444751.1| 30S ribosomal protein S12 [Chlamydophila pneumoniae AR39]
 gi|33241904|ref|NP_876845.1| 30S ribosomal protein S12 [Chlamydophila pneumoniae TW-183]
 gi|7388119|sp|Q9Z800|RS12_CHLPN RecName: Full=30S ribosomal protein S12
 gi|4376843|gb|AAD18692.1| S12 Ribosomal Protein [Chlamydophila pneumoniae CWL029]
 gi|8163384|gb|AAF73639.1| ribosomal protein S12 [Chlamydophila pneumoniae AR39]
 gi|8978923|dbj|BAA98758.1| S12 ribosomal protein [Chlamydophila pneumoniae J138]
 gi|33236414|gb|AAP98502.1| ribosomal protein S12 [Chlamydophila pneumoniae TW-183]
 gi|269303427|gb|ACZ33527.1| ribosomal protein S12 [Chlamydophila pneumoniae LPCoLN]
          Length = 123

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK S  A  K  AL+  PQKRGVCL+V T TPKKPNSALRKV   RL++
Sbjct: 1   MPTINQLIRKRRKSSL-ARKKSPALQKCPQKRGVCLQVKTKTPKKPNSALRKVAWVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVIAY+ GEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD   VKNRKQ+RSRYGA
Sbjct: 60  GQEVIAYIGGEGHNLQEHSIVLIQGGRVKDLPGVRYHIVRGTLDCAAVKNRKQSRSRYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|15606128|ref|NP_213505.1| 30S ribosomal protein S12 [Aquifex aeolicus VF5]
 gi|15606877|ref|NP_214257.1| 30S ribosomal protein S12 [Aquifex aeolicus VF5]
 gi|6226057|sp|O70089|RS12_AQUAE RecName: Full=30S ribosomal protein S12
 gi|2983320|gb|AAC06910.1| ribosomal protein S12 [Aquifex aeolicus VF5]
 gi|2984118|gb|AAC07655.1| ribosomal protein S12 [Aquifex aeolicus VF5]
          Length = 128

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT NQL++  R+   +  +K  AL+G PQKRGVC+RVYTVTPKKPNSALRKV + RL++
Sbjct: 1   MPTFNQLVKYGRE-KRKKKSKAPALQGCPQKRGVCVRVYTVTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y++IRG LDA GV+ R+Q+RS+YG 
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAAGVEGRRQSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|117924150|ref|YP_864767.1| 30S ribosomal protein S12 [Magnetococcus sp. MC-1]
 gi|158512331|sp|A0L5W8|RS12_MAGSM RecName: Full=30S ribosomal protein S12
 gi|117607906|gb|ABK43361.1| SSU ribosomal protein S12P [Magnetococcus sp. MC-1]
          Length = 123

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQL+R  RK   +    V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTVNQLVRLGRKPQKKK-TNVPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ RS+YGA
Sbjct: 60  GHEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGSLDTQGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|313892662|ref|ZP_07826248.1| ribosomal protein S12 [Dialister microaerophilus UPII 345-E]
 gi|313118922|gb|EFR42128.1| ribosomal protein S12 [Dialister microaerophilus UPII 345-E]
          Length = 124

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+      AK  AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRE-VLSTKAKTPALKQSPQKRGVCTRVYTATPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV  R+Q RS+YGA
Sbjct: 60  GIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTVGVAGRQQGRSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KREK 123


>gi|309387062|gb|ADO67783.1| Tpa8 [Nocardiopsis sp. TFS65-07]
          Length = 123

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+    A  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + +L+S
Sbjct: 1   MPTIQQLVRKGRQDKV-AKNKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+YR++RG LD QGV+ RKQARS YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSIVLVRGGRVKDLPGVRYRIVRGSLDTQGVRGRKQARSHYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|312795769|ref|YP_004028691.1| SSU ribosomal protein S12P [Burkholderia rhizoxinica HKI 454]
 gi|312167544|emb|CBW74547.1| SSU ribosomal protein S12P [Burkholderia rhizoxinica HKI 454]
          Length = 196

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R  S    +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 71  MPTINQLVRKGRT-SEHVKSKSPALQDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 129

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 130 GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGA 189

Query: 121 ERPK 124
           +R K
Sbjct: 190 KRAK 193


>gi|308233486|ref|ZP_07664223.1| SSU ribosomal protein S12P [Atopobium vaginae DSM 15829]
 gi|328943551|ref|ZP_08241016.1| 30S ribosomal protein S12 [Atopobium vaginae DSM 15829]
 gi|327491520|gb|EGF23294.1| 30S ribosomal protein S12 [Atopobium vaginae DSM 15829]
          Length = 124

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R  S +A +K  AL+ NPQKRGVC RV+T TPKKPNSALRKV + RL +
Sbjct: 1   MPTINQLVRQGRV-SQKAKSKNAALQHNPQKRGVCTRVFTTTPKKPNSALRKVARVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y+++RG  D   V++RK+ARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLIRGGRVRDLPGVRYKIVRGAYDCAAVQDRKKARSRYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|218779766|ref|YP_002431084.1| 30S ribosomal protein S12 [Desulfatibacillum alkenivorans AK-01]
 gi|226708487|sp|B8FET9|RS12_DESAA RecName: Full=30S ribosomal protein S12
 gi|218761150|gb|ACL03616.1| ribosomal protein S12 [Desulfatibacillum alkenivorans AK-01]
          Length = 123

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  RK S +      AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRHGRKRSVKKT-NTPALKASPQKRGVCTRVYTTTPKKPNSALRKVARVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GV++RKQ RS YGA
Sbjct: 60  GMEVTAYIPGVGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDSIGVQDRKQGRSHYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|17231832|ref|NP_488380.1| 30S ribosomal protein S12 [Nostoc sp. PCC 7120]
 gi|75907513|ref|YP_321809.1| 30S ribosomal protein S12 [Anabaena variabilis ATCC 29413]
 gi|119510865|ref|ZP_01629989.1| 30S ribosomal protein S12 [Nodularia spumigena CCY9414]
 gi|20140061|sp|Q8YP60|RS12_ANASP RecName: Full=30S ribosomal protein S12
 gi|115305653|sp|Q3MDM2|RS12_ANAVT RecName: Full=30S ribosomal protein S12
 gi|17133476|dbj|BAB76039.1| 30S ribosomal protein S12 [Nostoc sp. PCC 7120]
 gi|75701238|gb|ABA20914.1| SSU ribosomal protein S12P [Anabaena variabilis ATCC 29413]
 gi|119464474|gb|EAW45387.1| 30S ribosomal protein S12 [Nodularia spumigena CCY9414]
          Length = 127

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ + R   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRTEREKA-RQKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+RKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|320451305|ref|YP_004203401.1| 30S ribosomal protein S12 [Thermus scotoductus SA-01]
 gi|320151474|gb|ADW22852.1| 30S ribosomal protein S12 [Thermus scotoductus SA-01]
          Length = 136

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+NQL+RK R+   +  +KV AL+G+P +RGVC  V TVTPKKPNSALRKV K RLTS
Sbjct: 3   LPTINQLVRKGRE-KVQKKSKVPALKGSPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTS 61

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGV D QGVK+RK++RS+YG 
Sbjct: 62  GYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDTQGVKDRKKSRSKYGT 121

Query: 121 ERPK 124
           ++PK
Sbjct: 122 KKPK 125


>gi|260893377|ref|YP_003239474.1| ribosomal protein S12 [Ammonifex degensii KC4]
 gi|260865518|gb|ACX52624.1| ribosomal protein S12 [Ammonifex degensii KC4]
          Length = 124

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  R+ + R+ +   ALRG PQKRGVC+RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRYGRE-AVRSKSSAPALRGCPQKRGVCVRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDA GV++R++ RS+YG 
Sbjct: 60  GMEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGALDAAGVQDRRRGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|300022536|ref|YP_003755147.1| ribosomal protein S12 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524357|gb|ADJ22826.1| ribosomal protein S12 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 123

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 87/125 (69%), Positives = 100/125 (80%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPR-KGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT+ QLIRKPR K  +R   K   +   PQKRGVC RVYT TPKKPNSALRKV K RLT
Sbjct: 1   MPTIQQLIRKPRVKPVYRE--KSRHMEACPQKRGVCTRVYTTTPKKPNSALRKVAKIRLT 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G EVI Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QGV  R+Q RS+YG
Sbjct: 59  NGFEVIGYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVLDTQGVAARRQRRSKYG 118

Query: 120 AERPK 124
           A+RPK
Sbjct: 119 AKRPK 123


>gi|37912995|gb|AAR05324.1| ribosomal protein S12 [uncultured marine alpha proteobacterium
           HOT2C01]
          Length = 123

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QLIRKPR    +   KV AL+ NPQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLIRKPRT-KVQKRNKVPALKANPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RGVLD QGV  RKQ RS YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGVLDTQGVGERKQRRSLYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|23465669|ref|NP_696272.1| 30S ribosomal protein S12 [Bifidobacterium longum NCC2705]
 gi|46190804|ref|ZP_00120941.2| COG0048: Ribosomal protein S12 [Bifidobacterium longum DJO10A]
 gi|227546271|ref|ZP_03976320.1| 30S ribosomal protein S12 [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239622271|ref|ZP_04665302.1| 30S ribosomal protein S12 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|283783545|ref|YP_003374299.1| ribosomal protein S12 [Gardnerella vaginalis 409-05]
 gi|291456314|ref|ZP_06595704.1| ribosomal protein S12 [Bifidobacterium breve DSM 20213]
 gi|296453754|ref|YP_003660897.1| 30S ribosomal protein S12 [Bifidobacterium longum subsp. longum
           JDM301]
 gi|310287775|ref|YP_003939033.1| rpsL SSU ribosomal protein S12P [Bifidobacterium bifidum S17]
 gi|311064661|ref|YP_003971386.1| 30S ribosomal protein S12P RpsL [Bifidobacterium bifidum PRL2010]
 gi|311114361|ref|YP_003985582.1| 30S ribosomal protein S12 [Gardnerella vaginalis ATCC 14019]
 gi|313140576|ref|ZP_07802769.1| 30S ribosomal protein S12 [Bifidobacterium bifidum NCIMB 41171]
 gi|317481780|ref|ZP_07940808.1| ribosomal protein S12 [Bifidobacterium sp. 12_1_47BFAA]
 gi|322688718|ref|YP_004208452.1| 30S ribosomal protein S12 [Bifidobacterium longum subsp. infantis
           157F]
 gi|322690703|ref|YP_004220273.1| 30S ribosomal protein S12 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|27151669|sp|P59162|RS12_BIFLO RecName: Full=30S ribosomal protein S12
 gi|23326345|gb|AAN24908.1| ribosomal protein S12 [Bifidobacterium longum NCC2705]
 gi|227213252|gb|EEI81124.1| 30S ribosomal protein S12 [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239514268|gb|EEQ54135.1| 30S ribosomal protein S12 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|283441332|gb|ADB13798.1| ribosomal protein S12 [Gardnerella vaginalis 409-05]
 gi|291045146|dbj|BAI82360.1| ribosomal protein S12 [Bifidobacterium bifidum]
 gi|291381591|gb|EFE89109.1| ribosomal protein S12 [Bifidobacterium breve DSM 20213]
 gi|296183185|gb|ADH00067.1| ribosomal protein S12 [Bifidobacterium longum subsp. longum JDM301]
 gi|309251711|gb|ADO53459.1| rpsL SSU ribosomal protein S12P [Bifidobacterium bifidum S17]
 gi|310866980|gb|ADP36349.1| RpsL SSU ribosomal protein S12P [Bifidobacterium bifidum PRL2010]
 gi|310945855|gb|ADP38559.1| 30S ribosomal protein S12 [Gardnerella vaginalis ATCC 14019]
 gi|313133086|gb|EFR50703.1| 30S ribosomal protein S12 [Bifidobacterium bifidum NCIMB 41171]
 gi|316916717|gb|EFV38111.1| ribosomal protein S12 [Bifidobacterium sp. 12_1_47BFAA]
 gi|320455559|dbj|BAJ66181.1| 30S ribosomal protein S12 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|320460054|dbj|BAJ70674.1| 30S ribosomal protein S12 [Bifidobacterium longum subsp. infantis
           157F]
          Length = 123

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+   +  +K  AL+G+P +RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIEQLVRKGRQAKPKK-SKTLALKGSPLRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ RS YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVKDRKQGRSLYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|77918310|ref|YP_356125.1| 30S ribosomal protein S12 [Pelobacter carbinolicus DSM 2380]
 gi|90111789|sp|Q3A6Q2|RS12_PELCD RecName: Full=30S ribosomal protein S12
 gi|77544393|gb|ABA87955.1| SSU ribosomal protein S12P [Pelobacter carbinolicus DSM 2380]
          Length = 123

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R+   R  +   AL+ NPQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKGREKKVRK-STAPALKCNPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+ V +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GVK+RKQ RS+YGA
Sbjct: 60  GIVVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDLAGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|253807611|gb|ACT36189.1| ribosomal protein S12 [Helicosporidium sp. ex Simulium jonesi]
          Length = 134

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 89/133 (66%), Positives = 104/133 (78%), Gaps = 9/133 (6%)

Query: 1   MPTVNQLIRK------PRKGSFRACAKVT---ALRGNPQKRGVCLRVYTVTPKKPNSALR 51
           MPT+NQL++K      P K + R   K +   AL+G PQKRGVC RVYT TPKKPNSALR
Sbjct: 1   MPTINQLLKKARIISSPSKNNMRPNLKKSKKPALKGCPQKRGVCFRVYTRTPKKPNSALR 60

Query: 52  KVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNR 111
           KV K RL++G+ VIAY+PGEGHNLQEHSVV + GGRVKDLPGVKY+V+RGVLDAQGV NR
Sbjct: 61  KVAKIRLSNGLIVIAYIPGEGHNLQEHSVVCIRGGRVKDLPGVKYKVVRGVLDAQGVSNR 120

Query: 112 KQARSRYGAERPK 124
           KQ+RS+YG    K
Sbjct: 121 KQSRSKYGVANDK 133


>gi|89902560|ref|YP_525031.1| 30S ribosomal protein S12 [Rhodoferax ferrireducens T118]
 gi|119366796|sp|Q21RV3|RS12_RHOFD RecName: Full=30S ribosomal protein S12
 gi|89347297|gb|ABD71500.1| SSU ribosomal protein S12P [Rhodoferax ferrireducens T118]
 gi|260219748|emb|CBA26592.1| 30S ribosomal protein S12 [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 125

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R+      +K  A++ +PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRQGREVET-IKSKSPAMQNSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|310779601|ref|YP_003967934.1| SSU ribosomal protein S12P [Ilyobacter polytropus DSM 2926]
 gi|309748924|gb|ADO83586.1| SSU ribosomal protein S12P [Ilyobacter polytropus DSM 2926]
          Length = 122

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 79/122 (64%), Positives = 100/122 (81%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL++K R  +     K  AL GNPQ+RGVC+RVYT TPKKPNSALRKV + +LT+
Sbjct: 1   MPTLNQLVKKGR-ATLEEAKKSPALHGNPQRRGVCIRVYTSTPKKPNSALRKVARVKLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PGEGHNLQEHS+V++ GGR KDLPGV+Y+VIRG LD  GV NRK++RS+YGA
Sbjct: 60  GIEVTTYIPGEGHNLQEHSIVLVRGGRTKDLPGVRYKVIRGALDTAGVANRKKSRSKYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|297181145|gb|ADI17342.1| hypothetical protein [uncultured Oceanospirillales bacterium
           HF0070_21F08]
          Length = 124

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+R PRK        V AL+G PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRNPRKRKVEKSDSV-ALQGCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV++RKQ RS+YGA
Sbjct: 60  GYEVSSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTAGVQDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|225018159|ref|ZP_03707351.1| hypothetical protein CLOSTMETH_02096 [Clostridium methylpentosum
           DSM 5476]
 gi|224949156|gb|EEG30365.1| hypothetical protein CLOSTMETH_02096 [Clostridium methylpentosum
           DSM 5476]
          Length = 139

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (75%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGS------------FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK RK              F +  KV+  + +PQKRGVC  V T+TPKKPNS
Sbjct: 1   MPTFNQLVRKGRKEKESKSNAPALGKRFNSMKKVSTDQSSPQKRGVCTAVRTMTPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRKV + RL++G+EV +Y+PGEGHNLQEHSVV++ GGR+KDLPG +Y +IRG LD+QGV
Sbjct: 61  ALRKVARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRIKDLPGTRYHIIRGTLDSQGV 120

Query: 109 KNRKQARSRYGAERPK 124
            +RKQARS+YGA+RPK
Sbjct: 121 ADRKQARSKYGAKRPK 136


>gi|186684012|ref|YP_001867208.1| 30S ribosomal protein S12 [Nostoc punctiforme PCC 73102]
 gi|226712624|sp|B2J5A8|RS12_NOSP7 RecName: Full=30S ribosomal protein S12
 gi|186466464|gb|ACC82265.1| ribosomal protein S12/S23 [Nostoc punctiforme PCC 73102]
          Length = 127

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ + R   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRNEREQA-RQKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+RKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|163840915|ref|YP_001625320.1| 30S ribosomal protein S12 [Renibacterium salmoninarum ATCC 33209]
 gi|189040474|sp|A9WSW8|RS12_RENSM RecName: Full=30S ribosomal protein S12
 gi|162954391|gb|ABY23906.1| SSU ribosomal protein S12P [Renibacterium salmoninarum ATCC 33209]
          Length = 124

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R     A  K  AL+ NP +RGVC RVYT TPKKPNSALRKV + RL  
Sbjct: 1   MPTINQLVRKGRSPKV-AKTKAPALKNNPMRRGVCTRVYTTTPKKPNSALRKVARVRLAG 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVKNRKQARS+YGA
Sbjct: 60  GIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGSLDTQGVKNRKQARSKYGA 119

Query: 121 ERPK 124
           +  K
Sbjct: 120 KMEK 123


>gi|218294749|ref|ZP_03495603.1| ribosomal protein S12 [Thermus aquaticus Y51MC23]
 gi|218244657|gb|EED11181.1| ribosomal protein S12 [Thermus aquaticus Y51MC23]
          Length = 137

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+NQL+R+ R+   +  +KV AL+G+P +RGVC  V TVTPKKPNSALRKV K RLTS
Sbjct: 4   LPTINQLVRRGRE-KVQKKSKVPALKGSPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTS 62

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGV DAQGVK+RK++RS+YG 
Sbjct: 63  GYEVTAYIPGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGVYDAQGVKDRKKSRSKYGT 122

Query: 121 ERPK 124
           ++PK
Sbjct: 123 KKPK 126


>gi|166367020|ref|YP_001659293.1| 30S ribosomal protein S12 [Microcystis aeruginosa NIES-843]
 gi|189040467|sp|B0JSE3|RS12_MICAN RecName: Full=30S ribosomal protein S12
 gi|159029231|emb|CAO87591.1| rpsL [Microcystis aeruginosa PCC 7806]
 gi|166089393|dbj|BAG04101.1| 30S ribosomal protein S12 [Microcystis aeruginosa NIES-843]
          Length = 127

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R  + R   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRDERSKAKRK-TKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDA GVKNR++ARS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDATGVKNRQKARSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|59802166|ref|YP_208878.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae FA 1090]
 gi|240113969|ref|ZP_04728459.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae MS11]
 gi|240116705|ref|ZP_04730767.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae PID18]
 gi|240118927|ref|ZP_04732989.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae PID1]
 gi|254494727|ref|ZP_05107898.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae 1291]
 gi|268600033|ref|ZP_06134200.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae MS11]
 gi|268602374|ref|ZP_06136541.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae PID18]
 gi|268604637|ref|ZP_06138804.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae PID1]
 gi|75355448|sp|Q5F5S1|RS12_NEIG1 RecName: Full=30S ribosomal protein S12
 gi|59719061|gb|AAW90466.1| putative 30S ribosomal protein S12 [Neisseria gonorrhoeae FA 1090]
 gi|226513767|gb|EEH63112.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae 1291]
 gi|268584164|gb|EEZ48840.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae MS11]
 gi|268586505|gb|EEZ51181.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae PID18]
 gi|268588768|gb|EEZ53444.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae PID1]
          Length = 123

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+       KV AL   PQKRGVC RVYT TP+KPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKGRQKPV-YVNKVPALEACPQKRGVCTRVYTTTPRKPNSALRKVCKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|269122586|ref|YP_003310763.1| ribosomal protein S12 [Sebaldella termitidis ATCC 33386]
 gi|268616464|gb|ACZ10832.1| ribosomal protein S12 [Sebaldella termitidis ATCC 33386]
          Length = 124

 Score =  170 bits (431), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  R  S +   K  AL+GNPQKRGVC+RVYT TPKKPNSALRKV + +L +
Sbjct: 1   MPTINQLVRHGRSTSEKK-KKSPALKGNPQKRGVCVRVYTTTPKKPNSALRKVARVKLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGR KDLPGV+Y++IRG LD  GV NRKQARSRYG 
Sbjct: 60  GIEVTAYIPGIGHNLQEHSIVLIRGGRTKDLPGVRYKIIRGALDTAGVVNRKQARSRYGT 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKDK 123


>gi|83591281|ref|YP_431290.1| 30S ribosomal protein S12 [Moorella thermoacetica ATCC 39073]
 gi|115305661|sp|Q2RFP2|RS12_MOOTA RecName: Full=30S ribosomal protein S12
 gi|83574195|gb|ABC20747.1| SSU ribosomal protein S12P [Moorella thermoacetica ATCC 39073]
          Length = 124

 Score =  170 bits (430), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+R+ R+   R      AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTIQQLVRQAREKVVRKST-APALKESPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GV+NR Q RS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAAGVQNRNQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|126658890|ref|ZP_01730033.1| 30S ribosomal protein S12 [Cyanothece sp. CCY0110]
 gi|172039004|ref|YP_001805505.1| 30S ribosomal protein S12 [Cyanothece sp. ATCC 51142]
 gi|254811080|sp|B1WQY7|RS12_CYAA5 RecName: Full=30S ribosomal protein S12
 gi|126619840|gb|EAZ90566.1| 30S ribosomal protein S12 [Cyanothece sp. CCY0110]
 gi|171700458|gb|ACB53439.1| 30S ribosomal protein S12 [Cyanothece sp. ATCC 51142]
          Length = 124

 Score =  170 bits (430), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R  + +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSERSKAKKK-TKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDAQGVK+RKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAQGVKDRKQGRSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|303326475|ref|ZP_07356918.1| ribosomal protein S12 [Desulfovibrio sp. 3_1_syn3]
 gi|302864391|gb|EFL87322.1| ribosomal protein S12 [Desulfovibrio sp. 3_1_syn3]
          Length = 123

 Score =  170 bits (430), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  RK   +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRIERKAVVKR-KKTPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV +R+++RS+YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSVVIIRGGRVKDLPGVRYHIVRGTLDTSGVADRRKSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|11467215|ref|NP_043003.1| ribosomal protein S12 [Zea mays]
 gi|48478793|ref|YP_024351.1| ribosomal protein S12 [Saccharum hybrid cultivar SP-80-3280]
 gi|50812551|ref|YP_054608.1| ribosomal protein S12 [Saccharum officinarum]
 gi|50812583|ref|YP_054607.1| ribosomal protein S12 [Saccharum officinarum]
 gi|118614537|ref|YP_899385.1| ribosomal protein S12 [Sorghum bicolor]
 gi|1173189|sp|P12340|RR12_MAIZE RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|68053148|sp|Q6ENU0|RR12_SACOF RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|75324216|sp|Q6L3C7|RR12_SACHY RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|125987676|sp|A1E9Q2|RR12_SORBI RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|342619|gb|AAA85359.1| ribosomal protein S12 [Zea mays]
 gi|1216141|emb|CAA60309.1| ribosomal protein S12 [Zea mays]
 gi|48478695|gb|AAT44715.1| ribosomal protein S12 [Saccharum hybrid cultivar SP80-3280]
 gi|49659535|dbj|BAD27316.1| ribosomal protein S12 [Saccharum hybrid cultivar NCo 310]
 gi|49659567|dbj|BAD27348.1| ribosomal protein S12 [Saccharum hybrid cultivar NCo 310]
 gi|118201171|gb|ABK79541.1| ribosomal protein S12 [Sorghum bicolor]
          Length = 124

 Score =  170 bits (430), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTV QLIR  R+   R   K  AL+G PQ+RG C RVYT+ PKKPNSALRKV + RLTS
Sbjct: 1   MPTVKQLIRNARQ-PIRNARKSAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+YR+IRG LDA  VKNR+Q RS+YGA
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDAVAVKNRQQGRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|110225657|ref|YP_665663.1| ribosomal protein S12 [Nephroselmis olivacea]
 gi|6066172|gb|AAF03190.1|AF110138_22 ribosomal protein S12 [Nephroselmis olivacea]
          Length = 124

 Score =  170 bits (430), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQ++R PR    R   +  AL+G PQK+GVCLRVYT  PKKPNSALRK+ K RLT+
Sbjct: 1   MPTMNQILRTPRLPKQR-INRAKALQGCPQKQGVCLRVYTTKPKKPNSALRKIAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVIAY+PGEGH+LQEHSVV+L GGRVKDLPGVKY +IRGVLD QGV NRKQ RS+YG 
Sbjct: 60  RSEVIAYIPGEGHHLQEHSVVLLRGGRVKDLPGVKYHIIRGVLDLQGVANRKQGRSKYGT 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|91214186|ref|YP_538789.1| ribosomal protein S12 [Glycine max]
 gi|91214200|ref|YP_538788.1| ribosomal protein S12 [Glycine max]
 gi|88984804|sp|P07134|RR12_SOYBN RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|83595787|gb|ABC25168.1| ribosomal protein S12 [Glycine max]
 gi|83595801|gb|ABC25182.1| ribosomal protein S12 [Glycine max]
          Length = 123

 Score =  170 bits (430), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTMKQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YGA
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|56750662|ref|YP_171363.1| 30S ribosomal protein S12 [Synechococcus elongatus PCC 6301]
 gi|81299696|ref|YP_399904.1| 30S ribosomal protein S12 [Synechococcus elongatus PCC 7942]
 gi|52783788|sp|P63199|RS12_SYNP6 RecName: Full=30S ribosomal protein S12
 gi|52783789|sp|P63200|RS12_SYNE7 RecName: Full=30S ribosomal protein S12
 gi|79685|pir||S04427 ribosomal protein S12 - Synechococcus sp. (PCC 6301)
 gi|1405430|emb|CAA35493.1| rps12 [Synechococcus elongatus PCC 6301]
 gi|56685621|dbj|BAD78843.1| 30S ribosomal protein S12 [Synechococcus elongatus PCC 6301]
 gi|81168577|gb|ABB56917.1| SSU ribosomal protein S12P [Synechococcus elongatus PCC 7942]
          Length = 124

 Score =  170 bits (430), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRDEREKITKK-TKSPALKNCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|301631545|ref|XP_002944858.1| PREDICTED: 30S ribosomal protein S12-like [Xenopus (Silurana)
           tropicalis]
          Length = 125

 Score =  170 bits (430), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  R+      +K  A+   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRHGREVET-IKSKSPAMENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|298531090|ref|ZP_07018491.1| ribosomal protein S12 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509113|gb|EFI33018.1| ribosomal protein S12 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 123

 Score =  170 bits (430), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R    +   K  AL+  PQKRGVC+RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRRSRDQVVKR-KKRAALQECPQKRGVCVRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GV++R+++RS+YG 
Sbjct: 60  GIEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYSIIRGTLDTSGVRDRRKSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|256420650|ref|YP_003121303.1| ribosomal protein S12 [Chitinophaga pinensis DSM 2588]
 gi|256035558|gb|ACU59102.1| ribosomal protein S12 [Chitinophaga pinensis DSM 2588]
          Length = 126

 Score =  170 bits (430), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+   RA +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTIQQLVRKGRE-IIRAKSKSRALDSCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEVIAY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD  GVK+RKQ+RS+YG 
Sbjct: 60  KVEVIAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTAGVKDRKQSRSKYGT 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|298490073|ref|YP_003720250.1| 30S ribosomal protein S12 ['Nostoc azollae' 0708]
 gi|298231991|gb|ADI63127.1| ribosomal protein S12 ['Nostoc azollae' 0708]
          Length = 127

 Score =  170 bits (430), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ + R   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSERELA-RQKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+RKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|282898979|ref|ZP_06306961.1| Ribosomal protein S12 [Cylindrospermopsis raciborskii CS-505]
 gi|281196119|gb|EFA71034.1| Ribosomal protein S12 [Cylindrospermopsis raciborskii CS-505]
          Length = 127

 Score =  170 bits (430), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ + R   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSERELA-RQKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+RKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|114330569|ref|YP_746791.1| 30S ribosomal protein S12 [Nitrosomonas eutropha C91]
 gi|122314437|sp|Q0AIK0|RS12_NITEC RecName: Full=30S ribosomal protein S12
 gi|114307583|gb|ABI58826.1| SSU ribosomal protein S12P [Nitrosomonas eutropha C91]
          Length = 125

 Score =  170 bits (430), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RKPRK   +  +KV AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLVRKPRKAK-QVKSKVPALESCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRV+DLPGV+Y  +RG LD  GVK+RK+ARS+YG+
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVRDLPGVRYHTVRGSLDTAGVKDRKKARSKYGS 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|254422472|ref|ZP_05036190.1| ribosomal protein S12 [Synechococcus sp. PCC 7335]
 gi|196189961|gb|EDX84925.1| ribosomal protein S12 [Synechococcus sp. PCC 7335]
          Length = 124

 Score =  170 bits (430), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R  + +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRTERSKATKK-TKSPALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|330814203|ref|YP_004358442.1| SSU ribosomal protein S12p (S23e) [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487298|gb|AEA81703.1| SSU ribosomal protein S12p (S23e) [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 123

 Score =  170 bits (430), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL++K RK    A  KV AL   P KRGVC RVYT TPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLLKKKRK-KIVARNKVPALDACPLKRGVCTRVYTTTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y  +RG+LD QGV NRKQ RS+YG 
Sbjct: 60  GSEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHTVRGLLDTQGVANRKQRRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|11466995|ref|NP_041902.1| ribosomal protein S12 [Euglena gracilis]
 gi|133738|sp|P02368|RR12_EUGGR RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|11534|emb|CAA29597.1| ribosomal protein S12 [Euglena gracilis]
 gi|12564|emb|CAA25157.1| unnamed protein product [Euglena gracilis]
 gi|14356|emb|CAA77906.1| ribosomal protein S12 [Euglena gracilis]
 gi|415745|emb|CAA50089.1| 30S ribosomal protein S12 [Euglena gracilis]
          Length = 125

 Score =  170 bits (430), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+  L R PRK   R   K  AL+G PQKR +C+RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTLEHLTRSPRKKIKRK-TKSPALKGCPQKRAICMRVYTTTPKKPNSALRKVTRVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGVKY VIRG LDA  VKNRK ARS+YG 
Sbjct: 60  GLEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVKYHVIRGCLDAASVKNRKNARSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|312880377|ref|ZP_07740177.1| SSU ribosomal protein S12P [Aminomonas paucivorans DSM 12260]
 gi|310783668|gb|EFQ24066.1| SSU ribosomal protein S12P [Aminomonas paucivorans DSM 12260]
          Length = 127

 Score =  170 bits (430), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++Q+IR  R+   R  +   AL+ NPQ+RGVC RVYTVTPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQMIRHGREEKRRRSS-APALQENPQRRGVCTRVYTVTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV+ R+Q+RS+YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDCGGVEKRRQSRSKYGA 119

Query: 121 ERPK 124
            RPK
Sbjct: 120 RRPK 123


>gi|319761133|ref|YP_004125070.1| ribosomal protein s12 [Alicycliphilus denitrificans BC]
 gi|330822991|ref|YP_004386294.1| 30S ribosomal protein S12 [Alicycliphilus denitrificans K601]
 gi|317115694|gb|ADU98182.1| ribosomal protein S12 [Alicycliphilus denitrificans BC]
 gi|329308363|gb|AEB82778.1| ribosomal protein S12 [Alicycliphilus denitrificans K601]
          Length = 125

 Score =  169 bits (429), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R       +K  A+   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRQGRTVEV-VKSKSPAMENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|160902261|ref|YP_001567842.1| 30S ribosomal protein S12 [Petrotoga mobilis SJ95]
 gi|189040470|sp|A9BHB0|RS12_PETMO RecName: Full=30S ribosomal protein S12
 gi|160359905|gb|ABX31519.1| ribosomal protein S12 [Petrotoga mobilis SJ95]
          Length = 124

 Score =  169 bits (429), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  R  S +   K  ALRGNPQKRGVC+RV T+TPKKPNSALRK+ + +L++
Sbjct: 1   MPTINQLIRYGRT-SVKKKTKSPALRGNPQKRGVCVRVSTMTPKKPNSALRKIARVKLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PGEGHNLQEHS V++ GGRVKDLPGV+Y++IRG LDA GV+ RKQ RS+YG 
Sbjct: 60  GIEVTCYIPGEGHNLQEHSNVLVRGGRVKDLPGVRYKIIRGTLDAAGVEGRKQGRSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|239618270|ref|YP_002941592.1| ribosomal protein S12 [Kosmotoga olearia TBF 19.5.1]
 gi|259494655|sp|C5CGR9|RS12_KOSOT RecName: Full=30S ribosomal protein S12
 gi|239507101|gb|ACR80588.1| ribosomal protein S12 [Kosmotoga olearia TBF 19.5.1]
          Length = 124

 Score =  169 bits (429), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  RK   +  +K  AL  NPQKRGVC+RV T+TPKKPNSALRK+ + RL++
Sbjct: 1   MPTINQLIRHGRK-RLKKKSKSPALENNPQKRGVCVRVSTMTPKKPNSALRKIARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA+GV NR+Q+RSRYGA
Sbjct: 60  GTEVTAYIPGEGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDAEGVANRRQSRSRYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|110833241|ref|YP_692100.1| 30S ribosomal protein S12 [Alcanivorax borkumensis SK2]
 gi|119366754|sp|Q0VSM0|RS12_ALCBS RecName: Full=30S ribosomal protein S12
 gi|110646352|emb|CAL15828.1| 30S ribosomal protein S12 [Alcanivorax borkumensis SK2]
          Length = 123

 Score =  169 bits (429), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPRK        V AL+G PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRKSKVEKSDSV-ALQGCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV++RKQ RS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTAGVQDRKQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|67921714|ref|ZP_00515231.1| Ribosomal protein S12, bacterial and chloroplast form [Crocosphaera
           watsonii WH 8501]
 gi|67856306|gb|EAM51548.1| Ribosomal protein S12, bacterial and chloroplast form [Crocosphaera
           watsonii WH 8501]
          Length = 124

 Score =  169 bits (429), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R  + +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSERSKAKKK-TKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDAQGVK+RKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAQGVKDRKQGRSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|11572|emb|CAA28661.1| unnamed protein product [Glycine max]
          Length = 123

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTMKQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YGA
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSQYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|254449118|ref|ZP_05062570.1| ribosomal protein S12 [gamma proteobacterium HTCC5015]
 gi|198261310|gb|EDY85603.1| ribosomal protein S12 [gamma proteobacterium HTCC5015]
          Length = 123

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPRK      + V AL  +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MTTVNQLVRKPRKRKIEK-SNVPALEASPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y V+RG LD QGV +RK+ RS+YG 
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGSLDTQGVADRKKGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|212716884|ref|ZP_03325012.1| hypothetical protein BIFCAT_01828 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660169|gb|EEB20744.1| hypothetical protein BIFCAT_01828 [Bifidobacterium catenulatum DSM
           16992]
          Length = 123

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+   +  +K  AL+G+P +RGVC RVYT TP+KPNSALRKV + RL+S
Sbjct: 1   MPTIEQLVRKGRQAKPKK-SKTLALKGSPLRRGVCTRVYTTTPRKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ RS YGA
Sbjct: 60  GVEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVKDRKQGRSLYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|158334960|ref|YP_001516132.1| 30S ribosomal protein S12 [Acaryochloris marina MBIC11017]
 gi|189040443|sp|B0CCD3|RS12_ACAM1 RecName: Full=30S ribosomal protein S12
 gi|158305201|gb|ABW26818.1| 30S ribosomal protein S12 [Acaryochloris marina MBIC11017]
          Length = 124

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R  + +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSERYNTKKK-TKSPALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+R+Q RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|255326836|ref|ZP_05367912.1| ribosomal protein S12 [Rothia mucilaginosa ATCC 25296]
 gi|283457535|ref|YP_003362118.1| 30S ribosomal protein S12 [Rothia mucilaginosa DY-18]
 gi|255296053|gb|EET75394.1| ribosomal protein S12 [Rothia mucilaginosa ATCC 25296]
 gi|283133533|dbj|BAI64298.1| ribosomal protein S12 [Rothia mucilaginosa DY-18]
          Length = 124

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R        K  AL+GNP KRGVC RVYT TPKKPNSALRKV + +L  
Sbjct: 1   MPTIQQLVRKGRTPKV-VKTKAPALKGNPMKRGVCTRVYTTTPKKPNSALRKVARVKLNG 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK R QARSRYGA
Sbjct: 60  GVEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQGVKGRGQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|194033209|ref|YP_002000509.1| ribosomal protein S12 [Brachypodium distachyon]
 gi|193075617|gb|ACF08700.1| ribosomal protein S12 [Brachypodium distachyon]
          Length = 124

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTV QLIR  R+   R   K  AL+G PQ+RG C RVYT+ PKKPNSALRKV + RLTS
Sbjct: 1   MPTVKQLIRNARQ-PIRTARKTAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+YR+IRG LDA  VKNR+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDAVAVKNRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|73666792|ref|YP_302808.1| 30S ribosomal protein S12 [Ehrlichia canis str. Jake]
 gi|123759468|sp|Q3YSU5|RS12_EHRCJ RecName: Full=30S ribosomal protein S12
 gi|72393933|gb|AAZ68210.1| SSU ribosomal protein S12P [Ehrlichia canis str. Jake]
          Length = 123

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 103/123 (83%), Gaps = 2/123 (1%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPRK S  A  K  AL+ NPQKR VC++VYT TPKKPNSALRKV + ++  
Sbjct: 1   MPTINQLVRKPRK-SRSALNKAPALQHNPQKRAVCVKVYTTTPKKPNSALRKVARVKIAG 59

Query: 61  -GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
            G EVIAY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD++GV+NRK+ARS+YG
Sbjct: 60  YGSEVIAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDSRGVQNRKKARSKYG 119

Query: 120 AER 122
            ++
Sbjct: 120 VKK 122


>gi|302036660|ref|YP_003796982.1| 30S ribosomal protein S12 [Candidatus Nitrospira defluvii]
 gi|300604724|emb|CBK41056.1| 30S ribosomal protein S12 [Candidatus Nitrospira defluvii]
          Length = 123

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R    ++  K  AL+  PQKRGVCLRVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRT-LVKSKTKSPALKRCPQKRGVCLRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PG GHNLQEHS+V++ GGRVKDLPGV+Y ++RG LDA GV +RKQARS+YGA
Sbjct: 60  GMEVTTYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGSLDAVGVADRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|226226265|ref|YP_002760371.1| 30S ribosomal protein S12 [Gemmatimonas aurantiaca T-27]
 gi|259494651|sp|C1A6P1|RS12_GEMAT RecName: Full=30S ribosomal protein S12
 gi|226089456|dbj|BAH37901.1| 30S ribosomal protein S12 [Gemmatimonas aurantiaca T-27]
          Length = 134

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ RK      +K  AL+ NP KRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRRARKDVVEK-SKAPALKSNPFKRGVCTRVYTTTPKKPNSALRKVARIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LDA GV  R Q+RS+YG 
Sbjct: 60  QLEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDASGVNGRNQSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|126666818|ref|ZP_01737795.1| 30S ribosomal protein S12 [Marinobacter sp. ELB17]
 gi|126628863|gb|EAZ99483.1| 30S ribosomal protein S12 [Marinobacter sp. ELB17]
          Length = 124

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+R+PRK    A + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRRPRKRKV-AKSDVPALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD QGV+NRKQ RS+YG 
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTQGVQNRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|302390953|ref|YP_003826773.1| 30S ribosomal protein S12P [Acetohalobium arabaticum DSM 5501]
 gi|302203030|gb|ADL11708.1| SSU ribosomal protein S12P [Acetohalobium arabaticum DSM 5501]
          Length = 122

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 98/123 (79%), Gaps = 1/123 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R    +      AL G PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKGR-NKVKKKQTAPALEGAPQKRGVCTRVYTATPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV++RKQARS+YG 
Sbjct: 60  GKEVTAYIPGEGHNLQEHSVVLVRGGRVKDLPGVRYTIVRGALDTAGVEDRKQARSKYGV 119

Query: 121 ERP 123
           ++P
Sbjct: 120 KKP 122


>gi|37523494|ref|NP_926871.1| 30S ribosomal protein S12 [Gloeobacter violaceus PCC 7421]
 gi|52783385|sp|Q7NEF4|RS12_GLOVI RecName: Full=30S ribosomal protein S12
 gi|35214498|dbj|BAC91866.1| 30S ribosomal protein S12 [Gloeobacter violaceus PCC 7421]
          Length = 135

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR+ R G  +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIAQLIRRER-GIAQRKTKSPALKACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVKNR Q+RS+YG 
Sbjct: 60  GFEVTAYIPGVGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKNRMQSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|114329702|ref|YP_740500.1| ribosomal protein S12 [Citrus sinensis]
 gi|114329716|ref|YP_740499.1| ribosomal protein S12 [Citrus sinensis]
 gi|122166159|sp|Q09MF3|RR12_CITSI RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|113952668|gb|ABI49066.1| ribosomal protein S12 [Citrus sinensis]
 gi|113952682|gb|ABI49080.1| ribosomal protein S12 [Citrus sinensis]
          Length = 123

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR PR+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNPRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|160872811|ref|ZP_02062943.1| ribosomal protein S12 [Rickettsiella grylli]
 gi|159121610|gb|EDP46948.1| ribosomal protein S12 [Rickettsiella grylli]
          Length = 125

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR    R  + V AL   PQKRGVC RVYTVTPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRV-QRRVKSMVPALSSCPQKRGVCTRVYTVTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y V+RG LDA GV  RKQ RS+YGA
Sbjct: 60  GMEVTTYIGGEGHNLQEHSVILMRGGRVKDLPGVRYHVVRGALDASGVSGRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|139389666|ref|YP_001123223.1| ribosomal protein S12 [Arabis hirsuta]
 gi|139389689|ref|YP_001123179.1| ribosomal protein S12 [Arabis hirsuta]
 gi|158513634|sp|A4QK42|RR12_ARAHI RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|134286421|dbj|BAF50047.1| ribosomal protein S1 [Arabis hirsuta]
 gi|134286444|dbj|BAF50070.1| ribosomal protein S12 [Arabis hirsuta]
          Length = 123

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-QIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|213692787|ref|YP_002323373.1| ribosomal protein S12 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|254811069|sp|B7GU49|RS12_BIFLI RecName: Full=30S ribosomal protein S12
 gi|213524248|gb|ACJ52995.1| ribosomal protein S12 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|260654038|dbj|BAI44423.1| ribosomal protein S12 [Bifidobacterium breve]
 gi|320458953|dbj|BAJ69574.1| 30S ribosomal protein S12 [Bifidobacterium longum subsp. infantis
           ATCC 15697]
          Length = 123

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+   +  +K  AL+G+P +RGVC RVYT TP+KPNSALRKV + RL+S
Sbjct: 1   MPTIEQLVRKGRQAKPKK-SKTLALKGSPLRRGVCTRVYTTTPRKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ RS YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVKDRKQGRSLYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|114567846|ref|YP_755000.1| 30S ribosomal protein S12 [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|119366816|sp|Q0AUH5|RS12_SYNWW RecName: Full=30S ribosomal protein S12
 gi|114338781|gb|ABI69629.1| SSU ribosomal protein S12P [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 125

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 101/125 (80%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPR-KGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT+NQL+RK R KG  ++ A   AL+  PQKRGVC RVYT TPKKPNSALRK+ + RLT
Sbjct: 1   MPTINQLVRKGREKGEQKSTA--PALKSCPQKRGVCTRVYTTTPKKPNSALRKIARVRLT 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDA GV+ R Q RS+YG
Sbjct: 59  NGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDASGVQKRNQGRSKYG 118

Query: 120 AERPK 124
            +RPK
Sbjct: 119 TKRPK 123


>gi|300742063|ref|ZP_07072084.1| ribosomal protein S12 [Rothia dentocariosa M567]
 gi|311111981|ref|YP_003983203.1| 30S ribosomal protein S12 [Rothia dentocariosa ATCC 17931]
 gi|300381248|gb|EFJ77810.1| ribosomal protein S12 [Rothia dentocariosa M567]
 gi|310943475|gb|ADP39769.1| 30S ribosomal protein S12 [Rothia dentocariosa ATCC 17931]
          Length = 124

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R        K  AL+GNP KRGVC RVYT TPKKPNSALRKV + +L  
Sbjct: 1   MPTIQQLVRKGRTPKV-VKTKAPALKGNPMKRGVCTRVYTTTPKKPNSALRKVARVKLNG 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK R QARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQGVKGRGQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|284049262|ref|YP_003399601.1| ribosomal protein S12 [Acidaminococcus fermentans DSM 20731]
 gi|283953483|gb|ADB48286.1| ribosomal protein S12 [Acidaminococcus fermentans DSM 20731]
          Length = 127

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+      +   AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRQ-VITQKSTAPALKNSPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV +R Q RS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVADRNQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|260886871|ref|ZP_05898134.1| ribosomal protein S12 [Selenomonas sputigena ATCC 35185]
 gi|330839331|ref|YP_004413911.1| ribosomal protein S12 [Selenomonas sputigena ATCC 35185]
 gi|260863470|gb|EEX77970.1| ribosomal protein S12 [Selenomonas sputigena ATCC 35185]
 gi|329747095|gb|AEC00452.1| ribosomal protein S12 [Selenomonas sputigena ATCC 35185]
          Length = 125

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK S +  +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKSRK-SMQEKSNAPALKNCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV++R QARS+YGA
Sbjct: 60  SIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGSLDTAGVQDRGQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|149390419|ref|YP_001294332.1| ribosomal protein S12 [Dioscorea elephantipes]
 gi|149390420|ref|YP_001294376.1| ribosomal protein S12 [Dioscorea elephantipes]
 gi|156633623|sp|A6MMI7|RR12_DIOEL RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|148668111|gb|ABR01495.1| ribosomal protein S12 [Dioscorea elephantipes]
 gi|148668112|gb|ABR01496.1| ribosomal protein S12 [Dioscorea elephantipes]
          Length = 123

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-KIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|325981800|ref|YP_004294202.1| 30S ribosomal protein S12 [Nitrosomonas sp. AL212]
 gi|325531319|gb|ADZ26040.1| ribosomal protein S12 [Nitrosomonas sp. AL212]
          Length = 125

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RKPR    R  + V AL  +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLVRKPRIAK-RVKSTVPALENSPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YG+
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQGRSKYGS 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|170078668|ref|YP_001735306.1| 30S ribosomal protein S12 [Synechococcus sp. PCC 7002]
 gi|226712662|sp|B1XI66|RS12_SYNP2 RecName: Full=30S ribosomal protein S12
 gi|169886337|gb|ACB00051.1| 30S ribosomal protein S12 [Synechococcus sp. PCC 7002]
          Length = 124

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R    +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSERY-KLKKKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+RKQ RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDATGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|87301863|ref|ZP_01084697.1| 30S ribosomal protein S12 [Synechococcus sp. WH 5701]
 gi|87283431|gb|EAQ75386.1| 30S ribosomal protein S12 [Synechococcus sp. WH 5701]
          Length = 124

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRTERQHLTRK-TKSPALRGCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTSGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KTPK 123


>gi|124112112|ref|YP_001019137.1| ribosomal protein S12 [Chlorokybus atmophyticus]
 gi|158564119|sp|Q19V72|RR12_CHLAT RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|124012221|gb|ABD62244.2| ribosomal protein S12 [Chlorokybus atmophyticus]
          Length = 123

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  RK       K  ALRG PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSQRK-KVEKKTKSPALRGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG+LD  GVK+R Q RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGILDTAGVKDRSQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|329121823|ref|ZP_08250439.1| 30S ribosomal protein S12 [Dialister micraerophilus DSM 19965]
 gi|327468096|gb|EGF13584.1| 30S ribosomal protein S12 [Dialister micraerophilus DSM 19965]
          Length = 127

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+NQL+RK R+      AK  AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 4   LPTINQLVRKGRE-VLSTKAKTPALKQSPQKRGVCTRVYTATPKKPNSALRKVARVRLTN 62

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV  R+Q RS+YGA
Sbjct: 63  GIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTVGVAGRQQGRSKYGA 122

Query: 121 ERPK 124
           +R K
Sbjct: 123 KREK 126


>gi|262277090|ref|ZP_06054883.1| ribosomal protein S12 [alpha proteobacterium HIMB114]
 gi|262224193|gb|EEY74652.1| ribosomal protein S12 [alpha proteobacterium HIMB114]
          Length = 123

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 87/125 (69%), Positives = 101/125 (80%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPR-KGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT+NQL++K R K   R   KV AL+    KRGVC RVYT TPKKPNSALRKV + RL+
Sbjct: 1   MPTINQLLKKKRVKQVIRN--KVPALQACALKRGVCTRVYTTTPKKPNSALRKVARVRLS 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G EV AY+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y V+RG+LD QGV NRKQ RS+YG
Sbjct: 59  NGFEVTAYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHVVRGLLDTQGVANRKQQRSKYG 118

Query: 120 AERPK 124
           A+RPK
Sbjct: 119 AKRPK 123


>gi|148273807|ref|YP_001223368.1| 30S ribosomal protein S12 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|170780727|ref|YP_001709059.1| 30S ribosomal protein S12 [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|166231856|sp|A5CUB9|RS12_CLAM3 RecName: Full=30S ribosomal protein S12
 gi|189040450|sp|B0RB33|RS12_CLAMS RecName: Full=30S ribosomal protein S12
 gi|147831737|emb|CAN02706.1| 30S ribosomal protein S12 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|169155295|emb|CAQ00398.1| 30S ribosomal protein S12 [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 124

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R        K  AL+ NPQ+RGVC RVYT TPKKPNSALRKV + +L++
Sbjct: 1   MPTIQQLVRKGRTPKV-VKTKAPALKANPQQRGVCTRVYTTTPKKPNSALRKVARVKLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD Q VKNRKQARSRYGA
Sbjct: 60  GQEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGALDTQAVKNRKQARSRYGA 119

Query: 121 ERPK 124
           +  K
Sbjct: 120 KMEK 123


>gi|269792799|ref|YP_003317703.1| 30S ribosomal protein S12 [Thermanaerovibrio acidaminovorans DSM
           6589]
 gi|269100434|gb|ACZ19421.1| ribosomal protein S12 [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 123

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QLIR  R+   R  +   AL+ NPQ+RGVC RVYTVTPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLIRNGREEKRRRSS-APALQENPQRRGVCTRVYTVTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV+ R+Q RS+YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDCGGVEKRRQGRSKYGA 119

Query: 121 ERPK 124
            RPK
Sbjct: 120 RRPK 123


>gi|307543820|ref|YP_003896299.1| 30S ribosomal protein S12 [Halomonas elongata DSM 2581]
 gi|307215844|emb|CBV41114.1| 30S ribosomal protein S12 [Halomonas elongata DSM 2581]
          Length = 124

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK    A + V AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRQA-AKSDVPALQACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV+NRKQ RS+YG 
Sbjct: 60  GYEVASYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDTSGVQNRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|289424801|ref|ZP_06426583.1| ribosomal protein S12 [Propionibacterium acnes SK187]
 gi|50840934|gb|AAT83601.1| 30S ribosomal protein S12 [Propionibacterium acnes KPA171202]
 gi|289154764|gb|EFD03447.1| ribosomal protein S12 [Propionibacterium acnes SK187]
          Length = 140

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+ QL+RK R     +  K  AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 18  VPTIQQLVRKGRTDKI-SKNKTPALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 76

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK RKQARSRYGA
Sbjct: 77  GIEVTAYIPGVGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGSLDTQGVKGRKQARSRYGA 136

Query: 121 ERPK 124
           ++ K
Sbjct: 137 KKEK 140


>gi|171060531|ref|YP_001792880.1| 30S ribosomal protein S12 [Leptothrix cholodnii SP-6]
 gi|226712611|sp|B1Y7G7|RS12_LEPCP RecName: Full=30S ribosomal protein S12
 gi|170777976|gb|ACB36115.1| ribosomal protein S12 [Leptothrix cholodnii SP-6]
          Length = 125

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R+      +K  A++  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRQGREVEV-TKSKSPAMQNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YG+
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGS 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|295394354|ref|ZP_06804579.1| 30S ribosomal protein S12 [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972812|gb|EFG48662.1| 30S ribosomal protein S12 [Brevibacterium mcbrellneri ATCC 49030]
          Length = 124

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 102/125 (81%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVT-ALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT+ QL+RK R    +A    T AL G+PQ+RGVC RVYT TPKKPNSALRKV + +L+
Sbjct: 1   MPTIQQLVRKGRHD--KAAKNATPALLGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLS 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           S +EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK R+QARSRYG
Sbjct: 59  SQIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGSLDTQGVKGRQQARSRYG 118

Query: 120 AERPK 124
           A+R K
Sbjct: 119 AKREK 123


>gi|50346806|ref|YP_053133.1| ribosomal protein S12 [Nymphaea alba]
 gi|50346807|ref|YP_053134.1| ribosomal protein S12 [Nymphaea alba]
 gi|121720637|ref|YP_001001513.1| ribosomal protein S12 [Nuphar advena]
 gi|121720660|ref|YP_001001558.1| ribosomal protein S12 [Nuphar advena]
 gi|68053160|sp|Q6EW28|RR12_NYMAL RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|158514026|sp|A1XFT4|RR12_NUPAD RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|50250351|emb|CAF28617.1| ribosomal protein S12 [Nymphaea alba]
 gi|50250352|emb|CAF28618.1| ribosomal protein S12 [Nymphaea alba]
 gi|84682228|gb|ABC60482.1| ribosomal protein S12 [Nuphar advena]
 gi|84682251|gb|ABC60505.1| ribosomal protein S12 [Nuphar advena]
 gi|290487434|gb|ADD30101.1| ribosomal protein S12 [Ehretia acuminata]
          Length = 123

 Score =  169 bits (427), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PMRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|308178142|ref|YP_003917548.1| 30S ribosomal protein S12 [Arthrobacter arilaitensis Re117]
 gi|307745605|emb|CBT76577.1| 30S ribosomal protein S12 [Arthrobacter arilaitensis Re117]
          Length = 124

 Score =  169 bits (427), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 98/122 (80%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R        K  AL+GNP +RGVC RVYT TPKKPNSALRKV + RL  
Sbjct: 1   MPTIQQLVRKGRSPKV-VKTKAPALKGNPMRRGVCTRVYTTTPKKPNSALRKVARVRLAG 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVK+RKQARSRYGA
Sbjct: 60  GVEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQGVKDRKQARSRYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|88600826|gb|ABD46294.1| ribosomal protein S12 [Neorickettsia sennetsu str. Miyayama]
          Length = 123

 Score =  169 bits (427), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 99/122 (81%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPRK   R   +V AL  NP KRG+C +VYT TPKKPNSALRKV + RL+ 
Sbjct: 2   MPTINQLVRKPRKTPAR-INRVPALNKNPLKRGICSKVYTTTPKKPNSALRKVARVRLSG 60

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVIAY+PGEGHNLQEHSVV + GGRVKDLPGV+Y ++RGV D +GVK RK+ RS+YGA
Sbjct: 61  GAEVIAYIPGEGHNLQEHSVVCIRGGRVKDLPGVRYHIVRGVFDTEGVKGRKKGRSKYGA 120

Query: 121 ER 122
           ++
Sbjct: 121 KK 122


>gi|291280153|ref|YP_003496988.1| 30S ribosomal protein S12 [Deferribacter desulfuricans SSM1]
 gi|290754855|dbj|BAI81232.1| 30S ribosomal protein S12 [Deferribacter desulfuricans SSM1]
          Length = 123

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK  +       K  AL+GNPQKRGVC+RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTLNQLVRK-GRKKVVKKTKSPALQGNPQKRGVCVRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PG GHNLQEHSVV++ GGRVKDLPG++Y++IRG LDA GV +RKQ+RS+YGA
Sbjct: 60  GVEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGIRYKIIRGALDASGVADRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|237703073|ref|ZP_04533554.1| 30S ribosomal subunit protein S12 [Escherichia sp. 3_2_53FAA]
 gi|254038504|ref|ZP_04872560.1| 30S ribosomal subunit protein S12 [Escherichia sp. 1_1_43]
 gi|293412762|ref|ZP_06655430.1| 30S ribosomal protein S12 [Escherichia coli B354]
 gi|293416746|ref|ZP_06659383.1| 30S ribosomal protein S12 [Escherichia coli B185]
 gi|293453647|ref|ZP_06664066.1| 30S ribosomal protein S12 [Escherichia coli B088]
 gi|309794603|ref|ZP_07689025.1| ribosomal protein S12 [Escherichia coli MS 145-7]
 gi|331644039|ref|ZP_08345168.1| ribosomal protein S12 [Escherichia coli H736]
 gi|331649141|ref|ZP_08350227.1| ribosomal protein S12 [Escherichia coli M605]
 gi|331654922|ref|ZP_08355921.1| ribosomal protein S12 [Escherichia coli M718]
 gi|331674844|ref|ZP_08375601.1| ribosomal protein S12 [Escherichia coli TA280]
 gi|331679399|ref|ZP_08380069.1| ribosomal protein S12 [Escherichia coli H591]
 gi|26110368|gb|AAN82554.1|AE016767_314 30S ribosomal protein S12 [Escherichia coli CFT073]
 gi|91074392|gb|ABE09273.1| 30S ribosomal subunit protein S12 [Escherichia coli UTI89]
 gi|226839010|gb|EEH71033.1| 30S ribosomal subunit protein S12 [Escherichia sp. 1_1_43]
 gi|226902337|gb|EEH88596.1| 30S ribosomal subunit protein S12 [Escherichia sp. 3_2_53FAA]
 gi|291321773|gb|EFE61204.1| 30S ribosomal protein S12 [Escherichia coli B088]
 gi|291431322|gb|EFF04307.1| 30S ribosomal protein S12 [Escherichia coli B185]
 gi|291468409|gb|EFF10902.1| 30S ribosomal protein S12 [Escherichia coli B354]
 gi|308121653|gb|EFO58915.1| ribosomal protein S12 [Escherichia coli MS 145-7]
 gi|325498891|gb|EGC96750.1| 30S ribosomal subunit protein S12 [Escherichia fergusonii ECD227]
 gi|331036333|gb|EGI08559.1| ribosomal protein S12 [Escherichia coli H736]
 gi|331041639|gb|EGI13783.1| ribosomal protein S12 [Escherichia coli M605]
 gi|331046937|gb|EGI19015.1| ribosomal protein S12 [Escherichia coli M718]
 gi|331067753|gb|EGI39151.1| ribosomal protein S12 [Escherichia coli TA280]
 gi|331072571|gb|EGI43896.1| ribosomal protein S12 [Escherichia coli H591]
 gi|332104235|gb|EGJ07581.1| 30S ribosomal subunit protein S12 [Shigella sp. D9]
          Length = 144

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 21  MATVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 79

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 80  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGV 139

Query: 121 ERPK 124
           +RPK
Sbjct: 140 KRPK 143


>gi|258591311|emb|CBE67610.1| 30S ribosomal subunit protein S12 [NC10 bacterium 'Dutch sediment']
          Length = 125

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RK R  + +  AK  AL+  PQ+RGVC+RVYT TPKKPNSALRKV + RL++
Sbjct: 1   MPTIHQLVRKGRAAAVKK-AKTPALQRCPQRRGVCIRVYTTTPKKPNSALRKVTRVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PG GHNLQEHS+V++ GGRVKDLPGV+Y VIRG LD  GV++RKQARS YGA
Sbjct: 60  GIEVTTYIPGIGHNLQEHSIVLIRGGRVKDLPGVRYHVIRGALDTAGVQDRKQARSLYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|161986639|ref|YP_445162.2| 30S ribosomal protein S12 [Salinibacter ruber DSM 13855]
 gi|115502081|sp|Q2S3R9|RS12_SALRD RecName: Full=30S ribosomal protein S12
          Length = 124

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT  QLIRK RK +    +   AL G+PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTTQQLIRKGRK-TEEETSDAPALEGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV+ R+Q RS+YG 
Sbjct: 60  GNEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVEERRQGRSKYGT 119

Query: 121 ERPK 124
           ++P+
Sbjct: 120 KKPR 123


>gi|118430347|ref|YP_874714.1| ribosomal protein S12 [Agrostis stolonifera]
 gi|118430361|ref|YP_874760.1| ribosomal protein S12 [Agrostis stolonifera]
 gi|118430432|ref|YP_874631.1| ribosomal protein S12 [Hordeum vulgare subsp. vulgare]
 gi|118430445|ref|YP_874676.1| ribosomal protein S12 [Hordeum vulgare subsp. vulgare]
 gi|159106887|ref|YP_001531262.1| ribosomal protein S12 [Lolium perenne]
 gi|159106927|ref|YP_001542418.1| ribosomal protein S12 [Lolium perenne]
 gi|1350868|sp|P48856|RR12_HORVU RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|125987673|sp|A1E9Y6|RR12_AGRST RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|899306|emb|CAA61739.1| small ribosomal protein 12 [Hordeum vulgare subsp. vulgare]
 gi|118201086|gb|ABK79457.1| ribosomal protein S12 [Hordeum vulgare subsp. vulgare]
 gi|118201099|gb|ABK79470.1| ribosomal protein S12 [Hordeum vulgare subsp. vulgare]
 gi|118201256|gb|ABK79625.1| ribosomal protein S12 [Agrostis stolonifera]
 gi|118201270|gb|ABK79639.1| ribosomal protein S12 [Agrostis stolonifera]
 gi|158934421|emb|CAO85999.1| ribosomal protein S12 [Lolium perenne]
          Length = 124

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTV QLIR  R+   R   K  AL+G PQ+RG C RVYT+ PKKPNSALRKV + RLTS
Sbjct: 1   MPTVKQLIRNARQ-PIRNARKTAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+YR+IRG LDA  VKNR+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDAVAVKNRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|116617154|ref|YP_817461.1| ribosomal protein S12 [Coffea arabica]
 gi|116617167|ref|YP_817506.1| ribosomal protein S12 [Coffea arabica]
 gi|161784216|ref|YP_001595487.1| ribosomal protein S12 [Lemna minor]
 gi|161784256|ref|YP_001595532.1| ribosomal protein S12 [Lemna minor]
 gi|122153600|sp|A0A314|RR12_COFAR RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|88696794|gb|ABD48519.1| ribosomal protein S12 [Lemna minor]
 gi|88696834|gb|ABD48559.1| ribosomal protein S12 [Lemna minor]
 gi|116242210|gb|ABJ89725.1| ribosomal protein S12 [Coffea arabica]
 gi|116242223|gb|ABJ89738.1| ribosomal protein S12 [Coffea arabica]
 gi|290487454|gb|ADD30111.1| ribosomal protein S12 [Bulnesia arborea]
          Length = 123

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNARQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|152998276|ref|YP_001343111.1| 30S ribosomal protein S12 [Marinomonas sp. MWYL1]
 gi|189040465|sp|A6W397|RS12_MARMS RecName: Full=30S ribosomal protein S12
 gi|150839200|gb|ABR73176.1| ribosomal protein S12 [Marinomonas sp. MWYL1]
          Length = 124

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPRK    A + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRKRKV-AKSDVPALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV+NRKQ RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVQNRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|7525057|ref|NP_051038.1| ribosomal protein S12 [Arabidopsis thaliana]
 gi|7525080|ref|NP_051037.1| ribosomal protein S12 [Arabidopsis thaliana]
 gi|11497571|ref|NP_054910.1| ribosomal protein S12 [Spinacia oleracea]
 gi|11497594|ref|NP_054911.1| ribosomal protein S12 [Spinacia oleracea]
 gi|59430010|ref|NP_054549.2| ribosomal protein S12 [Nicotiana tabacum]
 gi|59430011|ref|NP_054568.2| ribosomal protein S12 [Nicotiana tabacum]
 gi|68164827|ref|YP_247624.1| ribosomal protein S12 [Cucumis sativus]
 gi|68164828|ref|YP_247623.1| ribosomal protein S12 [Cucumis sativus]
 gi|75755682|ref|YP_319744.1| ribosomal protein S12 [Acorus calamus]
 gi|75755683|ref|YP_319743.1| ribosomal protein S12 [Acorus calamus]
 gi|78102562|ref|YP_358650.1| ribosomal protein S12 [Nicotiana sylvestris]
 gi|78102589|ref|YP_358649.1| ribosomal protein S12 [Nicotiana sylvestris]
 gi|81301592|ref|YP_398837.1| ribosomal protein S12 [Nicotiana tomentosiformis]
 gi|81301619|ref|YP_398836.1| ribosomal protein S12 [Nicotiana tomentosiformis]
 gi|115605086|ref|YP_784497.1| ribosomal protein S12 [Piper cenocladum]
 gi|115605088|ref|YP_784452.1| ribosomal protein S12 [Piper cenocladum]
 gi|139387276|ref|YP_001123397.1| ribosomal protein S12 [Capsella bursa-pastoris]
 gi|139387299|ref|YP_001123352.1| ribosomal protein S12 [Capsella bursa-pastoris]
 gi|139388118|ref|YP_001123310.1| ribosomal protein S12 [Barbarea verna]
 gi|139388141|ref|YP_001123265.1| ribosomal protein S12 [Barbarea verna]
 gi|139388934|ref|YP_001123661.1| ribosomal protein S12 [Lepidium virginicum]
 gi|139388957|ref|YP_001123616.1| ribosomal protein S12 [Lepidium virginicum]
 gi|139389120|ref|YP_001123838.1| ribosomal protein S12 [Nasturtium officinale]
 gi|139389143|ref|YP_001123793.1| ribosomal protein S12 [Nasturtium officinale]
 gi|139389288|ref|YP_001123054.1| ribosomal protein S12 [Aethionema grandiflorum]
 gi|139389310|ref|YP_001123010.1| ribosomal protein S12 [Aethionema grandiflorum]
 gi|139389442|ref|YP_001123139.1| ribosomal protein S12 [Olimarabidopsis pumila]
 gi|139389825|ref|YP_001123486.1| ribosomal protein S12 [Crucihimalaya wallichii]
 gi|139389848|ref|YP_001123441.1| ribosomal protein S12 [Crucihimalaya wallichii]
 gi|139389974|ref|YP_001123574.1| ribosomal protein S12 [Draba nemorosa]
 gi|139389997|ref|YP_001123530.1| ribosomal protein S12 [Draba nemorosa]
 gi|139390176|ref|YP_001123749.1| ribosomal protein S12 [Lobularia maritima]
 gi|139390199|ref|YP_001123705.1| ribosomal protein S12 [Lobularia maritima]
 gi|139390372|ref|YP_001122970.1| ribosomal protein S12 [Aethionema cordifolium]
 gi|139390394|ref|YP_001122926.1| ribosomal protein S12 [Aethionema cordifolium]
 gi|161622289|ref|YP_001586161.1| ribosomal protein S12 [Acorus americanus]
 gi|161622333|ref|YP_001586205.1| ribosomal protein S12 [Acorus americanus]
 gi|189162295|ref|YP_001936541.1| ribosomal protein S12 [Fagopyrum esculentum subsp. ancestrale]
 gi|189162334|ref|YP_001936496.1| ribosomal protein S12 [Fagopyrum esculentum subsp. ancestrale]
 gi|289065113|ref|YP_003433954.1| ribosomal protein S12 [Typha latifolia]
 gi|289065148|ref|YP_003433999.1| ribosomal protein S12 [Typha latifolia]
 gi|49065835|sp|P62126|RR12_ARATH RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|49065836|sp|P62127|RR12_NICPL RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|49065837|sp|P62128|RR12_SPIOL RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|49065838|sp|P62129|RR12_TOBAC RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|75317282|sp|Q4VZJ2|RR12_CUCSA RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|122164338|sp|Q06GN6|RR12_PIPCE RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|122249044|sp|Q33C08|RR12_NICTO RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|122249061|sp|Q3C1K5|RR12_NICSY RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|122249111|sp|Q3V510|RR12_ACOCL RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|158513603|sp|A4QJD9|RR12_AETCO RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|158513622|sp|A4QJM3|RR12_AETGR RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|158513628|sp|A4QJV5|RR12A_OLIPU RecName: Full=30S ribosomal protein S12-A, chloroplastic
 gi|158513954|sp|A4QKC9|RR12_BARVE RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|158513961|sp|A4QKL6|RR12_CAPBU RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|158513968|sp|A4QKV5|RR12_CRUWA RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|158513975|sp|A4QL43|RR12_DRANE RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|158513982|sp|A4QLD0|RR12_LEPVR RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|158513989|sp|A4QLL8|RR12_LOBMA RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|158513996|sp|A4QLV7|RR12_NASOF RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|188036213|pdb|3BBN|L Chain L, Homology Model For The Spinach Chloroplast 30s Subunit
           Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome.
 gi|5881718|dbj|BAA84409.1| ribosomal protein S12 [Arabidopsis thaliana]
 gi|5881741|dbj|BAA84432.1| ribosomal protein S12 [Arabidopsis thaliana]
 gi|7636152|emb|CAB88774.1| ribosomal protein S12 [Spinacia oleracea]
 gi|7636175|emb|CAB88797.1| ribosomal protein S12 [Spinacia oleracea]
 gi|67511422|emb|CAJ00782.1| rps12 [Cucumis sativus]
 gi|67511423|emb|CAJ00783.1| rps12 [Cucumis sativus]
 gi|74381732|emb|CAI53817.1| ribosomal protein S12 [Acorus calamus]
 gi|74381733|emb|CAI53818.1| ribosomal protein S12 [Acorus calamus]
 gi|77799589|dbj|BAE46678.1| ribosomal protein S12 [Nicotiana sylvestris]
 gi|77799616|dbj|BAE46705.1| ribosomal protein S12 [Nicotiana sylvestris]
 gi|80750951|dbj|BAE48027.1| ribosomal protein S12 [Nicotiana tomentosiformis]
 gi|80750978|dbj|BAE48054.1| ribosomal protein S12 [Nicotiana tomentosiformis]
 gi|112253815|gb|ABI14536.1| ribosomal protein S12 [Piper cenocladum]
 gi|112253817|gb|ABI14538.1| ribosomal protein S12 [Piper cenocladum]
 gi|134286165|dbj|BAF49794.1| ribosomal protein S1 [Aethionema cordifolium]
 gi|134286187|dbj|BAF49816.1| ribosomal protein S12 [Aethionema cordifolium]
 gi|134286250|dbj|BAF49878.1| ribosomal protein S1 [Aethionema grandiflorum]
 gi|134286272|dbj|BAF49900.1| ribosomal protein S12 [Aethionema grandiflorum]
 gi|134286336|dbj|BAF49963.1| ribosomal protein S1 [Olimarabidopsis pumila]
 gi|134286509|dbj|BAF50134.1| ribosomal protein S1 [Barbarea verna]
 gi|134286532|dbj|BAF50157.1| ribosomal protein S12 [Barbarea verna]
 gi|134286597|dbj|BAF50221.1| ribosomal protein S1 [Capsella bursa-pastoris]
 gi|134286620|dbj|BAF50244.1| ribosomal protein S12 [Capsella bursa-pastoris]
 gi|134286687|dbj|BAF50310.1| ribosomal protein S1 [Crucihimalaya wallichii]
 gi|134286710|dbj|BAF50333.1| ribosomal protein S12 [Crucihimalaya wallichii]
 gi|134286776|dbj|BAF50398.1| ribosomal protein S1 [Draba nemorosa]
 gi|134286799|dbj|BAF50421.1| ribosomal protein S12 [Draba nemorosa]
 gi|134286864|dbj|BAF50485.1| ribosomal protein S1 [Lepidium virginicum]
 gi|134286887|dbj|BAF50508.1| ribosomal protein S12 [Lepidium virginicum]
 gi|134286953|dbj|BAF50573.1| ribosomal protein S1 [Lobularia maritima]
 gi|134286976|dbj|BAF50596.1| ribosomal protein S12 [Lobularia maritima]
 gi|134287043|dbj|BAF50662.1| ribosomal protein S1 [Nasturtium officinale]
 gi|134287066|dbj|BAF50685.1| ribosomal protein S12 [Nasturtium officinale]
 gi|160369832|gb|ABX38723.1| ribosomal protein S12 [Acorus americanus]
 gi|160369876|gb|ABX38767.1| ribosomal protein S12 [Acorus americanus]
 gi|166065381|gb|ABY79756.1| ribosomal protein S12 [Fagopyrum esculentum subsp. ancestrale]
 gi|166065420|gb|ABY79795.1| ribosomal protein S12 [Fagopyrum esculentum subsp. ancestrale]
 gi|281371796|gb|ADA63723.1| ribosomal protein S12 [Typha latifolia]
 gi|281371831|gb|ADA63758.1| ribosomal protein S12 [Typha latifolia]
 gi|290487444|gb|ADD30106.1| ribosomal protein S12 [Nerium oleander]
 gi|225248|prf||1211235CG ribosomal protein S12
          Length = 123

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|62129585|gb|AAX67288.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
          Length = 144

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 21  MATVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 79

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 80  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGV 139

Query: 121 ERPK 124
           +RPK
Sbjct: 140 KRPK 143


>gi|297569427|ref|YP_003690771.1| ribosomal protein S12 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925342|gb|ADH86152.1| ribosomal protein S12 [Desulfurivibrio alkaliphilus AHT2]
          Length = 123

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ RK   +      A++  PQKRGVC+RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRQGRKKRVKK-TNTPAMKACPQKRGVCVRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y V+RG LD  GV NRKQ RS+YGA
Sbjct: 60  GIEVTSYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGTLDTLGVANRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|161511034|ref|YP_506566.2| 30S ribosomal protein S12 [Neorickettsia sennetsu str. Miyayama]
 gi|254797041|ref|YP_003081878.1| ribosomal protein S12 [Neorickettsia risticii str. Illinois]
 gi|110825782|sp|Q2GD80|RS12_NEOSM RecName: Full=30S ribosomal protein S12
 gi|254590268|gb|ACT69630.1| ribosomal protein S12 [Neorickettsia risticii str. Illinois]
          Length = 122

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 99/122 (81%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPRK   R   +V AL  NP KRG+C +VYT TPKKPNSALRKV + RL+ 
Sbjct: 1   MPTINQLVRKPRKTPAR-INRVPALNKNPLKRGICSKVYTTTPKKPNSALRKVARVRLSG 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVIAY+PGEGHNLQEHSVV + GGRVKDLPGV+Y ++RGV D +GVK RK+ RS+YGA
Sbjct: 60  GAEVIAYIPGEGHNLQEHSVVCIRGGRVKDLPGVRYHIVRGVFDTEGVKGRKKGRSKYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|326793553|ref|YP_004311373.1| ribosomal protein S12 [Marinomonas mediterranea MMB-1]
 gi|326544317|gb|ADZ89537.1| ribosomal protein S12 [Marinomonas mediterranea MMB-1]
          Length = 123

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPRK    A + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRKRKV-AKSDVPALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV+NRKQ RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVQNRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|229817293|ref|ZP_04447575.1| hypothetical protein BIFANG_02554 [Bifidobacterium angulatum DSM
           20098]
 gi|229785082|gb|EEP21196.1| hypothetical protein BIFANG_02554 [Bifidobacterium angulatum DSM
           20098]
          Length = 123

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R    +  +K  AL+G+P +RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIEQLVRKGRSPKPKK-SKTLALKGSPLRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ RS YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVKDRKQGRSLYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|69216535|gb|AAZ03933.1| ribosomal protein S12 [Nuphar advena]
          Length = 123

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PMRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSQYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|116748986|ref|YP_845673.1| 30S ribosomal protein S12 [Syntrophobacter fumaroxidans MPOB]
 gi|158512348|sp|A0LII6|RS12_SYNFM RecName: Full=30S ribosomal protein S12
 gi|116698050|gb|ABK17238.1| SSU ribosomal protein S12P [Syntrophobacter fumaroxidans MPOB]
          Length = 123

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   R  +   AL+  PQKRGVC+RVYT TPKKPNSALRK+ + RLT+
Sbjct: 1   MPTINQLVRKGRE-EIRKKSSTPALQCCPQKRGVCVRVYTTTPKKPNSALRKIARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDA GV +RKQ RS+YG 
Sbjct: 60  GIEVTSYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDALGVADRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|121592707|ref|YP_984603.1| 30S ribosomal protein S12 [Acidovorax sp. JS42]
 gi|221069455|ref|ZP_03545560.1| ribosomal protein S12 [Comamonas testosteroni KF-1]
 gi|222109488|ref|YP_002551752.1| 30S ribosomal protein s12 [Acidovorax ebreus TPSY]
 gi|299530592|ref|ZP_07044010.1| 30S ribosomal protein S12 [Comamonas testosteroni S44]
 gi|158513892|sp|A1W2Q2|RS12_ACISJ RecName: Full=30S ribosomal protein S12
 gi|254811084|sp|B9MB68|RS12_DIAST RecName: Full=30S ribosomal protein S12
 gi|120604787|gb|ABM40527.1| SSU ribosomal protein S12P [Acidovorax sp. JS42]
 gi|220714478|gb|EED69846.1| ribosomal protein S12 [Comamonas testosteroni KF-1]
 gi|221728932|gb|ACM31752.1| ribosomal protein S12 [Acidovorax ebreus TPSY]
 gi|298721415|gb|EFI62354.1| 30S ribosomal protein S12 [Comamonas testosteroni S44]
          Length = 125

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R       +K  A+   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRQGRTVEV-VKSKSPAMENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|284053254|ref|ZP_06383464.1| 30S ribosomal protein S12 [Arthrospira platensis str. Paraca]
 gi|133752|sp|P13576|RS12_SPIPL RecName: Full=30S ribosomal protein S12
 gi|47448|emb|CAA33670.1| unnamed protein product [Arthrospira platensis]
 gi|291569323|dbj|BAI91595.1| 30S ribosomal protein S12 [Arthrospira platensis NIES-39]
          Length = 124

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ + +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSAREKTDKK-TKSPALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+R+  RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRNGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|11467352|ref|NP_043209.1| ribosomal protein S12 [Cyanophora paradoxa]
 gi|133736|sp|P17294|RR12_CYAPA RecName: Full=Cyanelle 30S ribosomal protein S12
 gi|11414|emb|CAA36738.1| unnamed protein product [Cyanophora paradoxa]
 gi|1016153|gb|AAA81240.1| ribosomal protein S12 [Cyanophora paradoxa]
          Length = 124

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R        K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSKRT-KIEKKTKSPALKACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDAAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|257064324|ref|YP_003143996.1| SSU ribosomal protein S12P [Slackia heliotrinireducens DSM 20476]
 gi|256791977|gb|ACV22647.1| SSU ribosomal protein S12P [Slackia heliotrinireducens DSM 20476]
          Length = 123

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R        K  AL+GNPQKRGVC RVYT TPKKPNSALRKV + RL +
Sbjct: 1   MPTINQLVRKGRAKQVDK-RKTPALKGNPQKRGVCTRVYTTTPKKPNSALRKVARVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGH LQEHS+V++ GGRVKDLPGV+Y++IR  LD   V  RKQARSRYGA
Sbjct: 60  GMEVTAYIPGEGHKLQEHSMVLIRGGRVKDLPGVRYKIIRAALDCTPVDGRKQARSRYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|139387503|ref|YP_001122830.1| ribosomal protein S12 [Phaseolus vulgaris]
 gi|146216964|ref|YP_001165473.1| ribosomal protein S12 [Phaseolus vulgaris]
 gi|158513616|sp|A4GGC9|RR12_PHAVU RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|112031025|gb|ABH88137.1| ribosomal protein S12 [Phaseolus vulgaris]
 gi|145314572|gb|ABP58678.1| ribosomal protein S12 [Phaseolus vulgaris]
 gi|158187114|gb|ABW22747.1| ribosomal protein S12 [Phaseolus vulgaris]
 gi|158187115|gb|ABW22748.1| ribosomal protein S12 [Phaseolus vulgaris]
          Length = 123

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  AL+G PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTMKQLIRNTRQ-PIRNVTKSPALQGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YGA
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|222823481|ref|YP_002575055.1| 30S ribosomal protein S12 [Campylobacter lari RM2100]
 gi|254811075|sp|B9KFG9|RS12_CAMLR RecName: Full=30S ribosomal protein S12
 gi|222538703|gb|ACM63804.1| 30S ribosomal protein S12 [Campylobacter lari RM2100]
          Length = 127

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK      +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLVRKERKKVLEK-SKSPALKNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV  R  +RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|212704150|ref|ZP_03312278.1| hypothetical protein DESPIG_02205 [Desulfovibrio piger ATCC 29098]
 gi|212672354|gb|EEB32837.1| hypothetical protein DESPIG_02205 [Desulfovibrio piger ATCC 29098]
          Length = 123

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  R    +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRIERTAVVKR-KKTPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV +R+++RS+YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTSGVADRRKSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|203284299|ref|YP_002222039.1| 30S ribosomal protein S12 [Borrelia duttonii Ly]
 gi|203287835|ref|YP_002222850.1| 30S ribosomal protein S12 [Borrelia recurrentis A1]
 gi|226708464|sp|B5RLU7|RS12_BORDL RecName: Full=30S ribosomal protein S12
 gi|226708467|sp|B5RRJ5|RS12_BORRA RecName: Full=30S ribosomal protein S12
 gi|201083742|gb|ACH93333.1| 30S ribosomal protein S12 [Borrelia duttonii Ly]
 gi|201085055|gb|ACH94629.1| 30S ribosomal protein S12 [Borrelia recurrentis A1]
          Length = 124

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPRK      A   AL+  PQKRG+C RV TVTPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLIRKPRKSQKEKTAS-PALQNCPQKRGICTRVMTVTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG  D  GV NRKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGAKDTLGVNNRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|82701895|ref|YP_411461.1| 30S ribosomal protein S12 [Nitrosospira multiformis ATCC 25196]
 gi|115305664|sp|Q2YB02|RS12_NITMU RecName: Full=30S ribosomal protein S12
 gi|82409960|gb|ABB74069.1| SSU ribosomal protein S12P [Nitrosospira multiformis ATCC 25196]
          Length = 125

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RKPR  +    +KV AL  +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLVRKPR-AAKPLKSKVPALGNSPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YGA
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|294638059|ref|ZP_06716318.1| ribosomal protein S12 [Edwardsiella tarda ATCC 23685]
 gi|291088767|gb|EFE21328.1| ribosomal protein S12 [Edwardsiella tarda ATCC 23685]
          Length = 135

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 12  MATINQLVRKPRAKKVEK-SNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 70

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 71  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGV 130

Query: 121 ERPK 124
           +RPK
Sbjct: 131 KRPK 134


>gi|33241116|ref|NP_876058.1| 30S ribosomal protein S12 [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
 gi|52783393|sp|Q7VA02|RS12_PROMA RecName: Full=30S ribosomal protein S12
 gi|33238646|gb|AAQ00711.1| Ribosomal protein S12 [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
          Length = 124

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALR  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRTERQRLTRK-TKSPALRSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV+L GGRVKDLPGV+Y +IRG LD  GVK+R+QARS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQARSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KAPK 123


>gi|15803855|ref|NP_289889.1| 30S ribosomal protein S12 [Escherichia coli O157:H7 EDL933]
 gi|15833447|ref|NP_312220.1| 30S ribosomal protein S12 [Escherichia coli O157:H7 str. Sakai]
 gi|16131221|ref|NP_417801.1| 30S ribosomal subunit protein S12 [Escherichia coli str. K-12
           substr. MG1655]
 gi|16762835|ref|NP_458452.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16766737|ref|NP_462352.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29144322|ref|NP_807664.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|30065372|ref|NP_839543.1| 30S ribosomal protein S12 [Shigella flexneri 2a str. 2457T]
 gi|56415367|ref|YP_152442.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|56480314|ref|NP_709116.2| 30S ribosomal protein S12 [Shigella flexneri 2a str. 301]
 gi|74313848|ref|YP_312267.1| 30S ribosomal protein S12 [Shigella sonnei Ss046]
 gi|82545692|ref|YP_409639.1| 30S ribosomal protein S12 [Shigella boydii Sb227]
 gi|82778623|ref|YP_404972.1| 30S ribosomal protein S12 [Shigella dysenteriae Sd197]
 gi|89110668|ref|AP_004448.1| 30S ribosomal subunit protein S12 [Escherichia coli str. K-12
           substr. W3110]
 gi|110807175|ref|YP_690695.1| 30S ribosomal protein S12 [Shigella flexneri 5 str. 8401]
 gi|117625620|ref|YP_858943.1| 30S ribosomal protein S12 [Escherichia coli APEC O1]
 gi|146313392|ref|YP_001178466.1| 30S ribosomal protein S12 [Enterobacter sp. 638]
 gi|157159216|ref|YP_001464796.1| 30S ribosomal protein S12 [Escherichia coli E24377A]
 gi|157162818|ref|YP_001460136.1| 30S ribosomal protein S12 [Escherichia coli HS]
 gi|161486095|ref|NP_755980.2| 30S ribosomal protein S12 [Escherichia coli CFT073]
 gi|162138355|ref|YP_542804.2| 30S ribosomal protein S12 [Escherichia coli UTI89]
 gi|162139535|ref|YP_218369.2| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|168232575|ref|ZP_02657633.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|170018422|ref|YP_001723376.1| 30S ribosomal protein S12 [Escherichia coli ATCC 8739]
 gi|170683246|ref|YP_001745590.1| 30S ribosomal protein S12 [Escherichia coli SMS-3-5]
 gi|170769555|ref|ZP_02904008.1| ribosomal protein S12 [Escherichia albertii TW07627]
 gi|187733627|ref|YP_001882015.1| 30S ribosomal protein S12 [Shigella boydii CDC 3083-94]
 gi|188492124|ref|ZP_02999394.1| ribosomal protein S12 [Escherichia coli 53638]
 gi|189010787|ref|ZP_02809334.2| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4076]
 gi|189401831|ref|ZP_02778106.2| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4401]
 gi|189403222|ref|ZP_02794205.2| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4486]
 gi|189404708|ref|ZP_02810157.2| ribosomal protein S12 [Escherichia coli O157:H7 str. EC869]
 gi|191171605|ref|ZP_03033153.1| ribosomal protein S12 [Escherichia coli F11]
 gi|194445616|ref|YP_002042698.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194450308|ref|YP_002047471.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194734350|ref|YP_002116390.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197248822|ref|YP_002148367.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197264688|ref|ZP_03164762.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197300673|ref|ZP_02660092.2| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197364297|ref|YP_002143934.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198244511|ref|YP_002217410.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200388421|ref|ZP_03215033.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205354924|ref|YP_002228725.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205360340|ref|ZP_02682812.2| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|207858690|ref|YP_002245341.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|208806557|ref|ZP_03248894.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4206]
 gi|208812812|ref|ZP_03254141.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4045]
 gi|208821429|ref|ZP_03261749.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4042]
 gi|209395851|ref|YP_002272784.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4115]
 gi|209920794|ref|YP_002294878.1| 30S ribosomal protein S12 [Escherichia coli SE11]
 gi|213026551|ref|ZP_03340998.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213163699|ref|ZP_03349409.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213420986|ref|ZP_03354052.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213426778|ref|ZP_03359528.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213586432|ref|ZP_03368258.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213649030|ref|ZP_03379083.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213865460|ref|ZP_03387579.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|215488628|ref|YP_002331059.1| 30S ribosomal protein S12 [Escherichia coli O127:H6 str. E2348/69]
 gi|217324399|ref|ZP_03440483.1| ribosomal protein S12 [Escherichia coli O157:H7 str. TW14588]
 gi|218550603|ref|YP_002384394.1| 30S ribosomal protein S12 [Escherichia fergusonii ATCC 35469]
 gi|218555886|ref|YP_002388799.1| 30S ribosomal protein S12 [Escherichia coli IAI1]
 gi|218560403|ref|YP_002393316.1| 30S ribosomal protein S12 [Escherichia coli S88]
 gi|218691622|ref|YP_002399834.1| 30S ribosomal protein S12 [Escherichia coli ED1a]
 gi|218697021|ref|YP_002404688.1| 30S ribosomal protein S12 [Escherichia coli 55989]
 gi|218702090|ref|YP_002409719.1| 30S ribosomal protein S12 [Escherichia coli IAI39]
 gi|218706936|ref|YP_002414455.1| 30S ribosomal protein S12 [Escherichia coli UMN026]
 gi|224585243|ref|YP_002639042.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238913571|ref|ZP_04657408.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|253771832|ref|YP_003034663.1| 30S ribosomal protein S12 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254795265|ref|YP_003080102.1| 30S ribosomal protein S12 [Escherichia coli O157:H7 str. TW14359]
 gi|256020687|ref|ZP_05434552.1| 30S ribosomal protein S12 [Shigella sp. D9]
 gi|256025931|ref|ZP_05439796.1| 30S ribosomal protein S12 [Escherichia sp. 4_1_40B]
 gi|260599648|ref|YP_003212219.1| 30S ribosomal protein S12 [Cronobacter turicensis z3032]
 gi|260846126|ref|YP_003223904.1| 30S ribosomal subunit protein S12 [Escherichia coli O103:H2 str.
           12009]
 gi|260857449|ref|YP_003231340.1| 30S ribosomal subunit protein S12 [Escherichia coli O26:H11 str.
           11368]
 gi|260870070|ref|YP_003236472.1| 30S ribosomal subunit protein S12 [Escherichia coli O111:H- str.
           11128]
 gi|261224633|ref|ZP_05938914.1| 30S ribosomal subunit protein S12 [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254473|ref|ZP_05947006.1| 30S ribosomal subunit protein S12 [Escherichia coli O157:H7 str.
           FRIK966]
 gi|261341845|ref|ZP_05969703.1| ribosomal protein S12 [Enterobacter cancerogenus ATCC 35316]
 gi|283788019|ref|YP_003367884.1| 30S ribosomal subunit protein S12 [Citrobacter rodentium ICC168]
 gi|289803812|ref|ZP_06534441.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|289824776|ref|ZP_06544226.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|291284687|ref|YP_003501505.1| Ribosomal protein S12 [Escherichia coli O55:H7 str. CB9615]
 gi|293406926|ref|ZP_06650850.1| rps12 [Escherichia coli FVEC1412]
 gi|298382666|ref|ZP_06992261.1| small subunit ribosomal protein S12 [Escherichia coli FVEC1302]
 gi|300815462|ref|ZP_07095687.1| ribosomal protein S12 [Escherichia coli MS 107-1]
 gi|300822869|ref|ZP_07103005.1| ribosomal protein S12 [Escherichia coli MS 119-7]
 gi|300897843|ref|ZP_07116231.1| ribosomal protein S12 [Escherichia coli MS 198-1]
 gi|300907528|ref|ZP_07125168.1| ribosomal protein S12 [Escherichia coli MS 84-1]
 gi|300919392|ref|ZP_07135898.1| ribosomal protein S12 [Escherichia coli MS 115-1]
 gi|300926979|ref|ZP_07142739.1| ribosomal protein S12 [Escherichia coli MS 182-1]
 gi|300931140|ref|ZP_07146489.1| ribosomal protein S12 [Escherichia coli MS 187-1]
 gi|300935235|ref|ZP_07150257.1| ribosomal protein S12 [Escherichia coli MS 21-1]
 gi|300946926|ref|ZP_07161163.1| ribosomal protein S12 [Escherichia coli MS 116-1]
 gi|300956917|ref|ZP_07169174.1| ribosomal protein S12 [Escherichia coli MS 175-1]
 gi|300979567|ref|ZP_07174610.1| ribosomal protein S12 [Escherichia coli MS 45-1]
 gi|300986954|ref|ZP_07177927.1| ribosomal protein S12 [Escherichia coli MS 200-1]
 gi|301019744|ref|ZP_07183893.1| ribosomal protein S12 [Escherichia coli MS 69-1]
 gi|301023343|ref|ZP_07187135.1| ribosomal protein S12 [Escherichia coli MS 196-1]
 gi|301050456|ref|ZP_07197339.1| ribosomal protein S12 [Escherichia coli MS 185-1]
 gi|301302213|ref|ZP_07208345.1| ribosomal protein S12 [Escherichia coli MS 124-1]
 gi|301329637|ref|ZP_07222393.1| ribosomal protein S12 [Escherichia coli MS 78-1]
 gi|301645769|ref|ZP_07245689.1| ribosomal protein S12 [Escherichia coli MS 146-1]
 gi|306816315|ref|ZP_07450453.1| 30S ribosomal protein S12 [Escherichia coli NC101]
 gi|307140026|ref|ZP_07499382.1| 30S ribosomal protein S12 [Escherichia coli H736]
 gi|307311996|ref|ZP_07591634.1| ribosomal protein S12 [Escherichia coli W]
 gi|311277717|ref|YP_003939948.1| ribosomal protein S12 [Enterobacter cloacae SCF1]
 gi|312968347|ref|ZP_07782557.1| ribosomal protein S12 [Escherichia coli 2362-75]
 gi|312972396|ref|ZP_07786570.1| ribosomal protein S12 [Escherichia coli 1827-70]
 gi|331659634|ref|ZP_08360572.1| ribosomal protein S12 [Escherichia coli TA206]
 gi|331664942|ref|ZP_08365843.1| ribosomal protein S12 [Escherichia coli TA143]
 gi|331670158|ref|ZP_08370997.1| ribosomal protein S12 [Escherichia coli TA271]
 gi|331684985|ref|ZP_08385571.1| ribosomal protein S12 [Escherichia coli H299]
 gi|62287384|sp|Q5PIW1|RS12_SALPA RecName: Full=30S ribosomal protein S12
 gi|62288954|sp|P0A7S3|RS12_ECOLI RecName: Full=30S ribosomal protein S12
 gi|62288955|sp|P0A7S4|RS12_ECOL6 RecName: Full=30S ribosomal protein S12
 gi|62288956|sp|P0A7S5|RS12_ECO57 RecName: Full=30S ribosomal protein S12
 gi|62288957|sp|P0A7S6|RS12_SALTY RecName: Full=30S ribosomal protein S12
 gi|62288958|sp|P0A7S7|RS12_SALTI RecName: Full=30S ribosomal protein S12
 gi|62288959|sp|P0A7S8|RS12_SHIFL RecName: Full=30S ribosomal protein S12
 gi|90111800|sp|Q57J24|RS12_SALCH RecName: Full=30S ribosomal protein S12
 gi|90111801|sp|Q31VU7|RS12_SHIBS RecName: Full=30S ribosomal protein S12
 gi|90111802|sp|Q32B24|RS12_SHIDS RecName: Full=30S ribosomal protein S12
 gi|90111803|sp|Q3YWT0|RS12_SHISS RecName: Full=30S ribosomal protein S12
 gi|119366769|sp|Q1R5U1|RS12_ECOUT RecName: Full=30S ribosomal protein S12
 gi|123146630|sp|Q0SZX5|RS12_SHIF8 RecName: Full=30S ribosomal protein S12
 gi|158512618|sp|A1AGM9|RS12_ECOK1 RecName: Full=30S ribosomal protein S12
 gi|166991588|sp|A7ZSL7|RS12_ECO24 RecName: Full=30S ribosomal protein S12
 gi|166991589|sp|A8A5E9|RS12_ECOHS RecName: Full=30S ribosomal protein S12
 gi|166991590|sp|A4WFD5|RS12_ENT38 RecName: Full=30S ribosomal protein S12
 gi|189040458|sp|B1IPV7|RS12_ECOLC RecName: Full=30S ribosomal protein S12
 gi|226708493|sp|B7MCV7|RS12_ECO45 RecName: Full=30S ribosomal protein S12
 gi|226708494|sp|B5YTP9|RS12_ECO5E RecName: Full=30S ribosomal protein S12
 gi|226708495|sp|B7NLP7|RS12_ECO7I RecName: Full=30S ribosomal protein S12
 gi|226708496|sp|B7M1P3|RS12_ECO8A RecName: Full=30S ribosomal protein S12
 gi|226708497|sp|B7NDV0|RS12_ECOLU RecName: Full=30S ribosomal protein S12
 gi|226708498|sp|B6I242|RS12_ECOSE RecName: Full=30S ribosomal protein S12
 gi|226708499|sp|B1LHE2|RS12_ECOSM RecName: Full=30S ribosomal protein S12
 gi|226708502|sp|B7LS48|RS12_ESCF3 RecName: Full=30S ribosomal protein S12
 gi|226712643|sp|B5F8G0|RS12_SALA4 RecName: Full=30S ribosomal protein S12
 gi|226712644|sp|B5FJM2|RS12_SALDC RecName: Full=30S ribosomal protein S12
 gi|226712645|sp|B5R299|RS12_SALEP RecName: Full=30S ribosomal protein S12
 gi|226712646|sp|B5RH07|RS12_SALG2 RecName: Full=30S ribosomal protein S12
 gi|226712647|sp|B4TKM3|RS12_SALHS RecName: Full=30S ribosomal protein S12
 gi|226712648|sp|B4SUU8|RS12_SALNS RecName: Full=30S ribosomal protein S12
 gi|226712649|sp|B5BGZ4|RS12_SALPK RecName: Full=30S ribosomal protein S12
 gi|226712650|sp|B4TXF0|RS12_SALSV RecName: Full=30S ribosomal protein S12
 gi|226712653|sp|B2U2U9|RS12_SHIB3 RecName: Full=30S ribosomal protein S12
 gi|254811085|sp|B7UK52|RS12_ECO27 RecName: Full=30S ribosomal protein S12
 gi|254811086|sp|B7L4L7|RS12_ECO55 RecName: Full=30S ribosomal protein S12
 gi|254811087|sp|B7N1C3|RS12_ECO81 RecName: Full=30S ribosomal protein S12
 gi|254811104|sp|C0Q0C4|RS12_SALPC RecName: Full=30S ribosomal protein S12
 gi|25294699|pir||AI1004 30S ribosomal chain protein S12 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|116666559|pdb|1VS5|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|116666611|pdb|1VS7|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|256032355|pdb|3E1A|D Chain D, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Pre-Accommodation State
 gi|256032412|pdb|3E1C|D Chain D, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Post-Accommodation State
 gi|257097333|pdb|3I1M|L Chain L, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097385|pdb|3I1O|L Chain L, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097437|pdb|3I1Q|L Chain L, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097491|pdb|3I1S|L Chain L, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097545|pdb|3I1Z|L Chain L, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097600|pdb|3I21|L Chain L, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|290560318|pdb|3KC4|L Chain L, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
           Ribosomal Subnit. The 50s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kcr
 gi|308198698|pdb|3OR9|L Chain L, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The First
           70s Ribosome.
 gi|308198719|pdb|3ORA|L Chain L, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 gi|326634290|pdb|3IZV|P Chain P, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
           Ef-Tu
 gi|326634315|pdb|3IZW|P Chain P, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding.This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A Cognate
           Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
 gi|12517963|gb|AAG58449.1|AE005558_2 30S ribosomal subunit protein S12 [Escherichia coli O157:H7 str.
           EDL933]
 gi|43010|emb|CAA23648.1| unnamed protein product [Escherichia coli]
 gi|147892|gb|AAA50988.1| ribosomal protein S12 [Escherichia coli]
 gi|154357|gb|AAA27216.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Typhimurium]
 gi|208392|gb|AAA72526.1| ribosomal protein S12 [Cloning vector pHSG664]
 gi|606276|gb|AAA58139.1| 30S ribosomal subunit protein S12 [Escherichia coli str. K-12
           substr. MG1655]
 gi|1789740|gb|AAC76367.1| 30S ribosomal subunit protein S12 [Escherichia coli str. K-12
           substr. MG1655]
 gi|2501803|gb|AAC53716.1| small ribosomal protein [Cloning vector pAL-F]
 gi|11120597|gb|AAG30937.1| ribosomal protein S12 [Escherichia coli K-12]
 gi|13363666|dbj|BAB37616.1| 30S ribosomal subunit protein S12 [Escherichia coli O157:H7 str.
           Sakai]
 gi|16422005|gb|AAL22311.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16505141|emb|CAD08165.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139960|gb|AAO71524.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|30043634|gb|AAP19354.1| 30S ribosomal subunit protein S12 [Shigella flexneri 2a str. 2457T]
 gi|56129624|gb|AAV79130.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|56383865|gb|AAN44823.2| 30S ribosomal subunit protein S12 [Shigella flexneri 2a str. 301]
 gi|73857325|gb|AAZ90032.1| 30S ribosomal subunit protein S12 [Shigella sonnei Ss046]
 gi|81242771|gb|ABB63481.1| 30S ribosomal subunit protein S12 [Shigella dysenteriae Sd197]
 gi|81247103|gb|ABB67811.1| 30S ribosomal subunit protein S12 [Shigella boydii Sb227]
 gi|85676699|dbj|BAE77949.1| 30S ribosomal subunit protein S12 [Escherichia coli str. K12
           substr. W3110]
 gi|110616723|gb|ABF05390.1| 30S ribosomal subunit protein S12 [Shigella flexneri 5 str. 8401]
 gi|115514744|gb|ABJ02819.1| 30S ribosomal protein S12 [Escherichia coli APEC O1]
 gi|145320268|gb|ABP62415.1| SSU ribosomal protein S12P [Enterobacter sp. 638]
 gi|157068498|gb|ABV07753.1| ribosomal protein S12 [Escherichia coli HS]
 gi|157081246|gb|ABV20954.1| ribosomal protein S12 [Escherichia coli E24377A]
 gi|161936401|emb|CAP53906.1| rpsL protein [Cloning vector pBAC-RT]
 gi|169753350|gb|ACA76049.1| ribosomal protein S12 [Escherichia coli ATCC 8739]
 gi|170121612|gb|EDS90543.1| ribosomal protein S12 [Escherichia albertii TW07627]
 gi|170520964|gb|ACB19142.1| ribosomal protein S12 [Escherichia coli SMS-3-5]
 gi|171194008|gb|ACB45196.1| ribosomal protein L [Cloning vector pMQ118]
 gi|171194036|gb|ACB45219.1| ribosomal protein L [Cloning vector pMQ150]
 gi|187430619|gb|ACD09893.1| ribosomal protein S12 [Shigella boydii CDC 3083-94]
 gi|188487323|gb|EDU62426.1| ribosomal protein S12 [Escherichia coli 53638]
 gi|188998489|gb|EDU67481.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4076]
 gi|189359017|gb|EDU77436.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4401]
 gi|189361745|gb|EDU80164.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4486]
 gi|189374566|gb|EDU92982.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC869]
 gi|190908232|gb|EDV67823.1| ribosomal protein S12 [Escherichia coli F11]
 gi|194404279|gb|ACF64501.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194408612|gb|ACF68831.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194709852|gb|ACF89073.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197095774|emb|CAR61344.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197212525|gb|ACH49922.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197242943|gb|EDY25563.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197291291|gb|EDY30643.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197939027|gb|ACH76360.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199605519|gb|EDZ04064.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205274705|emb|CAR39761.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205333088|gb|EDZ19852.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205350362|gb|EDZ36993.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206710493|emb|CAR34851.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|208726358|gb|EDZ75959.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4206]
 gi|208734089|gb|EDZ82776.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4045]
 gi|208741552|gb|EDZ89234.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4042]
 gi|209157251|gb|ACI34684.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4115]
 gi|209756988|gb|ACI76806.1| 30S ribosomal subunit protein S12 [Escherichia coli]
 gi|209756990|gb|ACI76807.1| 30S ribosomal subunit protein S12 [Escherichia coli]
 gi|209756992|gb|ACI76808.1| 30S ribosomal subunit protein S12 [Escherichia coli]
 gi|209756994|gb|ACI76809.1| 30S ribosomal subunit protein S12 [Escherichia coli]
 gi|209756996|gb|ACI76810.1| 30S ribosomal subunit protein S12 [Escherichia coli]
 gi|209914053|dbj|BAG79127.1| 30S ribosomal protein S12 [Escherichia coli SE11]
 gi|215266700|emb|CAS11139.1| 30S ribosomal subunit protein S12 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217320620|gb|EEC29044.1| ribosomal protein S12 [Escherichia coli O157:H7 str. TW14588]
 gi|218353753|emb|CAV00054.1| 30S ribosomal subunit protein S12 [Escherichia coli 55989]
 gi|218358144|emb|CAQ90791.1| 30S ribosomal subunit protein S12 [Escherichia fergusonii ATCC
           35469]
 gi|218362654|emb|CAR00280.1| 30S ribosomal subunit protein S12 [Escherichia coli IAI1]
 gi|218367172|emb|CAR04946.1| 30S ribosomal subunit protein S12 [Escherichia coli S88]
 gi|218372076|emb|CAR19936.1| 30S ribosomal subunit protein S12 [Escherichia coli IAI39]
 gi|218429186|emb|CAR10141.2| 30S ribosomal subunit protein S12 [Escherichia coli ED1a]
 gi|218434033|emb|CAR14950.1| 30S ribosomal subunit protein S12 [Escherichia coli UMN026]
 gi|222035049|emb|CAP77794.1| 30S ribosomal protein S12 [Escherichia coli LF82]
 gi|224469771|gb|ACN47601.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|239937601|gb|ACS35607.1| RpsL [Allelic replacement vector pMQ236]
 gi|242378868|emb|CAQ33661.1| 30S ribosomal subunit protein S12, subunit of 30S ribosomal subunit
           and ribosome [Escherichia coli BL21(DE3)]
 gi|253322876|gb|ACT27478.1| ribosomal protein S12 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253979327|gb|ACT44997.1| 30S ribosomal protein S12 [Escherichia coli BL21(DE3)]
 gi|254594665|gb|ACT74026.1| 30S ribosomal subunit protein S12 [Escherichia coli O157:H7 str.
           TW14359]
 gi|257756098|dbj|BAI27600.1| 30S ribosomal subunit protein S12 [Escherichia coli O26:H11 str.
           11368]
 gi|257761273|dbj|BAI32770.1| 30S ribosomal subunit protein S12 [Escherichia coli O103:H2 str.
           12009]
 gi|257766426|dbj|BAI37921.1| 30S ribosomal subunit protein S12 [Escherichia coli O111:H- str.
           11128]
 gi|260218825|emb|CBA34180.1| 30S ribosomal protein S12 [Cronobacter turicensis z3032]
 gi|260447639|gb|ACX38061.1| ribosomal protein S12 [Escherichia coli DH1]
 gi|261248604|emb|CBG26442.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267995658|gb|ACY90543.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|281180378|dbj|BAI56708.1| 30S ribosomal protein S12 [Escherichia coli SE15]
 gi|281602692|gb|ADA75676.1| Ribosomal protein S12 [Shigella flexneri 2002017]
 gi|282951473|emb|CBG91172.1| 30S ribosomal subunit protein S12 [Citrobacter rodentium ICC168]
 gi|284923334|emb|CBG36428.1| 30S ribosomal subunit protein S12 [Escherichia coli 042]
 gi|288315742|gb|EFC54680.1| ribosomal protein S12 [Enterobacter cancerogenus ATCC 35316]
 gi|290764560|gb|ADD58521.1| Ribosomal protein S12 [Escherichia coli O55:H7 str. CB9615]
 gi|291425737|gb|EFE98771.1| rps12 [Escherichia coli FVEC1412]
 gi|294490098|gb|ADE88854.1| ribosomal protein S12 [Escherichia coli IHE3034]
 gi|295096968|emb|CBK86058.1| ribosomal protein S12, bacterial/organelle [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
 gi|298276502|gb|EFI18020.1| small subunit ribosomal protein S12 [Escherichia coli FVEC1302]
 gi|299880903|gb|EFI89114.1| ribosomal protein S12 [Escherichia coli MS 196-1]
 gi|300297840|gb|EFJ54225.1| ribosomal protein S12 [Escherichia coli MS 185-1]
 gi|300306323|gb|EFJ60843.1| ribosomal protein S12 [Escherichia coli MS 200-1]
 gi|300316300|gb|EFJ66084.1| ribosomal protein S12 [Escherichia coli MS 175-1]
 gi|300358432|gb|EFJ74302.1| ribosomal protein S12 [Escherichia coli MS 198-1]
 gi|300399122|gb|EFJ82660.1| ribosomal protein S12 [Escherichia coli MS 69-1]
 gi|300400735|gb|EFJ84273.1| ribosomal protein S12 [Escherichia coli MS 84-1]
 gi|300409471|gb|EFJ93009.1| ribosomal protein S12 [Escherichia coli MS 45-1]
 gi|300413527|gb|EFJ96837.1| ribosomal protein S12 [Escherichia coli MS 115-1]
 gi|300417030|gb|EFK00341.1| ribosomal protein S12 [Escherichia coli MS 182-1]
 gi|300453425|gb|EFK17045.1| ribosomal protein S12 [Escherichia coli MS 116-1]
 gi|300459525|gb|EFK23018.1| ribosomal protein S12 [Escherichia coli MS 21-1]
 gi|300461033|gb|EFK24526.1| ribosomal protein S12 [Escherichia coli MS 187-1]
 gi|300524635|gb|EFK45704.1| ribosomal protein S12 [Escherichia coli MS 119-7]
 gi|300532354|gb|EFK53416.1| ribosomal protein S12 [Escherichia coli MS 107-1]
 gi|300842376|gb|EFK70136.1| ribosomal protein S12 [Escherichia coli MS 124-1]
 gi|300844266|gb|EFK72026.1| ribosomal protein S12 [Escherichia coli MS 78-1]
 gi|301075980|gb|EFK90786.1| ribosomal protein S12 [Escherichia coli MS 146-1]
 gi|301159991|emb|CBW19510.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|305850711|gb|EFM51168.1| 30S ribosomal protein S12 [Escherichia coli NC101]
 gi|306908140|gb|EFN38640.1| ribosomal protein S12 [Escherichia coli W]
 gi|307555430|gb|ADN48205.1| 30S ribosomal subunit protein S12 [Escherichia coli ABU 83972]
 gi|307628406|gb|ADN72710.1| 30S ribosomal protein S12 [Escherichia coli UM146]
 gi|308746912|gb|ADO46664.1| ribosomal protein S12 [Enterobacter cloacae SCF1]
 gi|309703754|emb|CBJ03095.1| 30S ribosomal subunit protein S12 [Escherichia coli ETEC H10407]
 gi|310334773|gb|EFQ00978.1| ribosomal protein S12 [Escherichia coli 1827-70]
 gi|312287172|gb|EFR15082.1| ribosomal protein S12 [Escherichia coli 2362-75]
 gi|312914471|dbj|BAJ38445.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|312947894|gb|ADR28721.1| 30S ribosomal protein S12 [Escherichia coli O83:H1 str. NRG 857C]
 gi|313647362|gb|EFS11814.1| ribosomal protein S12 [Shigella flexneri 2a str. 2457T]
 gi|315062619|gb|ADT76946.1| 30S ribosomal subunit protein S12 [Escherichia coli W]
 gi|315137917|dbj|BAJ45076.1| 30S ribosomal protein S12 [Escherichia coli DH1]
 gi|315255926|gb|EFU35894.1| ribosomal protein S12 [Escherichia coli MS 85-1]
 gi|315285974|gb|EFU45412.1| ribosomal protein S12 [Escherichia coli MS 110-3]
 gi|315291601|gb|EFU50961.1| ribosomal protein S12 [Escherichia coli MS 153-1]
 gi|315295855|gb|EFU55168.1| ribosomal protein S12 [Escherichia coli MS 16-3]
 gi|315618960|gb|EFU99543.1| ribosomal protein S12 [Escherichia coli 3431]
 gi|320088574|emb|CBY98333.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|320172762|gb|EFW47996.1| 30S ribosomal protein S12 [Shigella dysenteriae CDC 74-1112]
 gi|320177983|gb|EFW52966.1| 30S ribosomal protein S12 [Shigella boydii ATCC 9905]
 gi|320184136|gb|EFW58954.1| 30S ribosomal protein S12 [Shigella flexneri CDC 796-83]
 gi|320191641|gb|EFW66291.1| 30S ribosomal protein S12 [Escherichia coli O157:H7 str. EC1212]
 gi|320199512|gb|EFW74102.1| 30S ribosomal protein S12 [Escherichia coli EC4100B]
 gi|320639633|gb|EFX09227.1| 30S ribosomal protein S12 [Escherichia coli O157:H7 str. G5101]
 gi|320645131|gb|EFX14147.1| 30S ribosomal protein S12 [Escherichia coli O157:H- str. 493-89]
 gi|320650442|gb|EFX18908.1| 30S ribosomal protein S12 [Escherichia coli O157:H- str. H 2687]
 gi|320655634|gb|EFX23557.1| 30S ribosomal protein S12 [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320661419|gb|EFX28834.1| 30S ribosomal protein S12 [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666441|gb|EFX33424.1| 30S ribosomal protein S12 [Escherichia coli O157:H7 str. LSU-61]
 gi|321226497|gb|EFX51547.1| SSU ribosomal protein S12p S23e [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322613918|gb|EFY10855.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617691|gb|EFY14589.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622175|gb|EFY19024.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626708|gb|EFY23508.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632329|gb|EFY29080.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322634994|gb|EFY31718.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643304|gb|EFY39871.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647755|gb|EFY44239.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650877|gb|EFY47266.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322654979|gb|EFY51294.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659484|gb|EFY55730.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322662503|gb|EFY58715.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322668549|gb|EFY64702.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671106|gb|EFY67235.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322678147|gb|EFY74208.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322679337|gb|EFY75386.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322688109|gb|EFY84074.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322716440|gb|EFZ08011.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323131807|gb|ADX19237.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323154167|gb|EFZ40370.1| ribosomal protein S12 [Escherichia coli EPECa14]
 gi|323162810|gb|EFZ48646.1| ribosomal protein S12 [Escherichia coli E128010]
 gi|323164896|gb|EFZ50687.1| ribosomal protein S12 [Shigella sonnei 53G]
 gi|323173965|gb|EFZ59593.1| ribosomal protein S12 [Escherichia coli LT-68]
 gi|323179136|gb|EFZ64710.1| ribosomal protein S12 [Escherichia coli 1180]
 gi|323182806|gb|EFZ68207.1| ribosomal protein S12 [Escherichia coli 1357]
 gi|323189067|gb|EFZ74351.1| ribosomal protein S12 [Escherichia coli RN587/1]
 gi|323193075|gb|EFZ78296.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323200240|gb|EFZ85324.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323204628|gb|EFZ89627.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323209330|gb|EFZ94264.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323210133|gb|EFZ95035.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215110|gb|EFZ99857.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221720|gb|EGA06131.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323225223|gb|EGA09462.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323228144|gb|EGA12275.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233589|gb|EGA17682.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323236949|gb|EGA21016.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323243836|gb|EGA27852.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249653|gb|EGA33563.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323254749|gb|EGA38556.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323257157|gb|EGA40861.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263468|gb|EGA46997.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323264497|gb|EGA48002.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323268475|gb|EGA51942.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|323376793|gb|ADX49061.1| ribosomal protein S12 [Escherichia coli KO11]
 gi|323934669|gb|EGB31069.1| ribosomal protein S12 [Escherichia coli E1520]
 gi|323939440|gb|EGB35651.1| ribosomal protein S12 [Escherichia coli E482]
 gi|323944432|gb|EGB40507.1| ribosomal protein S12 [Escherichia coli H120]
 gi|323950003|gb|EGB45886.1| ribosomal protein S12 [Escherichia coli H252]
 gi|323954716|gb|EGB50498.1| ribosomal protein S12 [Escherichia coli H263]
 gi|323959661|gb|EGB55313.1| ribosomal protein S12 [Escherichia coli H489]
 gi|323966157|gb|EGB61593.1| ribosomal protein S12 [Escherichia coli M863]
 gi|323969935|gb|EGB65210.1| ribosomal protein S12 [Escherichia coli TA007]
 gi|323974853|gb|EGB69965.1| ribosomal protein S12 [Escherichia coli TW10509]
 gi|324009476|gb|EGB78695.1| ribosomal protein S12 [Escherichia coli MS 57-2]
 gi|324015130|gb|EGB84349.1| ribosomal protein S12 [Escherichia coli MS 60-1]
 gi|324018772|gb|EGB87991.1| ribosomal protein S12 [Escherichia coli MS 117-3]
 gi|324111658|gb|EGC05638.1| ribosomal protein S12 [Escherichia fergusonii B253]
 gi|324116467|gb|EGC10386.1| ribosomal protein S12 [Escherichia coli E1167]
 gi|326344560|gb|EGD68309.1| 30S ribosomal protein S12 [Escherichia coli O157:H7 str. 1125]
 gi|326625191|gb|EGE31536.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326630071|gb|EGE36414.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|327250976|gb|EGE62669.1| ribosomal protein S12 [Escherichia coli STEC_7v]
 gi|330909385|gb|EGH37899.1| SSU ribosomal protein S12p (S23e) [Escherichia coli AA86]
 gi|331052849|gb|EGI24882.1| ribosomal protein S12 [Escherichia coli TA206]
 gi|331057452|gb|EGI29438.1| ribosomal protein S12 [Escherichia coli TA143]
 gi|331062220|gb|EGI34140.1| ribosomal protein S12 [Escherichia coli TA271]
 gi|331077356|gb|EGI48568.1| ribosomal protein S12 [Escherichia coli H299]
 gi|332085489|gb|EGI90655.1| ribosomal protein S12 [Shigella boydii 5216-82]
 gi|332085721|gb|EGI90885.1| ribosomal protein S12 [Shigella dysenteriae 155-74]
 gi|332090383|gb|EGI95481.1| ribosomal protein S12 [Shigella boydii 3594-74]
          Length = 124

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|229315906|ref|YP_002860132.1| ribosomal protein S12 [Micromonas sp. RCC299]
 gi|226431191|gb|ACO55596.1| ribosomal protein S12 [Micromonas sp. RCC299]
          Length = 129

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 103/128 (80%), Gaps = 7/128 (5%)

Query: 1   MPTVNQLI-----RKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIK 55
           MPT NQLI     R P+K   R   K  AL+G+PQKRGVCLRVYT TPKKPNSA+RK+ K
Sbjct: 1   MPTTNQLILGAQQRLPKK-RMRD-KKTPALQGSPQKRGVCLRVYTKTPKKPNSAIRKIAK 58

Query: 56  ARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQAR 115
            RL++  E+IAY+PGEGHNLQEHSVV++ GGRVKD+PGVKY+VIRGVLD QG+KNR Q R
Sbjct: 59  IRLSNNREIIAYIPGEGHNLQEHSVVLVRGGRVKDMPGVKYKVIRGVLDTQGLKNRHQGR 118

Query: 116 SRYGAERP 123
           S+YG ++P
Sbjct: 119 SKYGTKKP 126


>gi|161407968|ref|YP_001015772.2| 30S ribosomal protein S12 [Prochlorococcus marinus str. NATL1A]
 gi|156637361|sp|A2C4U8|RS12_PROM1 RecName: Full=30S ribosomal protein S12
          Length = 124

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  RK + +   K  ALRG P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRTERK-TLKTKTKSPALRGCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+ G GHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIGGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KSPK 123


>gi|114329770|ref|YP_740544.1| ribosomal protein S12 [Platanus occidentalis]
 gi|114329771|ref|YP_740589.1| ribosomal protein S12 [Platanus occidentalis]
 gi|122166012|sp|Q09G22|RR12_PLAOC RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|114054408|gb|ABI49802.1| ribosomal protein S12 [Platanus occidentalis]
 gi|114054409|gb|ABI49803.1| ribosomal protein S12 [Platanus occidentalis]
          Length = 123

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PVRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|34811523|pdb|1PN7|O Chain O, Coordinates Of S12, L11 Proteins And P-Trna, From The 70s
           X- Ray Structure Aligned To The 70s Cryo-Em Map Of
           E.Coli Ribosome
 gi|34811526|pdb|1PN8|O Chain O, Coordinates Of S12, L11 Proteins And E-Site Trna From 70s
           Crystal Structure Separately Fitted Into The Cryo-Em Map
           Of E.Coli 70s.Ef-G.Gdpnp Complex. The Atomic Coordinates
           Originally From The E-Site Trna Were Fitted In The
           Position Of The Hybrid PE-Site Trna.
 gi|34811540|pdb|1PNS|L Chain L, Crystal Structure Of A Streptomycin Dependent Ribosome
           From E. Coli, 30s Subunit Of 70s Ribosome. This File,
           1pns, Contains The 30s Subunit, Two Trnas, And One Mrna
           Molecule. The 50s Ribosomal Subunit Is In File 1pnu.
 gi|34811596|pdb|1PNX|L Chain L, Crystal Structure Of The Wild Type Ribosome From E. Coli,
           30s Subunit Of 70s Ribosome. This File, 1pnx, Contains
           Only Molecules Of The 30s Ribosomal Subunit. The 50s
           Subunit Is In The Pdb File 1pny.
 gi|56966334|pdb|1VOQ|L Chain L, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966387|pdb|1VOS|L Chain L, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966440|pdb|1VOV|L Chain L, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966493|pdb|1VOX|L Chain L, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966546|pdb|1VOZ|L Chain L, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|170292339|pdb|2R1G|H Chain H, Coordinates Of The Thermus Thermophilus 30s Components
           Neighboring Rbfa As Obtained By Fitting Into The Cryo-Em
           Map Of A 30s-Rbfa Complex
 gi|300508616|pdb|3MR8|L Chain L, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3mr8 Contains 30s Ribosomal Subunit. The 50s
           Ribosomal Subunit Can Be Found In Pdb Entry 3ms1.
           Molecule B In The Same Asymmetric Unit Is Deposited As
           3mrz (50s) And 3ms0 (30s).
 gi|300508671|pdb|3MS0|L Chain L, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3ms0 Contains 30s Ribosomal Subunit. The 50s
           Ribosomal Subunit Can Be Found In Pdb Entry 3mrz.
           Molecule A In The Same Asymmetric Unit Is Deposited As
           3mr8 (30s) And 3ms1 (50s).
 gi|322812561|pdb|3PYN|L Chain L, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 30s Subunit Of The First 70s Ribosome.
 gi|322812614|pdb|3PYQ|L Chain L, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 30s Subunit Of The Second 70s
           Ribosome.
 gi|322812667|pdb|3PYS|L Chain L, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 30s Subunit Of The First 70s Ribosome.
 gi|322812720|pdb|3PYU|L Chain L, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 30s Subunit Of The Second 70s Ribosome.
 gi|327200555|pdb|3IZZ|F Chain F, Models For Ribosome Components That Are Nearest Neighbors
           To The Bovine Mitochondrial Initiation Factor2 Bound To
           The E. Coli Ribosome
          Length = 124

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 102/123 (82%), Gaps = 1/123 (0%)

Query: 2   PTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSG 61
           PT+NQL+RK R+   R  +KV AL+G P +RGVC  V TVTPKKPNSALRKV K RLTSG
Sbjct: 1   PTINQLVRKGRE-KVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSG 59

Query: 62  VEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGAE 121
            EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGV DA GVK+RK++RS+YG +
Sbjct: 60  YEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTK 119

Query: 122 RPK 124
           +PK
Sbjct: 120 KPK 122


>gi|283794922|ref|YP_003359275.1| ribosomal protein S12 [Cryptomonas paramecium]
 gi|253981894|gb|ACT46811.1| ribosomal protein S12 [Cryptomonas paramecium]
          Length = 123

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLI   R    R   K +AL+G PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLISLERL-HVRKKTKSSALKGCPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHN+QEHSVV++ GGR KDLPGV+Y +IRG LDA GVKNRKQ+RS+YG+
Sbjct: 60  GFEVTAYIPGIGHNIQEHSVVLIRGGRTKDLPGVRYHIIRGTLDASGVKNRKQSRSKYGS 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|218437064|ref|YP_002375393.1| 30S ribosomal protein S12 [Cyanothece sp. PCC 7424]
 gi|226708484|sp|B7K837|RS12_CYAP7 RecName: Full=30S ribosomal protein S12
 gi|218169792|gb|ACK68525.1| ribosomal protein S12 [Cyanothece sp. PCC 7424]
          Length = 123

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R    +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRTER-SKVQKKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDA GVK+RKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDATGVKDRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|87122759|ref|ZP_01078633.1| 30S ribosomal protein S12 [Marinomonas sp. MED121]
 gi|86161987|gb|EAQ63278.1| 30S ribosomal protein S12 [Marinomonas sp. MED121]
          Length = 123

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK    A + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRKV-AKSDVPALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV+NRKQ RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVQNRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|315636343|ref|ZP_07891593.1| 30S ribosomal protein S12 [Arcobacter butzleri JV22]
 gi|315479432|gb|EFU70115.1| 30S ribosomal protein S12 [Arcobacter butzleri JV22]
          Length = 157

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK      +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 31  MPTINQLVRKERKKVIDK-SKSPALKKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTT 89

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV NR  +RS+YG 
Sbjct: 90  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNNRTVSRSKYGT 149

Query: 121 ERPK 124
           +RPK
Sbjct: 150 KRPK 153


>gi|227876224|ref|ZP_03994340.1| 30S ribosomal protein S12 [Mobiluncus mulieris ATCC 35243]
 gi|269976870|ref|ZP_06183844.1| ribosomal protein S12 [Mobiluncus mulieris 28-1]
 gi|306819499|ref|ZP_07453206.1| 30S ribosomal protein S12 [Mobiluncus mulieris ATCC 35239]
 gi|307701200|ref|ZP_07638222.1| ribosomal protein S12 [Mobiluncus mulieris FB024-16]
 gi|227843185|gb|EEJ53378.1| 30S ribosomal protein S12 [Mobiluncus mulieris ATCC 35243]
 gi|269934701|gb|EEZ91261.1| ribosomal protein S12 [Mobiluncus mulieris 28-1]
 gi|304647791|gb|EFM45109.1| 30S ribosomal protein S12 [Mobiluncus mulieris ATCC 35239]
 gi|307613594|gb|EFN92841.1| ribosomal protein S12 [Mobiluncus mulieris FB024-16]
          Length = 124

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+ K R  + R+ +K  AL G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIEQLVHKGR-STKRSKSKTPALVGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGV++RKQ RS+YGA
Sbjct: 60  GIEVSAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVRDRKQGRSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|157414773|ref|YP_001482029.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|172047076|sp|A8FKR5|RS12_CAMJ8 RecName: Full=30S ribosomal protein S12
 gi|157385737|gb|ABV52052.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|307747412|gb|ADN90682.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni M1]
 gi|315931079|gb|EFV10053.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 327]
          Length = 128

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK      +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLVRKERKKVLEK-SKSPALKNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV  R  +RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|318042650|ref|ZP_07974606.1| 30S ribosomal protein S12 [Synechococcus sp. CB0101]
          Length = 124

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALR  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSERQRLTRK-TKSPALRACPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KTPK 123


>gi|215400747|ref|YP_002327508.1| ribosomal protein S12 [Vaucheria litorea]
 gi|194441197|gb|ACF70925.1| ribosomal protein S12 [Vaucheria litorea]
          Length = 126

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR PR+  +R  +K  AL+  PQ+RGVC RVYT TPKKPNSA+RKV + RLTS
Sbjct: 1   MPTIQQLIRSPRQKIYRR-SKSPALKNCPQRRGVCTRVYTTTPKKPNSAIRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD+  VKNR Q RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDSASVKNRLQGRSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|307720241|ref|YP_003891381.1| 30S ribosomal protein S12P [Sulfurimonas autotrophica DSM 16294]
 gi|306978334|gb|ADN08369.1| SSU ribosomal protein S12P [Sulfurimonas autotrophica DSM 16294]
          Length = 124

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK   +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLIRKERKRVIKK-SKSPALDSCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGR+KDLPGVKY ++RG LD  GV NR  ARS+YG 
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRIKDLPGVKYHIVRGALDTAGVANRTVARSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|288942077|ref|YP_003444317.1| 30S ribosomal protein S12 [Allochromatium vinosum DSM 180]
 gi|288897449|gb|ADC63285.1| ribosomal protein S12 [Allochromatium vinosum DSM 180]
          Length = 124

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK +  A   V AL   PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRNV-AKTNVPALEACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV+ R+QARS+YGA
Sbjct: 60  GYEVASYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTSGVEKRRQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|224510691|pdb|3FIC|L Chain L, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas
           And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A
           6.4 A Cryo-Em Map. This File Contains The 30s Subunit
           And The Ligands
          Length = 125

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 102/123 (82%), Gaps = 1/123 (0%)

Query: 2   PTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSG 61
           PT+NQL+RK R+   R  +KV AL+G P +RGVC  V TVTPKKPNSALRKV K RLTSG
Sbjct: 1   PTINQLVRKGRE-KVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSG 59

Query: 62  VEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGAE 121
            EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGV DA GVK+RK++RS+YG +
Sbjct: 60  YEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTK 119

Query: 122 RPK 124
           +PK
Sbjct: 120 KPK 122


>gi|253729537|ref|YP_003029720.1| ribosomal protein S12 [Bambusa oldhamii]
 gi|255961362|ref|YP_003097555.1| ribosomal protein S12 [Dendrocalamus latiflorus]
 gi|246367047|gb|ACS94658.1| ribosomal protein S12 [Bambusa oldhamii]
 gi|255040239|gb|ACT99899.1| ribosomal protein S12 [Dendrocalamus latiflorus]
          Length = 124

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTV QLIR  R+   R   K  AL+G PQ+RG C RVYT+ PKKPNSALRKV + RLTS
Sbjct: 1   MPTVKQLIRNARQ-PIRNARKSAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+YR+IRG LDA  VKNR+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDAVAVKNRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|221194455|ref|ZP_03567512.1| ribosomal protein S12 [Atopobium rimae ATCC 49626]
 gi|221185359|gb|EEE17749.1| ribosomal protein S12 [Atopobium rimae ATCC 49626]
          Length = 123

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R  S +A +K  AL+ NPQKRGVC RV+T TPKKPNSALRKV + RL +
Sbjct: 1   MPTINQLVRKGRM-SVQAKSKNAALQHNPQKRGVCTRVFTTTPKKPNSALRKVARVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y+V+RG  D   V+NR +ARSRYG 
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVRDLPGVRYKVVRGAYDCAAVQNRAKARSRYGT 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|329897165|ref|ZP_08271906.1| SSU ribosomal protein S12p (S23e) [gamma proteobacterium IMCC3088]
 gi|328921382|gb|EGG28775.1| SSU ribosomal protein S12p (S23e) [gamma proteobacterium IMCC3088]
          Length = 124

 Score =  168 bits (425), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK      + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRKV-VKSDVPALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV NRKQARS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVANRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|123961725|gb|ABM76508.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. NATL1A]
          Length = 136

 Score =  168 bits (425), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  RK + +   K  ALRG P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 13  MPTIQQLIRTERK-TLKTKTKSPALRGCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 71

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+ G GHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD  GVK+R+Q+RS+YGA
Sbjct: 72  GFEVTAYIGGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGTLDTAGVKDRRQSRSKYGA 131

Query: 121 ERPK 124
           + PK
Sbjct: 132 KSPK 135


>gi|323149106|ref|YP_004222625.1| ribosomal protein S12 [Anthriscus cerefolium]
 gi|289645599|gb|ADD13662.1| ribosomal protein S12 [Anthriscus cerefolium]
          Length = 123

 Score =  168 bits (425), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRK R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRKTRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|11466871|ref|NP_039359.1| ribosomal protein S12 [Oryza sativa Japonica Group]
 gi|50234025|ref|YP_052725.1| ribosomal protein S12 [Oryza nivara]
 gi|59561393|ref|YP_203383.1| ribosomal protein S12 [Oryza nivara]
 gi|59593535|ref|NP_039457.2| ribosomal protein S12 [Oryza sativa Japonica Group]
 gi|133748|sp|P12149|RR12_ORYSJ RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|68053135|sp|Q6ENC0|RR12_ORYNI RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|148839648|sp|P0C461|RR12_ORYSI RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|148897902|sp|P0C460|RR12_ORYSA RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|1213603|emb|CAA33929.1| ribosomal protein S12 [Oryza sativa Japonica Group]
 gi|49615049|dbj|BAD26832.1| ribosomal protein S12 [Oryza nivara]
 gi|226658|prf||1603356CJ ribosomal protein S12
          Length = 124

 Score =  168 bits (425), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTV QLIR  R+   R   K  AL+G PQ+RG C RVYT+ PKKPNSALRKV + RLTS
Sbjct: 1   MPTVKQLIRNARQ-PIRNARKSAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+YR+IRG LDA  VKNR+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGALDAVAVKNRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|68171387|ref|ZP_00544780.1| Ribosomal protein S12, bacterial and chloroplast form [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88657872|ref|YP_507750.1| 30S ribosomal protein S12 [Ehrlichia chaffeensis str. Arkansas]
 gi|123736378|sp|Q2GFN3|RS12_EHRCR RecName: Full=30S ribosomal protein S12
 gi|67999182|gb|EAM85839.1| Ribosomal protein S12, bacterial and chloroplast form [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88599329|gb|ABD44798.1| ribosomal protein S12 [Ehrlichia chaffeensis str. Arkansas]
          Length = 123

 Score =  168 bits (425), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/123 (65%), Positives = 103/123 (83%), Gaps = 2/123 (1%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RKPRK S  +  K  AL+ NPQKR VC++VYT TPKKPNSALRKV + ++  
Sbjct: 1   MPTINQLVRKPRK-SRSSLNKAPALQHNPQKRAVCVKVYTTTPKKPNSALRKVARVKIAG 59

Query: 61  -GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
            G EVIAY+PGEGHNLQEHSV+++ GGRVKDLPGV+Y +IRG LD++GV+NRK+ARS+YG
Sbjct: 60  YGSEVIAYIPGEGHNLQEHSVILIRGGRVKDLPGVRYHIIRGALDSRGVQNRKKARSKYG 119

Query: 120 AER 122
            ++
Sbjct: 120 VKK 122


>gi|57237543|ref|YP_178557.1| 30S ribosomal protein S12 [Campylobacter jejuni RM1221]
 gi|86149000|ref|ZP_01067232.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|86151580|ref|ZP_01069794.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 260.94]
 gi|86153738|ref|ZP_01071941.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|88596896|ref|ZP_01100132.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 84-25]
 gi|121613664|ref|YP_001000187.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|148925867|ref|ZP_01809554.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|153952294|ref|YP_001398477.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. doylei
           269.97]
 gi|167005144|ref|ZP_02270902.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 81-176]
 gi|205355353|ref|ZP_03222124.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|218562146|ref|YP_002343925.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|283954229|ref|ZP_06371753.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 414]
 gi|283955913|ref|ZP_06373403.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 1336]
 gi|305433045|ref|ZP_07402201.1| 30S ribosomal protein S12 [Campylobacter coli JV20]
 gi|14423924|sp|Q9PI18|RS12_CAMJE RecName: Full=30S ribosomal protein S12
 gi|62287356|sp|Q5HVX8|RS12_CAMJR RecName: Full=30S ribosomal protein S12
 gi|158513883|sp|A1VYJ6|RS12_CAMJJ RecName: Full=30S ribosomal protein S12
 gi|166231855|sp|A7H4P7|RS12_CAMJD RecName: Full=30S ribosomal protein S12
 gi|57166347|gb|AAW35126.1| ribosomal protein S12 [Campylobacter jejuni RM1221]
 gi|85840358|gb|EAQ57615.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85841209|gb|EAQ58457.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 260.94]
 gi|85842699|gb|EAQ59911.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|87250243|gb|EAQ73201.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 81-176]
 gi|88190585|gb|EAQ94558.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112359852|emb|CAL34639.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|145844853|gb|EDK21957.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|152939740|gb|ABS44481.1| ribosomal protein S12 [Campylobacter jejuni subsp. doylei 269.97]
 gi|205346587|gb|EDZ33219.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|283792573|gb|EFC31352.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 1336]
 gi|283794247|gb|EFC32992.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 414]
 gi|284925759|gb|ADC28111.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni
           IA3902]
 gi|304443746|gb|EFM36403.1| 30S ribosomal protein S12 [Campylobacter coli JV20]
 gi|315057910|gb|ADT72239.1| SSU ribosomal protein S12p (S23e) [Campylobacter jejuni subsp.
           jejuni S3]
 gi|315930847|gb|EFV09838.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 305]
          Length = 128

 Score =  168 bits (425), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK      +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLVRKERKKVLEK-SKSPALKNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV  R  +RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|323140685|ref|ZP_08075606.1| ribosomal protein S12 [Phascolarctobacterium sp. YIT 12067]
 gi|322414809|gb|EFY05607.1| ribosomal protein S12 [Phascolarctobacterium sp. YIT 12067]
          Length = 126

 Score =  168 bits (425), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   ++ +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRE-VLKSKSTAPALKECPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV NR Q+RS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVANRNQSRSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRAK 123


>gi|308047975|ref|YP_003911541.1| 30S ribosomal protein S12P [Ferrimonas balearica DSM 9799]
 gi|307630165|gb|ADN74467.1| SSU ribosomal protein S12P [Ferrimonas balearica DSM 9799]
          Length = 124

 Score =  168 bits (425), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPRK   +    V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRKDKVKK-TNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +R+Q RS+YGA
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDTAGVNDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|109896928|ref|YP_660183.1| 30S ribosomal protein S12 [Pseudoalteromonas atlantica T6c]
 gi|119366791|sp|Q15YA9|RS12_PSEA6 RecName: Full=30S ribosomal protein S12
 gi|109699209|gb|ABG39129.1| SSU ribosomal protein S12P [Pseudoalteromonas atlantica T6c]
 gi|332172381|gb|AEE21635.1| ribosomal protein S12 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 124

 Score =  168 bits (425), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR+    A + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRQKP-DAKSNVAALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RKQARS+YGA
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDCAGVSSRKQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|289523374|ref|ZP_06440228.1| ribosomal protein S12 [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503066|gb|EFD24230.1| ribosomal protein S12 [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 123

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQLIR+ RK   +      AL+GNPQKRGVC RVYTVTPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLIRQGRKEKKKRSG-APALQGNPQKRGVCTRVYTVTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV+NR+Q RS+YG 
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDCGGVENRRQGRSKYGV 119

Query: 121 ERPK 124
            +PK
Sbjct: 120 RKPK 123


>gi|304391041|ref|ZP_07372993.1| 30S ribosomal protein S12 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315656183|ref|ZP_07909074.1| 30S ribosomal protein S12 [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
 gi|304325924|gb|EFL93170.1| 30S ribosomal protein S12 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315493185|gb|EFU82785.1| 30S ribosomal protein S12 [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
          Length = 124

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+ + R  S R  +K  AL G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 1   MPTIEQLVHQGRT-SKRTKSKTPALAGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGV++RKQ RS+YGA
Sbjct: 60  GIEVSAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVRDRKQGRSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|307152005|ref|YP_003887389.1| 30S ribosomal protein S12 [Cyanothece sp. PCC 7822]
 gi|306982233|gb|ADN14114.1| ribosomal protein S12 [Cyanothece sp. PCC 7822]
          Length = 123

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R    +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSER-SQIQKKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD+ GVK+RKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDSTGVKDRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|167626810|ref|YP_001677310.1| 30S ribosomal protein S12 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|241667391|ref|ZP_04754969.1| 30S ribosomal protein S12 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254875940|ref|ZP_05248650.1| 30S ribosomal protein S12 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|189040460|sp|B0U0Z3|RS12_FRAP2 RecName: Full=30S ribosomal protein S12
 gi|167596811|gb|ABZ86809.1| 30S ribosomal protein S12 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|254841961|gb|EET20375.1| 30S ribosomal protein S12 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 124

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+  PRK S    +KV AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MATINQLVNSPRKRSV-VKSKVPALKACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV NRK  RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTSGVNNRKHGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|310829723|ref|YP_003962080.1| hypothetical protein ELI_4175 [Eubacterium limosum KIST612]
 gi|308741457|gb|ADO39117.1| hypothetical protein ELI_4175 [Eubacterium limosum KIST612]
          Length = 124

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+++ RK S     K  AL+ NPQKRGVC  V T TPKKPNSALRK+ + +L +
Sbjct: 1   MPTINQLVKQGRK-SAEIKTKTPALKANPQKRGVCTAVRTSTPKKPNSALRKIARVKLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD  GV+NRKQARS+YGA
Sbjct: 60  GMEVTAYIPGIGHNLQEHSIVLVKGGRVKDLPGVRYKIIRGALDTAGVENRKQARSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|118496848|ref|YP_897898.1| 30S ribosomal protein S12 [Francisella tularensis subsp. novicida
           U112]
 gi|194324468|ref|ZP_03058240.1| ribosomal protein S12 [Francisella tularensis subsp. novicida FTE]
 gi|208780535|ref|ZP_03247874.1| ribosomal protein S12 [Francisella novicida FTG]
 gi|254372212|ref|ZP_04987704.1| 30S ribosomal protein S12 [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254373695|ref|ZP_04989179.1| 30S ribosomal protein S12 [Francisella novicida GA99-3548]
 gi|158512416|sp|A0Q4H9|RS12_FRATN RecName: Full=30S ribosomal protein S12
 gi|118422754|gb|ABK89144.1| 30S ribosomal protein S12 [Francisella novicida U112]
 gi|151569942|gb|EDN35596.1| 30S ribosomal protein S12 [Francisella novicida GA99-3549]
 gi|151571417|gb|EDN37071.1| 30S ribosomal protein S12 [Francisella novicida GA99-3548]
 gi|194321303|gb|EDX18789.1| ribosomal protein S12 [Francisella tularensis subsp. novicida FTE]
 gi|208743510|gb|EDZ89815.1| ribosomal protein S12 [Francisella novicida FTG]
 gi|328675403|gb|AEB28078.1| SSU ribosomal protein S12p (S23e) [Francisella cf. novicida 3523]
 gi|328676317|gb|AEB27187.1| SSU ribosomal protein S12p (S23e) [Francisella cf. novicida Fx1]
          Length = 124

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+  PRK S    +KV AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MATINQLVNNPRKRSV-VKSKVPALKACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV NRK  RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTSGVNNRKHGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|237728662|ref|ZP_04559143.1| 30S ribosomal subunit protein S12 [Citrobacter sp. 30_2]
 gi|226909284|gb|EEH95202.1| 30S ribosomal subunit protein S12 [Citrobacter sp. 30_2]
          Length = 144

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 21  MATVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 79

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YG 
Sbjct: 80  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGV 139

Query: 121 ERPK 124
           +RPK
Sbjct: 140 KRPK 143


>gi|323148928|ref|YP_004222483.1| ribosomal protein S12 [Smilax china]
 gi|323148929|ref|YP_004222440.1| ribosomal protein S12 [Smilax china]
 gi|308742619|gb|ADO33470.1| ribosomal protein S12 [Smilax china]
 gi|308742620|gb|ADO33471.1| ribosomal protein S12 [Smilax china]
          Length = 123

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVRKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|325972665|ref|YP_004248856.1| ribosomal protein S12 [Spirochaeta sp. Buddy]
 gi|324027903|gb|ADY14662.1| ribosomal protein S12 [Spirochaeta sp. Buddy]
          Length = 124

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R  S R   K  AL G PQKRGVC RV TVTPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLIRKGRT-SVRNKTKSPALEGCPQKRGVCTRVMTVTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV+L GGRVKDLPGV+Y ++RG  D  GV +RK++RS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGAKDTLGVADRKRSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|210623172|ref|ZP_03293622.1| hypothetical protein CLOHIR_01572 [Clostridium hiranonis DSM 13275]
 gi|210153785|gb|EEA84791.1| hypothetical protein CLOHIR_01572 [Clostridium hiranonis DSM 13275]
          Length = 155

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 100/136 (73%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKG------------SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT+NQL+RK RK              + +  K T    +PQKRGVC  V TVTPKKPNS
Sbjct: 17  MPTINQLVRKSRKDILKKSTAPALQKGYNSLNKKTTDASSPQKRGVCTSVKTVTPKKPNS 76

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRKV + RLT+G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV
Sbjct: 77  ALRKVARVRLTNGIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGTLDTAGV 136

Query: 109 KNRKQARSRYGAERPK 124
             R+Q+RS+YGA+RPK
Sbjct: 137 DKRRQSRSKYGAKRPK 152


>gi|15605611|ref|NP_219951.1| 30S ribosomal protein S12 [Chlamydia trachomatis D/UW-3/CX]
 gi|15835338|ref|NP_297097.1| 30S ribosomal protein S12 [Chlamydia muridarum Nigg]
 gi|162019864|ref|YP_328259.2| 30S ribosomal protein S12 [Chlamydia trachomatis A/HAR-13]
 gi|255311248|ref|ZP_05353818.1| 30S ribosomal protein S12 [Chlamydia trachomatis 6276]
 gi|255317550|ref|ZP_05358796.1| 30S ribosomal protein S12 [Chlamydia trachomatis 6276s]
 gi|255348807|ref|ZP_05380814.1| 30S ribosomal protein S12 [Chlamydia trachomatis 70]
 gi|255503347|ref|ZP_05381737.1| 30S ribosomal protein S12 [Chlamydia trachomatis 70s]
 gi|255507026|ref|ZP_05382665.1| 30S ribosomal protein S12 [Chlamydia trachomatis D(s)2923]
 gi|270285509|ref|ZP_06194903.1| SSU ribosomal protein S12P [Chlamydia muridarum Nigg]
 gi|270289520|ref|ZP_06195822.1| SSU ribosomal protein S12P [Chlamydia muridarum Weiss]
 gi|301335920|ref|ZP_07224164.1| 30S ribosomal protein S12 [Chlamydia trachomatis L2tet1]
 gi|301336906|ref|ZP_07225108.1| 30S ribosomal protein S12 [Chlamydia muridarum MopnTet14]
 gi|54039342|sp|P66371|RS12_CHLMU RecName: Full=30S ribosomal protein S12
 gi|54042115|sp|P66370|RS12_CHLTR RecName: Full=30S ribosomal protein S12
 gi|90111774|sp|Q3KLR1|RS12_CHLTA RecName: Full=30S ribosomal protein S12
 gi|8163302|gb|AAF73598.1| ribosomal protein S12 [Chlamydia muridarum Nigg]
 gi|296435036|gb|ADH17214.1| 30S ribosomal protein S12 [Chlamydia trachomatis E/150]
 gi|296435963|gb|ADH18137.1| 30S ribosomal protein S12 [Chlamydia trachomatis G/9768]
 gi|296436890|gb|ADH19060.1| 30S ribosomal protein S12 [Chlamydia trachomatis G/11222]
 gi|296437824|gb|ADH19985.1| 30S ribosomal protein S12 [Chlamydia trachomatis G/11074]
 gi|296438756|gb|ADH20909.1| 30S ribosomal protein S12 [Chlamydia trachomatis E/11023]
 gi|297140324|gb|ADH97082.1| 30S ribosomal protein S12 [Chlamydia trachomatis G/9301]
          Length = 123

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/125 (68%), Positives = 103/125 (82%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRK-GSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT+NQLIRK R+ G+ R   K  AL+ +PQKRGVCL+V T TPKKPNSALRKV   RL+
Sbjct: 1   MPTINQLIRKKRQSGATRK--KSPALQKSPQKRGVCLQVKTKTPKKPNSALRKVAWVRLS 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G EVIAY+ GEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD   VKNRKQ+RSRYG
Sbjct: 59  NGQEVIAYIGGEGHNLQEHSIVLVQGGRVKDLPGVRYHIVRGALDCAAVKNRKQSRSRYG 118

Query: 120 AERPK 124
           A+RPK
Sbjct: 119 AKRPK 123


>gi|166154652|ref|YP_001654770.1| 30S ribosomal protein S12 [Chlamydia trachomatis 434/Bu]
 gi|166155527|ref|YP_001653782.1| 30S ribosomal protein S12 [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|237802866|ref|YP_002888060.1| 30S ribosomal protein S12 [Chlamydia trachomatis B/Jali20/OT]
 gi|237804788|ref|YP_002888942.1| 30S ribosomal protein S12 [Chlamydia trachomatis B/TZ1A828/OT]
 gi|6578105|gb|AAC68038.2| S12 Ribosomal Protein [Chlamydia trachomatis D/UW-3/CX]
 gi|76167703|gb|AAX50711.1| SSU ribosomal protein S12P [Chlamydia trachomatis A/HAR-13]
 gi|165930640|emb|CAP04137.1| SSU ribosomal protein S12P [Chlamydia trachomatis 434/Bu]
 gi|165931515|emb|CAP07091.1| SSU ribosomal protein S12P [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|231273088|emb|CAX10001.1| SSU ribosomal protein S12P [Chlamydia trachomatis B/TZ1A828/OT]
 gi|231274100|emb|CAX10894.1| SSU ribosomal protein S12P [Chlamydia trachomatis B/Jali20/OT]
 gi|289525483|emb|CBJ14960.1| SSU ribosomal protein S12P [Chlamydia trachomatis Sweden2]
 gi|297748569|gb|ADI51115.1| SSU ribosomal protein S12P [Chlamydia trachomatis D-EC]
 gi|297749449|gb|ADI52127.1| SSU ribosomal protein S12P [Chlamydia trachomatis D-LC]
          Length = 129

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/125 (68%), Positives = 103/125 (82%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRK-GSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT+NQLIRK R+ G+ R   K  AL+ +PQKRGVCL+V T TPKKPNSALRKV   RL+
Sbjct: 7   MPTINQLIRKKRQSGATRK--KSPALQKSPQKRGVCLQVKTKTPKKPNSALRKVAWVRLS 64

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G EVIAY+ GEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD   VKNRKQ+RSRYG
Sbjct: 65  NGQEVIAYIGGEGHNLQEHSIVLVQGGRVKDLPGVRYHIVRGALDCAAVKNRKQSRSRYG 124

Query: 120 AERPK 124
           A+RPK
Sbjct: 125 AKRPK 129


>gi|152972235|ref|YP_001337381.1| 30S ribosomal protein S12 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|206576337|ref|YP_002236272.1| ribosomal protein S12 [Klebsiella pneumoniae 342]
 gi|238896824|ref|YP_002921569.1| 30S ribosomal protein S12 [Klebsiella pneumoniae NTUH-K2044]
 gi|262045187|ref|ZP_06018213.1| 30S ribosomal protein S12 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288933258|ref|YP_003437317.1| ribosomal protein S12 [Klebsiella variicola At-22]
 gi|290512062|ref|ZP_06551430.1| 30S ribosomal protein S12 [Klebsiella sp. 1_1_55]
 gi|329999009|ref|ZP_08303284.1| ribosomal protein S12 [Klebsiella sp. MS 92-3]
 gi|166231866|sp|A6TEY0|RS12_KLEP7 RecName: Full=30S ribosomal protein S12
 gi|226708514|sp|B5XN85|RS12_KLEP3 RecName: Full=30S ribosomal protein S12
 gi|150957084|gb|ABR79114.1| 30S ribosomal protein S12 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|206565395|gb|ACI07171.1| ribosomal protein S12 [Klebsiella pneumoniae 342]
 gi|238549151|dbj|BAH65502.1| 30S ribosomal protein S12 [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259037397|gb|EEW38642.1| 30S ribosomal protein S12 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288887987|gb|ADC56305.1| ribosomal protein S12 [Klebsiella variicola At-22]
 gi|289775852|gb|EFD83852.1| 30S ribosomal protein S12 [Klebsiella sp. 1_1_55]
 gi|328538488|gb|EGF64602.1| ribosomal protein S12 [Klebsiella sp. MS 92-3]
          Length = 124

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|72382915|ref|YP_292270.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. NATL2A]
 gi|90111791|sp|Q46IW1|RS12_PROMT RecName: Full=30S ribosomal protein S12
 gi|72002765|gb|AAZ58567.1| SSU ribosomal protein S12P [Prochlorococcus marinus str. NATL2A]
          Length = 124

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  RK + +   K  ALRG P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRTERK-TLKTKTKSPALRGCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+ G GHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIGGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGSLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KSPK 123


>gi|154148589|ref|YP_001407179.1| 30S ribosomal protein S12 [Campylobacter hominis ATCC BAA-381]
 gi|166231854|sp|A7I3T8|RS12_CAMHC RecName: Full=30S ribosomal protein S12
 gi|153804598|gb|ABS51605.1| ribosomal protein S12 [Campylobacter hominis ATCC BAA-381]
          Length = 124

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK      +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLVRKERKKIIEK-SKSPALKNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV  R  +RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|94987384|ref|YP_595317.1| 30S ribosomal protein S12 [Lawsonia intracellularis PHE/MN1-00]
 gi|119366782|sp|Q1MPT1|RS12_LAWIP RecName: Full=30S ribosomal protein S12
 gi|94731633|emb|CAJ54996.1| 30S ribosomal protein S12 [Lawsonia intracellularis PHE/MN1-00]
          Length = 123

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR   +       K  AL+G PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRH-ERKKVVKRKKTPALQGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV++R+Q RS+YGA
Sbjct: 60  GLEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTSGVQDRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|266808599|gb|ACY78419.1| RpsL [T-vector pRNT4]
          Length = 124

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 99/126 (78%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAK--VTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           M TVNQL+RKPR    R  AK  V AL   PQKRGVC RVYT TPKKPNSALRKV + RL
Sbjct: 1   MATVNQLVRKPR---VRKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           T+G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+Y
Sbjct: 58  TNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKY 117

Query: 119 GAERPK 124
           G +RPK
Sbjct: 118 GVKRPK 123


>gi|92112549|ref|YP_572477.1| 30S ribosomal protein S12 [Chromohalobacter salexigens DSM 3043]
 gi|119366761|sp|Q1R0I0|RS12_CHRSD RecName: Full=30S ribosomal protein S12
 gi|91795639|gb|ABE57778.1| SSU ribosomal protein S12P [Chromohalobacter salexigens DSM 3043]
          Length = 124

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK    A + V AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRPV-AKSDVPALQSCPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV+NR+Q RS+YG 
Sbjct: 60  GYEVASYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDTSGVQNRRQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|254282671|ref|ZP_04957639.1| ribosomal protein S12 [gamma proteobacterium NOR51-B]
 gi|219678874|gb|EED35223.1| ribosomal protein S12 [gamma proteobacterium NOR51-B]
          Length = 123

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK    A + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRKV-AASDVKALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +R+Q RS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVSDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|254495337|ref|ZP_05108261.1| 30S ribosomal protein S12 [Polaribacter sp. MED152]
 gi|85819691|gb|EAQ40848.1| 30S ribosomal protein S12 [Polaribacter sp. MED152]
          Length = 124

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R       +K  AL+G+PQ+RGVC RVYT TPKKPNSA+RKV + RLT+
Sbjct: 1   MPTIQQLVRKGRT-KITKKSKSAALQGSPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PGEGHNLQEHS+V++ GGRVKDLPGVKY V+RG LD  GV+ R Q RS+YGA
Sbjct: 60  GNEINAYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHVVRGALDTAGVEGRTQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|326200304|gb|ADZ52343.1| ribosomal protein S12 [Asclepias syriaca]
 gi|326200337|gb|ADZ52376.1| ribosomal protein S12 [Asclepias syriaca]
          Length = 126

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNRTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|257125031|ref|YP_003163145.1| 30S ribosomal protein S12 [Leptotrichia buccalis C-1013-b]
 gi|260891602|ref|ZP_05902865.1| ribosomal protein S12 [Leptotrichia hofstadii F0254]
 gi|257048970|gb|ACV38154.1| ribosomal protein S12 [Leptotrichia buccalis C-1013-b]
 gi|260858612|gb|EEX73112.1| ribosomal protein S12 [Leptotrichia hofstadii F0254]
          Length = 122

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 99/122 (81%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  R  + +   K  AL+GNPQKRGVC+RVYT TPKKPNSALRKV + +L +
Sbjct: 1   MPTINQLVRFGRSTTEKK-KKSPALKGNPQKRGVCVRVYTTTPKKPNSALRKVARVKLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V+L GGR KDLPGV+Y++IRG LD  GV NRKQ RSRYGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSIVLLRGGRTKDLPGVRYKIIRGALDTAGVVNRKQGRSRYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|159904175|ref|YP_001551519.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9211]
 gi|226712634|sp|A9BCK3|RS12_PROM4 RecName: Full=30S ribosomal protein S12
 gi|159889351|gb|ABX09565.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9211]
          Length = 123

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 85/124 (68%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  RK   R   K  ALR  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRTERKRLTRK-TKSPALRSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV+L GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KVPK 123


>gi|257460964|ref|ZP_05626064.1| 30S ribosomal protein S12 [Campylobacter gracilis RM3268]
 gi|257441627|gb|EEV16770.1| 30S ribosomal protein S12 [Campylobacter gracilis RM3268]
          Length = 124

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK      +K  AL+  PQ+RGVC +VYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLVRKERK-KITEKSKSPALKNCPQRRGVCTKVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV  R  ARS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|114804287|ref|YP_762285.1| ribosomal protein S12 [Morus indica]
 gi|114804288|ref|YP_762240.1| ribosomal protein S12 [Morus indica]
 gi|115604981|ref|YP_784365.1| ribosomal protein S12 [Drimys granadensis]
 gi|115604994|ref|YP_784410.1| ribosomal protein S12 [Drimys granadensis]
 gi|122894014|ref|YP_001004165.1| ribosomal protein S12 [Ranunculus macranthus]
 gi|122894052|ref|YP_001004210.1| ribosomal protein S12 [Ranunculus macranthus]
 gi|122164417|sp|Q06GX3|RR12_DRIGR RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|122166781|sp|Q09WZ3|RR12_MORIN RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|158514027|sp|A1XGL7|RR12_RANMC RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|78100339|gb|ABB20980.1| ribosomal protein S12 [Morus indica]
 gi|78100340|gb|ABB20981.1| ribosomal protein S12 [Morus indica]
 gi|85540828|gb|ABC70780.1| ribosomal protein S12 [Ranunculus macranthus]
 gi|85540866|gb|ABC70818.1| ribosomal protein S12 [Ranunculus macranthus]
 gi|112032709|gb|ABH88344.1| ribosomal protein S12 [Drimys granadensis]
 gi|112032722|gb|ABH88357.1| ribosomal protein S12 [Drimys granadensis]
 gi|290487460|gb|ADD30114.1| ribosomal protein S12 [Ficus sp. Moore 315]
          Length = 123

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   +   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIKNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|317968695|ref|ZP_07970085.1| 30S ribosomal protein S12 [Synechococcus sp. CB0205]
          Length = 124

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R    R   K  ALR  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSERTRLTRK-TKSPALRSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KTPK 123


>gi|330861862|emb|CBX72033.1| 30S ribosomal protein S12 [Yersinia enterocolitica W22703]
          Length = 148

 Score =  167 bits (424), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 25  MATINQLVRKPRSMKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 83

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YG 
Sbjct: 84  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGV 143

Query: 121 ERPK 124
           ++PK
Sbjct: 144 KKPK 147


>gi|224418577|ref|ZP_03656583.1| 30S ribosomal protein S12 [Helicobacter canadensis MIT 98-5491]
 gi|242309991|ref|ZP_04809146.1| 30S ribosomal protein S12 [Helicobacter pullorum MIT 98-5489]
 gi|253826872|ref|ZP_04869757.1| 30S ribosomal protein S12 [Helicobacter canadensis MIT 98-5491]
 gi|313142104|ref|ZP_07804297.1| 30S ribosomal protein S12 [Helicobacter canadensis MIT 98-5491]
 gi|239523288|gb|EEQ63154.1| 30S ribosomal protein S12 [Helicobacter pullorum MIT 98-5489]
 gi|253510278|gb|EES88937.1| 30S ribosomal protein S12 [Helicobacter canadensis MIT 98-5491]
 gi|313131135|gb|EFR48752.1| 30S ribosomal protein S12 [Helicobacter canadensis MIT 98-5491]
          Length = 129

 Score =  167 bits (424), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK   +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLIRKERKKVIKK-SKSPALVVCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGEGHNLQEHS+V++ GGRVKDLPGVKY +IRG LD  GV  R  +RS+YGA
Sbjct: 60  GFEVISYIPGEGHNLQEHSIVLIRGGRVKDLPGVKYHIIRGALDTAGVAKRTVSRSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|313184017|ref|YP_004021129.1| ribosomal protein S12 [Castanea mollissima]
 gi|313184050|ref|YP_004021174.1| ribosomal protein S12 [Castanea mollissima]
 gi|290487472|gb|ADD30120.1| ribosomal protein S12 [Quercus nigra]
 gi|309321544|gb|ADO65084.1| ribosomal protein S12 [Castanea mollissima]
 gi|309321577|gb|ADO65117.1| ribosomal protein S12 [Castanea mollissima]
          Length = 123

 Score =  167 bits (424), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRK R+   R   K  AL G PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRKTRQ-PIRNVTKSPALGGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|296120743|ref|YP_003628521.1| ribosomal protein S12 [Planctomyces limnophilus DSM 3776]
 gi|296013083|gb|ADG66322.1| ribosomal protein S12 [Planctomyces limnophilus DSM 3776]
          Length = 123

 Score =  167 bits (424), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 101/125 (80%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPR-KGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT+NQL+RKPR K   R   K   L   PQKRGVCL V T+TPKKPNSALRK+ + RL+
Sbjct: 1   MPTINQLVRKPRVKQPNRT--KSPVLEACPQKRGVCLMVKTMTPKKPNSALRKIARVRLS 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G E+ AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y++IRGVLD  GV NRKQARSRYG
Sbjct: 59  NGKEITAYIPGEGHNLQEHSIVLVRGGRVRDLPGVRYKIIRGVLDTLGVNNRKQARSRYG 118

Query: 120 AERPK 124
            +RPK
Sbjct: 119 TKRPK 123


>gi|294101623|ref|YP_003553481.1| ribosomal protein S12 [Aminobacterium colombiense DSM 12261]
 gi|293616603|gb|ADE56757.1| ribosomal protein S12 [Aminobacterium colombiense DSM 12261]
          Length = 123

 Score =  167 bits (424), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  RK   R  +   AL+GNP +RGVC RVYTVTPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRLGRKDK-RQNSDSPALQGNPARRGVCTRVYTVTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV+NRK+ RS+YGA
Sbjct: 60  GIEVTSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDCGGVENRKRGRSKYGA 119

Query: 121 ERPK 124
            +PK
Sbjct: 120 RKPK 123


>gi|157372783|ref|YP_001480772.1| 30S ribosomal protein S12 [Serratia proteamaculans 568]
 gi|270264380|ref|ZP_06192646.1| 30S ribosomal protein S12 [Serratia odorifera 4Rx13]
 gi|320540614|ref|ZP_08040264.1| 30S ribosomal subunit protein S12 [Serratia symbiotica str. Tucson]
 gi|166991593|sp|A8GKK4|RS12_SERP5 RecName: Full=30S ribosomal protein S12
 gi|157324547|gb|ABV43644.1| ribosomal protein S12 [Serratia proteamaculans 568]
 gi|270041516|gb|EFA14614.1| 30S ribosomal protein S12 [Serratia odorifera 4Rx13]
 gi|320029545|gb|EFW11574.1| 30S ribosomal subunit protein S12 [Serratia symbiotica str. Tucson]
          Length = 124

 Score =  167 bits (424), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRKGSFRAC-AKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           M T+NQL+RKPR  S +A  + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT
Sbjct: 1   MATINQLVRKPR--SVKAAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLT 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG
Sbjct: 59  NGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYG 118

Query: 120 AERPK 124
            ++PK
Sbjct: 119 VKKPK 123


>gi|160895835|ref|YP_001561417.1| 30S ribosomal protein S12 [Delftia acidovorans SPH-1]
 gi|226708486|sp|A9BPR3|RS12_DELAS RecName: Full=30S ribosomal protein S12
 gi|160361419|gb|ABX33032.1| ribosomal protein S12 [Delftia acidovorans SPH-1]
          Length = 125

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R       +K  A+   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRQGRTVEV-VKSKSPAMENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|294794542|ref|ZP_06759678.1| ribosomal protein S12 [Veillonella sp. 3_1_44]
 gi|294454872|gb|EFG23245.1| ribosomal protein S12 [Veillonella sp. 3_1_44]
          Length = 124

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R  S    +   AL+ +PQKRGVC RVYT TPKKPNSALRKV++ RLT+
Sbjct: 1   MPTINQLVRKGRM-SLTKKSTAPALQESPQKRGVCTRVYTATPKKPNSALRKVVRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV+NR Q+RS+YGA
Sbjct: 60  AIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVQNRMQSRSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|221135381|ref|ZP_03561684.1| 30S ribosomal protein S12 [Glaciecola sp. HTCC2999]
          Length = 124

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPRK      + V AL   PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRKKPVEK-SNVAALEACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +R+QARS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDCAGVNDRRQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|87125019|ref|ZP_01080866.1| 30S ribosomal protein S12 [Synechococcus sp. RS9917]
 gi|86167339|gb|EAQ68599.1| 30S ribosomal protein S12 [Synechococcus sp. RS9917]
          Length = 124

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ S +A  K  ALR  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRHERQ-SLKAKTKSPALRACPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+ G GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KTPK 123


>gi|108804979|ref|YP_644916.1| 30S ribosomal protein S12 [Rubrobacter xylanophilus DSM 9941]
 gi|119366803|sp|Q1AU24|RS12_RUBXD RecName: Full=30S ribosomal protein S12
 gi|108766222|gb|ABG05104.1| SSU ribosomal protein S12P [Rubrobacter xylanophilus DSM 9941]
          Length = 122

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 99/122 (81%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT NQL+RK RK   +  A   AL+G+PQ+RGVC RV T TPKKPNSALRK+ + RLT+
Sbjct: 1   MPTTNQLVRKERKRQTKKTA-TPALQGSPQRRGVCTRVSTTTPKKPNSALRKIARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AYVPGEGHNLQEHSVV++ GGRVKDLPGV+Y+V+RG LDA GV+ RKQ RS+YG 
Sbjct: 60  GHEVTAYVPGEGHNLQEHSVVLVRGGRVKDLPGVRYKVVRGALDALGVEGRKQGRSKYGT 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|238754168|ref|ZP_04615526.1| 30S ribosomal protein S12 [Yersinia ruckeri ATCC 29473]
 gi|238707664|gb|EEQ00024.1| 30S ribosomal protein S12 [Yersinia ruckeri ATCC 29473]
          Length = 124

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRSMKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|157738197|ref|YP_001490881.1| 30S ribosomal protein S12 [Arcobacter butzleri RM4018]
 gi|166991586|sp|A8EW88|RS12_ARCB4 RecName: Full=30S ribosomal protein S12
 gi|157700051|gb|ABV68211.1| 30S ribosomal protein S12 [Arcobacter butzleri RM4018]
          Length = 127

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK      +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLVRKERKKVIDK-SKSPALKKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV NR  +RS+YG 
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNNRTVSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|290487450|gb|ADD30109.1| ribosomal protein S12 [Ximenia americana]
          Length = 123

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C+RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCIRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|53803526|ref|YP_114793.1| 30S ribosomal protein S12 [Methylococcus capsulatus str. Bath]
 gi|61215835|sp|Q605A7|RS12_METCA RecName: Full=30S ribosomal protein S12
 gi|53757287|gb|AAU91578.1| ribosomal protein S12 [Methylococcus capsulatus str. Bath]
          Length = 124

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR  S +  + V AL G PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MTTINQLVRKPRV-SKKEKSNVPALEGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y V+RG LD  GV+ R+Q RS+YGA
Sbjct: 60  GAEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHVVRGSLDTAGVQKRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|69216537|gb|AAZ03934.1| ribosomal protein S12 [Ranunculus macranthus]
          Length = 123

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   +   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIKNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSQYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|34501389|ref|NP_904164.1| ribosomal protein S12 [Physcomitrella patens subsp. patens]
 gi|68053174|sp|Q6YXM6|RR12_PHYPA RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|34494759|dbj|BAC85026.1| ribosomal protein S12 [Physcomitrella patens subsp. patens]
          Length = 123

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+       K  ALRG PQ+RGVC RVYTVTPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRN-RRQPIENRTKSPALRGCPQRRGVCTRVYTVTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|290487470|gb|ADD30119.1| ribosomal protein S12 [Plumbago auriculata]
          Length = 123

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  AL G PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PMRNVTKSPALEGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|110643583|ref|YP_671313.1| 30S ribosomal protein S12 [Escherichia coli 536]
 gi|119366768|sp|Q0TCB7|RS12_ECOL5 RecName: Full=30S ribosomal protein S12
 gi|22121665|gb|AAM88610.1| mutant 30S ribosomal subunit protein S12 [Escherichia coli]
 gi|110345175|gb|ABG71412.1| 30S ribosomal protein S12 [Escherichia coli 536]
          Length = 124

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRV+DLPGV+Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVRDLPGVRYHTVRGALDCSGVKDRKQARSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|238902433|ref|YP_002928229.1| 30S ribosomal subunit protein S12 [Escherichia coli BW2952]
 gi|296105037|ref|YP_003615183.1| 30S ribosomal subunit protein S12 [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|297517422|ref|ZP_06935808.1| 30S ribosomal protein S12 [Escherichia coli OP50]
 gi|259494648|sp|C4ZUJ7|RS12_ECOBW RecName: Full=30S ribosomal protein S12
 gi|11120595|gb|AAG30936.1| ribosomal protein S12 [Escherichia coli]
 gi|238859786|gb|ACR61784.1| 30S ribosomal subunit protein S12 [Escherichia coli BW2952]
 gi|295059496|gb|ADF64234.1| 30S ribosomal subunit protein S12 [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 124

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR     A + V AL   PQKRGVC RVYT TP+KPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPRKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|6094150|sp|O50563|RS12_THICU RecName: Full=30S ribosomal protein S12
 gi|2654446|gb|AAB87731.1| ribosomal protein S12 [Thiomonas cuprina]
          Length = 124

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+         +K  A+  +PQ+RGVC RVYT TPKKPNSALRKV K  LT+
Sbjct: 1   MPTINQLVRQGAXAET-IKSKSAAMENSPQRRGVCTRVYTTTPKKPNSALRKVAKVPLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+RKQ+RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|78776556|ref|YP_392871.1| 30S ribosomal protein S12 [Sulfurimonas denitrificans DSM 1251]
 gi|118597404|sp|Q30TP5|RS12_SULDN RecName: Full=30S ribosomal protein S12
 gi|78497096|gb|ABB43636.1| SSU ribosomal protein S12P [Sulfurimonas denitrificans DSM 1251]
          Length = 126

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R+   +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLIRKERQKVVKK-SKSPALVSCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGR+KDLPGVKY ++RG LD  GV NR  +RS+YG 
Sbjct: 60  GFEVISYIMGEGHNLQEHSIVLVRGGRIKDLPGVKYHIVRGALDTAGVANRTVSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|304315935|ref|YP_003851080.1| ribosomal protein S12 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
 gi|302777437|gb|ADL67996.1| ribosomal protein S12 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
          Length = 123

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ RK   +  +   AL+GNPQKRGVC  V T TPKKPNSALRK+ + RL +
Sbjct: 1   MPTINQLVREGRK-KVKYKSTSPALKGNPQKRGVCTVVKTTTPKKPNSALRKIARVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA GV NRKQARS+YGA
Sbjct: 60  NTEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYKIIRGTLDAAGVANRKQARSQYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|312144252|ref|YP_003995698.1| ribosomal protein S12 [Halanaerobium sp. 'sapolanicus']
 gi|311904903|gb|ADQ15344.1| ribosomal protein S12 [Halanaerobium sp. 'sapolanicus']
          Length = 123

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QLIRK R+ + +  +   AL G+PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLIRKGREKTKKKTS-APALEGSPQKRGVCTRVYTATPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV++RKQ RS+YG 
Sbjct: 60  GKEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTAGVEDRKQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|328953163|ref|YP_004370497.1| ribosomal protein S12 [Desulfobacca acetoxidans DSM 11109]
 gi|328453487|gb|AEB09316.1| ribosomal protein S12 [Desulfobacca acetoxidans DSM 11109]
          Length = 123

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   R  +   AL+  PQKRGVC+RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGREKIKRKTS-TPALKSCPQKRGVCVRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y V+RG LD+ GV++R+Q RS+YGA
Sbjct: 60  GIEVTTYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGTLDSVGVQDRRQGRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|283835746|ref|ZP_06355487.1| hypothetical protein CIT292_10138 [Citrobacter youngae ATCC 29220]
 gi|291067909|gb|EFE06018.1| ribosomal protein S12 [Citrobacter youngae ATCC 29220]
          Length = 124

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|94500501|ref|ZP_01307032.1| 30S ribosomal protein S12 [Oceanobacter sp. RED65]
 gi|94427291|gb|EAT12270.1| 30S ribosomal protein S12 [Oceanobacter sp. RED65]
          Length = 123

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK    A + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRQV-AKSDVRALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RKQ RS+YGA
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVNDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|260905726|ref|ZP_05914048.1| SSU ribosomal protein S12P [Brevibacterium linens BL2]
          Length = 124

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R     A +   AL+ +PQ+RGVC RVYT TPKKPNSALRKV + +L+S
Sbjct: 1   MPTIQQLVRKGRHVKS-AGSDAPALKNSPQRRGVCTRVYTTTPKKPNSALRKVARVKLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PGEGHN+QEHS+V++ GGRVKDLPGV+YR++RG LD QGVK R+QARS+YGA
Sbjct: 60  QIEVTAYIPGEGHNVQEHSIVLVRGGRVKDLPGVRYRIVRGSLDTQGVKGRQQARSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KREK 123


>gi|11465447|ref|NP_045162.1| ribosomal protein S12 [Cyanidium caldarium]
 gi|14423929|sp|Q9TLV6|RR12_CYACA RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|6466350|gb|AAF12932.1|AF022186_54 unknown [Cyanidium caldarium]
          Length = 124

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  RK      +K  AL   PQK+GVC +VYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRFERK-QIVGTSKSAALESCPQKKGVCTKVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD+ GVKNR +ARS+YGA
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDSTGVKNRLRARSKYGA 119

Query: 121 ERPK 124
            +PK
Sbjct: 120 SKPK 123


>gi|323705656|ref|ZP_08117230.1| ribosomal protein S12 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535133|gb|EGB24910.1| ribosomal protein S12 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 123

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ RK   +  +   AL+GNPQKRGVC  V T TPKKPNSALRK+ + RL +
Sbjct: 1   MPTINQLVREGRK-KVKYKSASPALKGNPQKRGVCTVVKTTTPKKPNSALRKIARVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA GV NRKQARS+YGA
Sbjct: 60  NTEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYKIIRGTLDAAGVANRKQARSQYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|197131620|gb|ACH47328.1| ribosomal protein S12 [Pelargonium cotyledonis]
          Length = 123

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  R+   R   K  ALRG PQ+RG C RVYT++PKKPNSA RKV + RLTS
Sbjct: 1   MPTINQLLRNSRQ-PVRKTKKTPALRGCPQRRGRCTRVYTISPKKPNSADRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK R+Q RS+YG 
Sbjct: 60  GFEITAYIPGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKGRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|323149216|ref|YP_004222045.1| ribosomal protein S12 [Coccomyxa sp. C-169]
 gi|317467272|gb|ADV29893.1| ribosomal protein S12 [Coccomyxa sp. C-169]
          Length = 124

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+R  RK   R   K  ALR  PQ+RGVC+RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTIQQLVRTARKEISRK-TKSPALRSCPQRRGVCIRVYTTTPKKPNSALRKVARVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD   VKNR Q+RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDTAAVKNRTQSRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|15599464|ref|NP_252958.1| 30S ribosomal protein S12 [Pseudomonas aeruginosa PAO1]
 gi|107103780|ref|ZP_01367698.1| hypothetical protein PaerPA_01004851 [Pseudomonas aeruginosa PACS2]
 gi|116052303|ref|YP_788851.1| 30S ribosomal protein S12 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152989554|ref|YP_001346218.1| 30S ribosomal protein S12 [Pseudomonas aeruginosa PA7]
 gi|218889404|ref|YP_002438268.1| 30S ribosomal protein S12 [Pseudomonas aeruginosa LESB58]
 gi|296387175|ref|ZP_06876674.1| 30S ribosomal protein S12 [Pseudomonas aeruginosa PAb1]
 gi|313111422|ref|ZP_07797226.1| 30S ribosomal protein S12 [Pseudomonas aeruginosa 39016]
 gi|14423918|sp|Q9HWD0|RS12_PSEAE RecName: Full=30S ribosomal protein S12
 gi|122261452|sp|Q02T85|RS12_PSEAB RecName: Full=30S ribosomal protein S12
 gi|166231877|sp|A6UZI3|RS12_PSEA7 RecName: Full=30S ribosomal protein S12
 gi|226712636|sp|B7V639|RS12_PSEA8 RecName: Full=30S ribosomal protein S12
 gi|9950486|gb|AAG07656.1|AE004842_5 30S ribosomal protein S12 [Pseudomonas aeruginosa PAO1]
 gi|115587524|gb|ABJ13539.1| 30S ribosomal protein S12 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|150964712|gb|ABR86737.1| ribosomal protein S12 [Pseudomonas aeruginosa PA7]
 gi|218769627|emb|CAW25387.1| 30S ribosomal protein S12 [Pseudomonas aeruginosa LESB58]
 gi|310883728|gb|EFQ42322.1| 30S ribosomal protein S12 [Pseudomonas aeruginosa 39016]
          Length = 123

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK      + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRMVDK-SDVPALQNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YGA
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|156618927|ref|YP_001430027.1| ribosomal protein S12 [Cuscuta gronovii]
 gi|156618953|ref|YP_001430156.1| ribosomal protein S12 [Cuscuta gronovii]
 gi|159106817|ref|YP_001531201.1| ribosomal protein S12 [Cuscuta obtusiflora]
 gi|1173184|sp|P46296|RR12_CUSEU RecName: Full=Plastid 30S ribosomal protein S12
 gi|1052568|emb|CAA57776.1| ribosomal protein CS12 [Cuscuta europaea]
 gi|156555965|emb|CAM98349.1| ribosomal protein S12 [Cuscuta gronovii]
 gi|158142541|gb|ABW20582.1| ribosomal protein S12 [Cuscuta obtusiflora]
          Length = 123

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALR  PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRKVTKSPALRSCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|322831051|ref|YP_004211078.1| ribosomal protein S12 [Rahnella sp. Y9602]
 gi|321166252|gb|ADW71951.1| ribosomal protein S12 [Rahnella sp. Y9602]
          Length = 124

 Score =  167 bits (422), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRSTKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|330837659|ref|YP_004412300.1| 30S ribosomal protein S12P [Spirochaeta coccoides DSM 17374]
 gi|329749562|gb|AEC02918.1| SSU ribosomal protein S12P [Spirochaeta coccoides DSM 17374]
          Length = 124

 Score =  167 bits (422), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R  S     K  AL G+PQKRGVC RV TVTPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLIRKGRVASANKT-KSPALEGSPQKRGVCTRVMTVTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG  D  GV +RK++RS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLMRGGRVKDLPGVRYHIIRGAKDTLGVADRKRSRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|296112453|ref|YP_003626391.1| 30S ribosomal protein S12 [Moraxella catarrhalis RH4]
 gi|295920147|gb|ADG60498.1| 30S ribosomal protein S12 [Moraxella catarrhalis RH4]
          Length = 149

 Score =  167 bits (422), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T NQLIRK R  + +  +KV AL+  PQ+RGVC RVYT TPKKPNSA+RKV + RLTS
Sbjct: 26  MATTNQLIRKGRT-TIKEKSKVPALQACPQRRGVCTRVYTTTPKKPNSAMRKVCRVRLTS 84

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YGA
Sbjct: 85  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGA 144

Query: 121 ERPK 124
           +RPK
Sbjct: 145 KRPK 148


>gi|148243266|ref|YP_001228423.1| 30S ribosomal protein S12 [Synechococcus sp. RCC307]
 gi|166231892|sp|A5GW11|RS12_SYNR3 RecName: Full=30S ribosomal protein S12
 gi|147851576|emb|CAK29070.1| 30S ribosomal protein S12 [Synechococcus sp. RCC307]
          Length = 124

 Score =  167 bits (422), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALR  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRTERQTLSRK-TKSPALRSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KAPK 123


>gi|50122958|ref|YP_052125.1| 30S ribosomal protein S12 [Pectobacterium atrosepticum SCRI1043]
 gi|227112097|ref|ZP_03825753.1| 30S ribosomal protein S12 [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227326770|ref|ZP_03830794.1| 30S ribosomal protein S12 [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
 gi|253690191|ref|YP_003019381.1| ribosomal protein S12 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|261823240|ref|YP_003261346.1| 30S ribosomal protein S12 [Pectobacterium wasabiae WPP163]
 gi|52783349|sp|Q6CZW3|RS12_ERWCT RecName: Full=30S ribosomal protein S12
 gi|259494658|sp|C6DG82|RS12_PECCP RecName: Full=30S ribosomal protein S12
 gi|49613484|emb|CAG76935.1| 30S ribosomal subunit protein S12 [Pectobacterium atrosepticum
           SCRI1043]
 gi|251756769|gb|ACT14845.1| ribosomal protein S12 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|261607253|gb|ACX89739.1| ribosomal protein S12 [Pectobacterium wasabiae WPP163]
          Length = 124

 Score =  167 bits (422), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/125 (65%), Positives = 100/125 (80%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRKGSFRAC-AKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           M T+NQL+RKPR  S +A  + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT
Sbjct: 1   MATINQLVRKPR--SLKAAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLT 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YG
Sbjct: 59  NGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYG 118

Query: 120 AERPK 124
            ++PK
Sbjct: 119 VKKPK 123


>gi|315178332|gb|ADT85246.1| 30S ribosomal protein S12 - rpsL [Vibrio furnissii NCTC 11218]
          Length = 124

 Score =  167 bits (422), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRAKQV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RKQARS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVNDRKQARSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|246880730|gb|ACS95042.1| ribosomal protein S12 [Dunaliella salina]
          Length = 129

 Score =  167 bits (422), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 97/121 (80%), Gaps = 1/121 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  RK      +K  AL+  PQ+RG+CLRVYTVTPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSARKKQTTK-SKAPALKSCPQRRGICLRVYTVTPKKPNSALRKVARIRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEH+VV++ GGRVKDLPGV+Y ++RG LD  GVKNR Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHAVVLVRGGRVKDLPGVRYHIVRGTLDTAGVKNRTQSRSKYGA 119

Query: 121 E 121
           +
Sbjct: 120 K 120


>gi|302337473|ref|YP_003802679.1| ribosomal protein S12 [Spirochaeta smaragdinae DSM 11293]
 gi|301634658|gb|ADK80085.1| ribosomal protein S12 [Spirochaeta smaragdinae DSM 11293]
          Length = 124

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK   R   K  AL   PQKRGVC RV TVTPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRK-EIRKKGKAPALEACPQKRGVCTRVMTVTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG  D  GV +R+Q RS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGAKDTLGVDDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|161541288|ref|YP_826363.2| 30S ribosomal protein S12 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|158563892|sp|Q01W87|RS12_SOLUE RecName: Full=30S ribosomal protein S12
          Length = 124

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT NQL+R  RK   R      AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTFNQLVRNGRKPP-RWKTSSPALESCPQKRGVCTRVYTSTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PG GHNLQEHS+V++ GGRVKDLPGV+Y VIRG LD  GV NRKQ+RS+YGA
Sbjct: 60  GIEVTTYIPGVGHNLQEHSIVLIRGGRVKDLPGVRYHVIRGALDTAGVANRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|49077832|gb|AAT49722.1| PA4268 [synthetic construct]
          Length = 124

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK      + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRMVDK-SDVPALQNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YGA
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|239993454|ref|ZP_04713978.1| 30S ribosomal protein S12 [Alteromonas macleodii ATCC 27126]
 gi|226708453|sp|B4RRP9|RS12_ALTMD RecName: Full=30S ribosomal protein S12
          Length = 124

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR+      + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRRKPVEK-SNVAALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RKQARS+YGA
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDCAGVNDRKQARSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|291059313|gb|ADD72149.1| ribosomal protein S12 [Olea europaea]
          Length = 123

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHS V++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSSVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|149072034|ref|YP_001293605.1| ribosomal protein S12 [Rhodomonas salina]
 gi|134302985|gb|ABO70789.1| ribosomal protein S12 [Rhodomonas salina]
          Length = 124

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  RK   +      AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSERKKIKKKTKS-PALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHN+QEHSVV+L GGRVKDLPGV+Y ++RG LDA GVK+R+QARS+YGA
Sbjct: 60  GFEVTAYIPGIGHNIQEHSVVLLRGGRVKDLPGVRYHIVRGTLDASGVKDRRQARSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|152991729|ref|YP_001357450.1| 30S ribosomal protein S12 [Sulfurovum sp. NBC37-1]
 gi|166231891|sp|A6Q6I4|RS12_SULNB RecName: Full=30S ribosomal protein S12
 gi|151423590|dbj|BAF71093.1| 30S ribosomal protein S12 [Sulfurovum sp. NBC37-1]
          Length = 123

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK   +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLIRKERKKQVKK-SKSPALVKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGR+KDLPGVKY ++RG LDA GV  R  ARS+YG 
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRIKDLPGVKYHIVRGALDASGVTGRTVARSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|222099962|ref|YP_002534530.1| 30S ribosomal protein S12 [Thermotoga neapolitana DSM 4359]
 gi|221572352|gb|ACM23164.1| 30S ribosomal protein S12 [Thermotoga neapolitana DSM 4359]
          Length = 129

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  RK   +  +K  AL+GNPQKRGVC++V T+TPKKPNSALRK+ + RL++
Sbjct: 3   MPTINQLIRHGRK-PKKKKSKAPALQGNPQKRGVCIKVSTMTPKKPNSALRKIARVRLSN 61

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA GV+ R+Q+RS+YGA
Sbjct: 62  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDAAGVEGRRQSRSKYGA 121

Query: 121 ERPK 124
           +RPK
Sbjct: 122 KRPK 125


>gi|304413140|ref|ZP_07394613.1| 30S ribosomal subunit protein S12 [Candidatus Regiella insecticola
           LSR1]
 gi|304283983|gb|EFL92376.1| 30S ribosomal subunit protein S12 [Candidatus Regiella insecticola
           LSR1]
          Length = 124

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+    A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MTTINQLVRKPRRKRV-AKSNVPALASCPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|108758569|ref|YP_631494.1| 30S ribosomal protein S12 [Myxococcus xanthus DK 1622]
 gi|27151677|sp|Q8KRD1|RS12_MYXXA RecName: Full=30S ribosomal protein S12
 gi|119366788|sp|Q1D779|RS12_MYXXD RecName: Full=30S ribosomal protein S12
 gi|21307596|gb|AAK59393.1| 30S ribosomal protein S12 [Myxococcus xanthus]
 gi|108462449|gb|ABF87634.1| ribosomal protein S12 [Myxococcus xanthus DK 1622]
          Length = 123

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 81/123 (65%), Positives = 100/123 (81%), Gaps = 1/123 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RK R+       K  AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLVRKGRE-KLVVKGKSPALKESPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVVM+ GGRVKDLPGV+Y ++RG LD+ GV  RKQ+RS+YGA
Sbjct: 60  GIEVTSYIPGVGHNLQEHSVVMIRGGRVKDLPGVRYHIVRGTLDSVGVAGRKQSRSKYGA 119

Query: 121 ERP 123
           +RP
Sbjct: 120 KRP 122


>gi|71066452|ref|YP_265179.1| 30S ribosomal protein S12 [Psychrobacter arcticus 273-4]
 gi|93007011|ref|YP_581448.1| 30S ribosomal protein S12 [Psychrobacter cryohalolentis K5]
 gi|90111796|sp|Q4FQG3|RS12_PSYA2 RecName: Full=30S ribosomal protein S12
 gi|119366792|sp|Q1Q8N9|RS12_PSYCK RecName: Full=30S ribosomal protein S12
 gi|71039437|gb|AAZ19745.1| SSU ribosomal protein S12P [Psychrobacter arcticus 273-4]
 gi|92394689|gb|ABE75964.1| SSU ribosomal protein S12P [Psychrobacter cryohalolentis K5]
          Length = 124

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T NQLIRK RK + +  +KV AL   PQ+RGVC RVYT TPKKPNSA+RKV + RLTS
Sbjct: 1   MATTNQLIRKGRK-TIKEKSKVPALEACPQRRGVCTRVYTTTPKKPNSAMRKVCRVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|57504742|ref|ZP_00370796.1| ribosomal protein S12 [Campylobacter coli RM2228]
 gi|57019398|gb|EAL56096.1| ribosomal protein S12 [Campylobacter coli RM2228]
          Length = 128

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK      +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLVRKERKKVLEK-SKSPALKNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV  R  +RS+YG 
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|329296385|ref|ZP_08253721.1| 30S ribosomal protein S12 [Plautia stali symbiont]
          Length = 124

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 99/126 (78%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAK--VTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           M TVNQL+RKPR    R  AK  V AL   PQKRGVC RVYT TPKKPNSALRKV + RL
Sbjct: 1   MATVNQLVRKPR---VRQVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           T+G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+Y
Sbjct: 58  TNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKY 117

Query: 119 GAERPK 124
           G ++PK
Sbjct: 118 GVKKPK 123


>gi|294507045|ref|YP_003571103.1| 30S ribosomal protein S12 [Salinibacter ruber M8]
 gi|83755699|gb|ABC43812.1| ribosomal protein S12 [Salinibacter ruber DSM 13855]
 gi|294343373|emb|CBH24151.1| 30S ribosomal protein S12 [Salinibacter ruber M8]
          Length = 150

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT  QLIRK RK +    +   AL G+PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 27  VPTTQQLIRKGRK-TEEETSDAPALEGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 85

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV+ R+Q RS+YG 
Sbjct: 86  GNEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVEERRQGRSKYGT 145

Query: 121 ERPK 124
           ++P+
Sbjct: 146 KKPR 149


>gi|286143018|gb|ADC41539.1| 30S ribosomal protein S12 [Streptomyces platensis]
 gi|286143020|gb|ADC41540.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143022|gb|ADC41541.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143024|gb|ADC41542.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143026|gb|ADC41543.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143028|gb|ADC41544.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143030|gb|ADC41545.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143032|gb|ADC41546.1| 30S ribosomal protein S12 [Streptomyces platensis]
 gi|286143034|gb|ADC41547.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143036|gb|ADC41548.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143038|gb|ADC41549.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143040|gb|ADC41550.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143042|gb|ADC41551.1| 30S ribosomal protein S12 [Streptomyces tuirus]
 gi|286143044|gb|ADC41552.1| 30S ribosomal protein S12 [Streptomyces griseoruber]
 gi|286143046|gb|ADC41553.1| 30S ribosomal protein S12 [Streptomyces coelicolor]
 gi|286143048|gb|ADC41554.1| 30S ribosomal protein S12 [Streptomyces coelescens]
 gi|286143050|gb|ADC41555.1| 30S ribosomal protein S12 [Streptomyces violaceoruber]
 gi|286143052|gb|ADC41556.1| 30S ribosomal protein S12 [Streptomyces sp. DSM 40419]
 gi|286143054|gb|ADC41557.1| 30S ribosomal protein S12 [Streptomyces violaceolatus]
 gi|286143056|gb|ADC41558.1| 30S ribosomal protein S12 [Streptomyces lividans]
 gi|286143058|gb|ADC41559.1| 30S ribosomal protein S12 [Streptomyces sp. BTG 4-758]
 gi|286143060|gb|ADC41560.1| 30S ribosomal protein S12 [Streptomyces sp. BTG 4-759]
 gi|286143062|gb|ADC41561.1| 30S ribosomal protein S12 [Streptomyces sp. BTG 6-715]
 gi|286143064|gb|ADC41562.1| 30S ribosomal protein S12 [Streptomyces sp. BTG 6-708]
 gi|286143066|gb|ADC41563.1| 30S ribosomal protein S12 [Streptomyces sp. BTG 717 I]
 gi|286143070|gb|ADC41565.1| 30S ribosomal protein S12 [Streptomyces sp. BTG 723 I]
 gi|286143072|gb|ADC41566.1| 30S ribosomal protein S12 [Streptomyces sp. BTG 4-723]
 gi|286143074|gb|ADC41567.1| 30S ribosomal protein S12 [Streptomyces sp. BTG 4-738]
 gi|286143076|gb|ADC41568.1| 30S ribosomal protein S12 [Streptomyces coelicolor]
 gi|286143078|gb|ADC41569.1| 30S ribosomal protein S12 [Streptomyces violaceoruber]
 gi|286143080|gb|ADC41570.1| 30S ribosomal protein S12 [Streptomyces glaucescens]
 gi|286143082|gb|ADC41571.1| 30S ribosomal protein S12 [Streptomyces humidus]
 gi|286143084|gb|ADC41572.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143086|gb|ADC41573.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143088|gb|ADC41574.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143090|gb|ADC41575.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143092|gb|ADC41576.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143094|gb|ADC41577.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143096|gb|ADC41578.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143098|gb|ADC41579.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143100|gb|ADC41580.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143102|gb|ADC41581.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143104|gb|ADC41582.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143106|gb|ADC41583.1| 30S ribosomal protein S12 [Streptomyces sp. DSM 40932]
 gi|286143108|gb|ADC41584.1| 30S ribosomal protein S12 [Streptomyces californicus]
 gi|286143110|gb|ADC41585.1| 30S ribosomal protein S12 [Streptomyces olivoviridis]
 gi|286143112|gb|ADC41586.1| 30S ribosomal protein S12 [Streptomyces anulatus]
 gi|286143114|gb|ADC41587.1| 30S ribosomal protein S12 [Streptomyces reticuli]
 gi|286143116|gb|ADC41588.1| 30S ribosomal protein S12 [Streptomyces acrimycini]
 gi|286143118|gb|ADC41589.1| 30S ribosomal protein S12 [Streptomyces griseobrunneus]
 gi|286143120|gb|ADC41590.1| 30S ribosomal protein S12 [Streptomyces microflavus]
 gi|286143122|gb|ADC41591.1| 30S ribosomal protein S12 [Streptomyces bacillaris]
 gi|286143124|gb|ADC41592.1| 30S ribosomal protein S12 [Streptomyces vinaceus]
 gi|286143126|gb|ADC41593.1| 30S ribosomal protein S12 [Streptomyces microflavus]
 gi|286143128|gb|ADC41594.1| 30S ribosomal protein S12 [Streptomyces alboviridis]
 gi|286143130|gb|ADC41595.1| 30S ribosomal protein S12 [Streptomyces microflavus]
 gi|286143132|gb|ADC41596.1| 30S ribosomal protein S12 [Streptomyces albovinaceus]
 gi|286143134|gb|ADC41597.1| 30S ribosomal protein S12 [Kitasatospora mediocidica]
 gi|286143136|gb|ADC41598.1| 30S ribosomal protein S12 [Streptomyces albidus]
 gi|286143138|gb|ADC41599.1| 30S ribosomal protein S12 [Streptomyces floridae]
 gi|286143140|gb|ADC41600.1| 30S ribosomal protein S12 [Streptomyces roseochromogenes]
 gi|286143144|gb|ADC41602.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143146|gb|ADC41603.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143148|gb|ADC41604.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143150|gb|ADC41605.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143152|gb|ADC41606.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143154|gb|ADC41607.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143158|gb|ADC41609.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143160|gb|ADC41610.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143162|gb|ADC41611.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143164|gb|ADC41612.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143166|gb|ADC41613.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143168|gb|ADC41614.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143170|gb|ADC41615.1| 30S ribosomal protein S12 [Streptomyces sp. CB157]
 gi|286143174|gb|ADC41617.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143176|gb|ADC41618.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143178|gb|ADC41619.1| 30S ribosomal protein S12 [Streptomyces sp. CB169]
 gi|286143180|gb|ADC41620.1| 30S ribosomal protein S12 [Streptomyces sp. CB170]
 gi|286143182|gb|ADC41621.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143184|gb|ADC41622.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143186|gb|ADC41623.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143188|gb|ADC41624.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143190|gb|ADC41625.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143192|gb|ADC41626.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143194|gb|ADC41627.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143196|gb|ADC41628.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143198|gb|ADC41629.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143200|gb|ADC41630.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143202|gb|ADC41631.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143204|gb|ADC41632.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143206|gb|ADC41633.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143208|gb|ADC41634.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143210|gb|ADC41635.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143212|gb|ADC41636.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143214|gb|ADC41637.1| 30S ribosomal protein S12 [Streptomyces sp. E1002]
 gi|286143216|gb|ADC41638.1| 30S ribosomal protein S12 [Streptomyces limosus]
 gi|286143218|gb|ADC41639.1| 30S ribosomal protein S12 [Streptomyces griseus]
 gi|286143220|gb|ADC41640.1| 30S ribosomal protein S12 [Streptomyces netropsis]
 gi|286143222|gb|ADC41641.1| 30S ribosomal protein S12 [Streptomyces puniceus]
 gi|286143224|gb|ADC41642.1| 30S ribosomal protein S12 [Streptomyces cinnamoneus]
 gi|286143226|gb|ADC41643.1| 30S ribosomal protein S12 [Streptomyces mashuensis]
 gi|286143228|gb|ADC41644.1| 30S ribosomal protein S12 [Streptomyces galbus]
          Length = 109

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 91/102 (89%)

Query: 21  KVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSGVEVIAYVPGEGHNLQEHSV 80
           K  AL G+PQ+RGVC RV+T TPKKPNSALRKV + RLTSG+EV AY+PGEGHNLQEHS+
Sbjct: 8   KTPALEGSPQRRGVCTRVFTTTPKKPNSALRKVARVRLTSGIEVTAYIPGEGHNLQEHSI 67

Query: 81  VMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGAER 122
           V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA++
Sbjct: 68  VLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKK 109


>gi|148263136|ref|YP_001229842.1| 30S ribosomal protein S12 [Geobacter uraniireducens Rf4]
 gi|189040461|sp|A5GAY3|RS12_GEOUR RecName: Full=30S ribosomal protein S12
 gi|146396636|gb|ABQ25269.1| SSU ribosomal protein S12P [Geobacter uraniireducens Rf4]
          Length = 123

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  R+ S +  +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRIGRE-SKKDKSTAPALKCCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GVK+RK++RS+YGA
Sbjct: 60  GVEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSVGVKDRKKSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|238921447|ref|YP_002934962.1| 30S ribosomal protein S12, putative [Edwardsiella ictaluri 93-146]
 gi|269140575|ref|YP_003297276.1| 30S ribosomal protein S12 [Edwardsiella tarda EIB202]
 gi|259494649|sp|C5BGN0|RS12_EDWI9 RecName: Full=30S ribosomal protein S12
 gi|238871016|gb|ACR70727.1| 30S ribosomal protein S12, putative [Edwardsiella ictaluri 93-146]
 gi|267986236|gb|ACY86065.1| 30S ribosomal protein S12 [Edwardsiella tarda EIB202]
 gi|304560364|gb|ADM43028.1| SSU ribosomal protein S12p (S23e) [Edwardsiella tarda FL6-60]
          Length = 124

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRAKKVEK-SNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|162135923|ref|YP_892465.2| 30S ribosomal protein S12 [Campylobacter fetus subsp. fetus 82-40]
 gi|158512706|sp|A0RQI2|RS12_CAMFF RecName: Full=30S ribosomal protein S12
          Length = 127

 Score =  167 bits (422), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK      +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLVRKERKKVI-VKSKSPALKECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV  R  +RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|116075714|ref|ZP_01472973.1| 30S ribosomal protein S12 [Synechococcus sp. RS9916]
 gi|116067029|gb|EAU72784.1| 30S ribosomal protein S12 [Synechococcus sp. RS9916]
          Length = 124

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ S +A  K  ALR  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRNERQ-SVKAKTKSPALRSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+ G GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KTPK 123


>gi|326561954|gb|EGE12289.1| 30S ribosomal protein S12 [Moraxella catarrhalis 7169]
 gi|326562242|gb|EGE12569.1| 30S ribosomal protein S12 [Moraxella catarrhalis 46P47B1]
 gi|326563018|gb|EGE13292.1| 30S ribosomal protein S12 [Moraxella catarrhalis 103P14B1]
 gi|326565107|gb|EGE15299.1| 30S ribosomal protein S12 [Moraxella catarrhalis 12P80B1]
 gi|326569593|gb|EGE19647.1| 30S ribosomal protein S12 [Moraxella catarrhalis BC8]
 gi|326570303|gb|EGE20347.1| 30S ribosomal protein S12 [Moraxella catarrhalis BC1]
 gi|326572339|gb|EGE22332.1| 30S ribosomal protein S12 [Moraxella catarrhalis BC7]
 gi|326573611|gb|EGE23570.1| 30S ribosomal protein S12 [Moraxella catarrhalis CO72]
 gi|326577314|gb|EGE27202.1| 30S ribosomal protein S12 [Moraxella catarrhalis 101P30B1]
 gi|326577866|gb|EGE27732.1| 30S ribosomal protein S12 [Moraxella catarrhalis O35E]
          Length = 124

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T NQLIRK R  + +  +KV AL+  PQ+RGVC RVYT TPKKPNSA+RKV + RLTS
Sbjct: 1   MATTNQLIRKGRT-TIKEKSKVPALQACPQRRGVCTRVYTTTPKKPNSAMRKVCRVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|153868767|ref|ZP_01998512.1| Ribosomal protein S12/S23 [Beggiatoa sp. PS]
 gi|152074644|gb|EDN71479.1| Ribosomal protein S12/S23 [Beggiatoa sp. PS]
          Length = 127

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 84/126 (66%), Positives = 99/126 (78%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVT--ALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           M T+NQL+RKPRK   R  +K T  AL G PQKRGVC RVYT TPKKPNSA+RKV + RL
Sbjct: 1   MATINQLVRKPRK---RQQSKSTTPALEGCPQKRGVCTRVYTTTPKKPNSAMRKVARVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           T+G+EV  Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV  R+Q RS+Y
Sbjct: 58  TNGMEVTTYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTSGVDVRRQGRSKY 117

Query: 119 GAERPK 124
           GA+RPK
Sbjct: 118 GAKRPK 123


>gi|319787930|ref|YP_004147405.1| ribosomal protein S12 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466442|gb|ADV28174.1| ribosomal protein S12 [Pseudoxanthomonas suwonensis 11-1]
          Length = 124

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+      A   AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MATINQLVRKPRQAETYKSAS-PALEKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LDA GV  R+Q RS+YGA
Sbjct: 60  GYEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVTKRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|188535284|ref|YP_001909081.1| 30S ribosomal protein S12 [Erwinia tasmaniensis Et1/99]
 gi|259910004|ref|YP_002650360.1| 30S ribosomal protein S12 [Erwinia pyrifoliae Ep1/96]
 gi|292489854|ref|YP_003532744.1| 30S ribosomal protein S12 [Erwinia amylovora CFBP1430]
 gi|292900896|ref|YP_003540265.1| 30S ribosomal protein S12 [Erwinia amylovora ATCC 49946]
 gi|304397772|ref|ZP_07379648.1| ribosomal protein S12 [Pantoea sp. aB]
 gi|308188366|ref|YP_003932497.1| 30S ribosomal protein S12 [Pantoea vagans C9-1]
 gi|317049847|ref|YP_004117495.1| 30S ribosomal protein S12 [Pantoea sp. At-9b]
 gi|226708501|sp|B2VK38|RS12_ERWT9 RecName: Full=30S ribosomal protein S12
 gi|188030326|emb|CAO98215.1| 30S ribosomal protein S12 [Erwinia tasmaniensis Et1/99]
 gi|224965626|emb|CAX57158.1| 30S ribosomal protein S12 [Erwinia pyrifoliae Ep1/96]
 gi|291200744|emb|CBJ47877.1| 30S ribosomal subunit protein S12 [Erwinia amylovora ATCC 49946]
 gi|291555291|emb|CBA23599.1| 30S ribosomal protein S12 [Erwinia amylovora CFBP1430]
 gi|304354483|gb|EFM18854.1| ribosomal protein S12 [Pantoea sp. aB]
 gi|308058876|gb|ADO11048.1| 30S ribosomal protein S12 [Pantoea vagans C9-1]
 gi|310765603|gb|ADP10553.1| 30S ribosomal protein S12 [Erwinia sp. Ejp617]
 gi|312174036|emb|CBX82289.1| 30S ribosomal protein S12 [Erwinia amylovora ATCC BAA-2158]
 gi|316951464|gb|ADU70939.1| ribosomal protein S12 [Pantoea sp. At-9b]
          Length = 124

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 99/126 (78%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAK--VTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           M TVNQL+RKPR    R  AK  V AL   PQKRGVC RVYT TPKKPNSALRKV + RL
Sbjct: 1   MATVNQLVRKPR---VRKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           T+G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+Y
Sbjct: 58  TNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKY 117

Query: 119 GAERPK 124
           G ++PK
Sbjct: 118 GVKKPK 123


>gi|194470904|ref|ZP_03076888.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194457268|gb|EDX46107.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
          Length = 124

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVCYHTVRGALDCSGVKDRKQARSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|159161184|ref|YP_001542426.1| ribosomal protein S12 [Ceratophyllum demersum]
 gi|159161185|ref|YP_001542471.1| ribosomal protein S12 [Ceratophyllum demersum]
 gi|148508467|gb|ABQ81474.1| ribosomal protein S12 [Ceratophyllum demersum]
 gi|148508468|gb|ABQ81475.1| ribosomal protein S12 [Ceratophyllum demersum]
 gi|227481165|emb|CAP62544.1| ribosomal protein S12 [Ceratophyllum demersum]
 gi|227481178|emb|CAP62557.1| ribosomal protein S12 [Ceratophyllum demersum]
          Length = 126

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|115376085|ref|ZP_01463330.1| ribosomal protein S12 [Stigmatella aurantiaca DW4/3-1]
 gi|310820990|ref|YP_003953348.1| 30S ribosomal protein S12 [Stigmatella aurantiaca DW4/3-1]
 gi|115366900|gb|EAU65890.1| ribosomal protein S12 [Stigmatella aurantiaca DW4/3-1]
 gi|309394062|gb|ADO71521.1| 30S ribosomal protein S12 [Stigmatella aurantiaca DW4/3-1]
          Length = 123

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 82/123 (66%), Positives = 99/123 (80%), Gaps = 1/123 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RK R+       K  AL+  PQKRGVC RVYT TP+KPNSALRKV + RLT+
Sbjct: 1   MPTISQLVRKGRE-KLNIKGKSPALKECPQKRGVCTRVYTTTPRKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVVM+ GGRVKDLPGV+Y +IRG LD+ GV NRKQ RS+YGA
Sbjct: 60  GIEVTSYIPGVGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDSVGVANRKQGRSKYGA 119

Query: 121 ERP 123
           +RP
Sbjct: 120 KRP 122


>gi|313905813|ref|ZP_07839171.1| ribosomal protein S12 [Eubacterium cellulosolvens 6]
 gi|313469327|gb|EFR64671.1| ribosomal protein S12 [Eubacterium cellulosolvens 6]
          Length = 137

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 99/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGS------------FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+ S            F +  K    + +PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRQTSAKKSTAPALQRTFNSLKKKAVEQSSPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NRKQARS+YGA+RPK
Sbjct: 121 ANRKQARSKYGAKRPK 136


>gi|254163270|ref|YP_003046378.1| 30S ribosomal protein S12 [Escherichia coli B str. REL606]
 gi|253975171|gb|ACT40842.1| 30S ribosomal protein S12 [Escherichia coli B str. REL606]
          Length = 124

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR     A + V AL   PQKRGVC RVYT TP KPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPTKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|69216533|gb|AAZ03932.1| ribosomal protein S12 [Ginkgo biloba]
          Length = 123

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+       K  ALRG PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRNARQ-PIENGTKSPALRGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSQYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|257784968|ref|YP_003180185.1| 30S ribosomal protein S12 [Atopobium parvulum DSM 20469]
 gi|257473475|gb|ACV51594.1| ribosomal protein S12 [Atopobium parvulum DSM 20469]
          Length = 142

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+NQL+RK R  S ++ +K  AL+ NPQKRGVC RV+T TPKKPNSALRKV + RL +
Sbjct: 20  LPTINQLVRKGRV-SVKSKSKNAALQHNPQKRGVCTRVFTTTPKKPNSALRKVARVRLVN 78

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y+V+RG  D   V+NR Q RSRYG 
Sbjct: 79  GIEVTAYIPGEGHNLQEHSIVLVRGGRVRDLPGVRYKVVRGAFDCAAVQNRAQGRSRYGT 138

Query: 121 ERPK 124
           +R K
Sbjct: 139 KRAK 142


>gi|295311779|ref|YP_003587447.1| ribosomal protein S12 [Oncidium Gower Ramsey]
 gi|295311785|ref|YP_003587489.1| ribosomal protein S12 [Oncidium Gower Ramsey]
 gi|254833156|gb|ACT83159.1| ribosomal protein S12 [Oncidium Gower Ramsey]
 gi|254833162|gb|ACT83165.1| ribosomal protein S12 [Oncidium Gower Ramsey]
          Length = 123

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNARQ-PIRNVTKYPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|22127853|ref|NP_671276.1| 30S ribosomal protein S12 [Yersinia pestis KIM 10]
 gi|45440059|ref|NP_991598.1| 30S ribosomal protein S12 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51597995|ref|YP_072186.1| 30S ribosomal protein S12 [Yersinia pseudotuberculosis IP 32953]
 gi|108809263|ref|YP_653179.1| 30S ribosomal protein S12 [Yersinia pestis Antiqua]
 gi|108814027|ref|YP_649794.1| 30S ribosomal protein S12 [Yersinia pestis Nepal516]
 gi|123444105|ref|YP_001008075.1| 30S ribosomal protein S12 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|150260751|ref|ZP_01917479.1| 30S ribosomal protein S12 [Yersinia pestis CA88-4125]
 gi|153950162|ref|YP_001402869.1| 30S ribosomal protein S12 [Yersinia pseudotuberculosis IP 31758]
 gi|162421204|ref|YP_001607997.1| 30S ribosomal protein S12 [Yersinia pestis Angola]
 gi|165927847|ref|ZP_02223679.1| ribosomal protein S12 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165940004|ref|ZP_02228540.1| ribosomal protein S12 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166010450|ref|ZP_02231348.1| ribosomal protein S12 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213290|ref|ZP_02239325.1| ribosomal protein S12 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167418992|ref|ZP_02310745.1| ribosomal protein S12 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425635|ref|ZP_02317388.1| ribosomal protein S12 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170022536|ref|YP_001719041.1| 30S ribosomal protein S12 [Yersinia pseudotuberculosis YPIII]
 gi|186897191|ref|YP_001874303.1| 30S ribosomal protein S12 [Yersinia pseudotuberculosis PB1/+]
 gi|218927407|ref|YP_002345282.1| 30S ribosomal protein S12 [Yersinia pestis CO92]
 gi|229836317|ref|ZP_04456484.1| 30S ribosomal subunit protein S12 [Yersinia pestis Pestoides A]
 gi|229840059|ref|ZP_04460218.1| 30S ribosomal subunit protein S12 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842141|ref|ZP_04462296.1| 30S ribosomal subunit protein S12 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229904559|ref|ZP_04519670.1| 30S ribosomal subunit protein S12 [Yersinia pestis Nepal516]
 gi|238752694|ref|ZP_04614165.1| 30S ribosomal protein S12 [Yersinia rohdei ATCC 43380]
 gi|238758757|ref|ZP_04619931.1| 30S ribosomal protein S12 [Yersinia aldovae ATCC 35236]
 gi|238763737|ref|ZP_04624696.1| 30S ribosomal protein S12 [Yersinia kristensenii ATCC 33638]
 gi|238783162|ref|ZP_04627188.1| 30S ribosomal protein S12 [Yersinia bercovieri ATCC 43970]
 gi|238788916|ref|ZP_04632706.1| 30S ribosomal protein S12 [Yersinia frederiksenii ATCC 33641]
 gi|270488226|ref|ZP_06205300.1| ribosomal protein S12 [Yersinia pestis KIM D27]
 gi|294502282|ref|YP_003566344.1| 30S ribosomal protein S12 [Yersinia pestis Z176003]
 gi|317494350|ref|ZP_07952764.1| ribosomal protein S12 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|332163266|ref|YP_004299843.1| 30S ribosomal protein S12 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|20140073|sp|Q8ZJB5|RS12_YERPE RecName: Full=30S ribosomal protein S12
 gi|60390796|sp|Q664R4|RS12_YERPS RecName: Full=30S ribosomal protein S12
 gi|119366818|sp|Q1C2T8|RS12_YERPA RecName: Full=30S ribosomal protein S12
 gi|119366819|sp|Q1CCT6|RS12_YERPN RecName: Full=30S ribosomal protein S12
 gi|158512899|sp|A1JS57|RS12_YERE8 RecName: Full=30S ribosomal protein S12
 gi|166991595|sp|A7FNP1|RS12_YERP3 RecName: Full=30S ribosomal protein S12
 gi|226712675|sp|B2K5N7|RS12_YERPB RecName: Full=30S ribosomal protein S12
 gi|226712676|sp|A9R464|RS12_YERPG RecName: Full=30S ribosomal protein S12
 gi|226712677|sp|B1JIV3|RS12_YERPY RecName: Full=30S ribosomal protein S12
 gi|21960987|gb|AAM87527.1|AE014001_16 30S ribosomal subunit protein S12 [Yersinia pestis KIM 10]
 gi|45434914|gb|AAS60475.1| 30S ribosomal protein S12 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51591277|emb|CAH22943.1| 30S ribosomal protein S12 [Yersinia pseudotuberculosis IP 32953]
 gi|108777675|gb|ABG20194.1| SSU ribosomal protein S12P [Yersinia pestis Nepal516]
 gi|108781176|gb|ABG15234.1| SSU ribosomal protein S12P [Yersinia pestis Antiqua]
 gi|115346018|emb|CAL18884.1| 30S ribosomal protein S12 [Yersinia pestis CO92]
 gi|122091066|emb|CAL13949.1| 30S ribosomal protein S12 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|149290159|gb|EDM40236.1| 30S ribosomal protein S12 [Yersinia pestis CA88-4125]
 gi|152961657|gb|ABS49118.1| ribosomal protein S12 [Yersinia pseudotuberculosis IP 31758]
 gi|162354019|gb|ABX87967.1| ribosomal protein S12 [Yersinia pestis Angola]
 gi|165912044|gb|EDR30685.1| ribosomal protein S12 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165920123|gb|EDR37424.1| ribosomal protein S12 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990540|gb|EDR42841.1| ribosomal protein S12 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205588|gb|EDR50068.1| ribosomal protein S12 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962986|gb|EDR59007.1| ribosomal protein S12 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167055325|gb|EDR65119.1| ribosomal protein S12 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749070|gb|ACA66588.1| ribosomal protein S12 [Yersinia pseudotuberculosis YPIII]
 gi|186700217|gb|ACC90846.1| ribosomal protein S12 [Yersinia pseudotuberculosis PB1/+]
 gi|229678677|gb|EEO74782.1| 30S ribosomal subunit protein S12 [Yersinia pestis Nepal516]
 gi|229690451|gb|EEO82505.1| 30S ribosomal subunit protein S12 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696425|gb|EEO86472.1| 30S ribosomal subunit protein S12 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229706385|gb|EEO92392.1| 30S ribosomal subunit protein S12 [Yersinia pestis Pestoides A]
 gi|238698039|gb|EEP90797.1| 30S ribosomal protein S12 [Yersinia kristensenii ATCC 33638]
 gi|238703054|gb|EEP95597.1| 30S ribosomal protein S12 [Yersinia aldovae ATCC 35236]
 gi|238709121|gb|EEQ01368.1| 30S ribosomal protein S12 [Yersinia rohdei ATCC 43380]
 gi|238715958|gb|EEQ07944.1| 30S ribosomal protein S12 [Yersinia bercovieri ATCC 43970]
 gi|238722943|gb|EEQ14593.1| 30S ribosomal protein S12 [Yersinia frederiksenii ATCC 33641]
 gi|262360362|gb|ACY57083.1| 30S ribosomal protein S12 [Yersinia pestis D106004]
 gi|262364314|gb|ACY60871.1| 30S ribosomal protein S12 [Yersinia pestis D182038]
 gi|270336730|gb|EFA47507.1| ribosomal protein S12 [Yersinia pestis KIM D27]
 gi|294352741|gb|ADE63082.1| 30S ribosomal protein S12 [Yersinia pestis Z176003]
 gi|316917600|gb|EFV38945.1| ribosomal protein S12 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|318607751|emb|CBY29249.1| SSU ribosomal protein S12p (S23e) [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|320013334|gb|ADV96905.1| 30S ribosomal subunit protein S12 [Yersinia pestis biovar
           Medievalis str. Harbin 35]
 gi|325667496|gb|ADZ44140.1| 30S ribosomal protein S12 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 124

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRSMKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|313683390|ref|YP_004061128.1| SSU ribosomal protein s12p [Sulfuricurvum kujiense DSM 16994]
 gi|313156250|gb|ADR34928.1| SSU ribosomal protein S12P [Sulfuricurvum kujiense DSM 16994]
          Length = 126

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R+   +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLIRKERQAVVKK-SKSPALVSCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GVK+RK +RS+YG 
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVKDRKVSRSKYGT 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|262410747|gb|ACY66809.1| synthetic 30S ribosomal subunit protein S12 [Cloning vector pLS975]
          Length = 156

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 97/122 (79%), Gaps = 1/122 (0%)

Query: 3   TVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSGV 62
           TVNQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+G 
Sbjct: 35  TVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGF 93

Query: 63  EVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGAER 122
           EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG +R
Sbjct: 94  EVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKR 153

Query: 123 PK 124
           PK
Sbjct: 154 PK 155


>gi|254458649|ref|ZP_05072073.1| ribosomal protein S12 [Campylobacterales bacterium GD 1]
 gi|207084415|gb|EDZ61703.1| ribosomal protein S12 [Campylobacterales bacterium GD 1]
          Length = 125

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  RK   +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLIRNERKRVVKK-SKSPALVSCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGR+KDLPGVKY ++RG LD  GV NR  ARS+YG 
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRIKDLPGVKYHIVRGALDTAGVANRTVARSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|88607878|ref|YP_505593.1| 30S ribosomal protein S12 [Anaplasma phagocytophilum HZ]
 gi|123736433|sp|Q2GJ58|RS12_ANAPZ RecName: Full=30S ribosomal protein S12
 gi|88598941|gb|ABD44411.1| ribosomal protein S12 [Anaplasma phagocytophilum HZ]
          Length = 124

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 82/123 (66%), Positives = 101/123 (82%), Gaps = 2/123 (1%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+PRK S  A  K  AL+ NPQKR VC++VYT TPKKPNSALRKV + R+  
Sbjct: 1   MPTINQLVRRPRKPSVSAN-KAPALQHNPQKRAVCVKVYTTTPKKPNSALRKVARVRIAG 59

Query: 61  -GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
            G EVIAY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD +GV+ RK+ARS+YG
Sbjct: 60  YGSEVIAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTKGVQGRKKARSKYG 119

Query: 120 AER 122
            +R
Sbjct: 120 VKR 122


>gi|291276553|ref|YP_003516325.1| 30S ribosomal protein S12 [Helicobacter mustelae 12198]
 gi|290963747|emb|CBG39582.1| 30S ribosomal protein S12 [Helicobacter mustelae 12198]
          Length = 128

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK + R   K  AL   PQ+RGVC RVYT TPKKPNSALRKV K +LTS
Sbjct: 1   MPTINQLIRKERKKATRK-TKSPALMECPQRRGVCTRVYTTTPKKPNSALRKVAKVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EVI+Y+PGEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV  R  +RS+YGA
Sbjct: 60  KIEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTSGVAKRTVSRSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|114329992|ref|YP_740629.1| ribosomal protein S12 [Nandina domestica]
 gi|114329993|ref|YP_740674.1| ribosomal protein S12 [Nandina domestica]
 gi|122165938|sp|Q09FT7|RR12_NANDO RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|114054494|gb|ABI49887.1| ribosomal protein S12 [Nandina domestica]
 gi|114054495|gb|ABI49888.1| ribosomal protein S12 [Nandina domestica]
          Length = 123

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   +   K  ALRG PQ++G C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIKNVTKSPALRGCPQRKGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|222056710|ref|YP_002539072.1| ribosomal protein S12 [Geobacter sp. FRC-32]
 gi|254811088|sp|B9M6V0|RS12_GEOSF RecName: Full=30S ribosomal protein S12
 gi|221565999|gb|ACM21971.1| ribosomal protein S12 [Geobacter sp. FRC-32]
          Length = 123

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  R+ S +  +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRIGRE-SKKDKSTAPALKCCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GVK+RK++RS+YGA
Sbjct: 60  GIEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSVGVKDRKKSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|323357408|ref|YP_004223804.1| ribosomal protein S12 [Microbacterium testaceum StLB037]
 gi|323273779|dbj|BAJ73924.1| ribosomal protein S12 [Microbacterium testaceum StLB037]
          Length = 122

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 79/122 (64%), Positives = 98/122 (80%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R     +  K  AL+ NPQ+ GVC RVYT TPKKPNSA+RKV + +L +
Sbjct: 1   MPTIQQLVRKGRSPKV-SKTKAPALKSNPQQAGVCTRVYTTTPKKPNSAMRKVARVKLRN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD Q VKNRKQARSRYGA
Sbjct: 60  GTEVTAYIPGEGHNLQEHSLVLVRGGRVKDLPGVRYKIVRGALDTQAVKNRKQARSRYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|121534754|ref|ZP_01666575.1| ribosomal protein S12 [Thermosinus carboxydivorans Nor1]
 gi|121306774|gb|EAX47695.1| ribosomal protein S12 [Thermosinus carboxydivorans Nor1]
          Length = 124

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+ +    +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRE-TVEKKSTAPALKECPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV  R Q RS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVAKRNQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|296131831|ref|YP_003639078.1| ribosomal protein S12 [Thermincola sp. JR]
 gi|296030409|gb|ADG81177.1| ribosomal protein S12 [Thermincola potens JR]
          Length = 125

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RK R+      +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLVRKSRQ-MVEKKSTAPALKECPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV+NR Q RS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTAGVQNRNQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|32480890|ref|NP_862732.1| ribosomal protein S12 [Calycanthus floridus var. glaucus]
 gi|32480904|ref|NP_862733.1| ribosomal protein S12 [Calycanthus floridus var. glaucus]
 gi|34500973|ref|NP_904078.1| ribosomal protein S12 [Amborella trichopoda]
 gi|52220857|ref|YP_086944.1| ribosomal protein S12 [Panax ginseng]
 gi|52220870|ref|YP_086945.1| ribosomal protein S12 [Panax ginseng]
 gi|89280659|ref|YP_514876.1| ribosomal protein S12 [Solanum lycopersicum]
 gi|91209035|ref|YP_538873.1| ribosomal protein S12 [Solanum bulbocastanum]
 gi|91209048|ref|YP_538872.1| ribosomal protein S12 [Solanum bulbocastanum]
 gi|108773194|ref|YP_635618.1| ribosomal protein S12 [Solanum tuberosum]
 gi|108773195|ref|YP_635663.1| ribosomal protein S12 [Solanum tuberosum]
 gi|114107179|ref|YP_740096.1| ribosomal protein S12 [Daucus carota]
 gi|114107192|ref|YP_740141.1| ribosomal protein S12 [Daucus carota]
 gi|149390586|ref|YP_001294163.1| ribosomal protein S12 [Buxus microphylla]
 gi|149390600|ref|YP_001294208.1| ribosomal protein S12 [Buxus microphylla]
 gi|167391829|ref|YP_001671662.1| ribosomal protein S12 [Carica papaya]
 gi|167391830|ref|YP_001671707.1| ribosomal protein S12 [Carica papaya]
 gi|68053103|sp|Q68S28|RR12_PANGI RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|68053176|sp|Q70XU7|RR12_AMBTC RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|68053198|sp|Q7Y677|RR12_CALFG RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|122246294|sp|Q0G9T8|RR12_DAUCA RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|122248367|sp|Q27S25|RR12_SOLTU RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|122248453|sp|Q2MIC2|RR12_SOLLC RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|122248456|sp|Q2MIK8|RR12_SOLBU RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|156633621|sp|A6MM15|RR12_BUXMI RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|158564133|sp|Q0ZIZ5|RR12_VITVI RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|32399426|emb|CAD28682.1| ribosomal protein S12 [Calycanthus floridus var. glaucus]
 gi|32399440|emb|CAD28781.1| ribosomal protein S12 [Calycanthus floridus var. glaucus]
 gi|34481688|emb|CAD45130.1| ribosomal protein S12 [Amborella trichopoda]
 gi|51235360|gb|AAT98556.1| ribosomal protein S12 [Panax ginseng]
 gi|51235373|gb|AAT98569.1| ribosomal protein S12 [Panax ginseng]
 gi|84371942|gb|ABC56260.1| ribosomal protein S12 [Solanum bulbocastanum]
 gi|84371955|gb|ABC56273.1| ribosomal protein S12 [Solanum bulbocastanum]
 gi|84372030|gb|ABC56347.1| ribosomal protein S12 [Solanum lycopersicum]
 gi|84372043|gb|ABC56360.1| ribosomal protein S12 [Solanum lycopersicum]
 gi|88656869|gb|ABD47122.1| ribosomal protein S12 [Solanum tuberosum]
 gi|88656870|gb|ABD47123.1| ribosomal protein S12 [Solanum tuberosum]
 gi|89241695|emb|CAJ32417.1| ribosomal protein S12 [Solanum lycopersicum]
 gi|113200954|gb|ABI32470.1| ribosomal protein S12 [Daucus carota]
 gi|113200967|gb|ABI32483.1| ribosomal protein S12 [Daucus carota]
 gi|113531109|emb|CAL36992.1| ribosomal protein S12 [Solanum lycopersicum]
 gi|146762331|gb|ABQ45295.1| ribosomal protein S12 [Buxus microphylla]
 gi|146762345|gb|ABQ45309.1| ribosomal protein S12 [Buxus microphylla]
 gi|156573691|gb|ABU85178.1| ribosomal protein S12 [Anethum graveolens]
 gi|166344156|gb|ABY86806.1| ribosomal protein S12 [Carica papaya]
 gi|166344157|gb|ABY86807.1| ribosomal protein S12 [Carica papaya]
 gi|290487432|gb|ADD30100.1| ribosomal protein S12 [Dillenia indica]
 gi|290487440|gb|ADD30104.1| ribosomal protein S12 [Meliosma aff. cuneifolia Moore 333]
 gi|290487442|gb|ADD30105.1| ribosomal protein S12 [Nelumbo nucifera]
 gi|290487452|gb|ADD30110.1| ribosomal protein S12 [Berberidopsis corallina]
 gi|290487456|gb|ADD30112.1| ribosomal protein S12 [Cornus florida]
 gi|290487462|gb|ADD30115.1| ribosomal protein S12 [Gunnera manicata]
 gi|290487464|gb|ADD30116.1| ribosomal protein S12 [Heuchera sanguinea]
 gi|290487476|gb|ADD30122.1| ribosomal protein S12 [Trochodendron aralioides]
          Length = 123

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|119468173|ref|ZP_01611299.1| 30S ribosomal protein S12 [Alteromonadales bacterium TW-7]
 gi|315125343|ref|YP_004067346.1| 30S ribosomal protein S12 [Pseudoalteromonas sp. SM9913]
 gi|119448166|gb|EAW29430.1| 30S ribosomal protein S12 [Alteromonadales bacterium TW-7]
 gi|315013856|gb|ADT67194.1| 30S ribosomal protein S12 [Pseudoalteromonas sp. SM9913]
 gi|332037826|gb|EGI74276.1| 30S ribosomal protein S12 [Pseudoalteromonas haloplanktis ANT/505]
          Length = 124

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+      +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRRSKVTK-SNSAALKACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV++  +RG LD  GV +R+QARS+YGA
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRFHTVRGALDCAGVSDRRQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|257455001|ref|ZP_05620246.1| ribosomal protein S12 [Enhydrobacter aerosaccus SK60]
 gi|257447573|gb|EEV22571.1| ribosomal protein S12 [Enhydrobacter aerosaccus SK60]
          Length = 124

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T NQLIRK R  +    +KV AL+  PQ+RGVC RVYT TPKKPNSA+RKV + RLTS
Sbjct: 1   MATTNQLIRKGRN-TITEKSKVPALKACPQRRGVCTRVYTTTPKKPNSAMRKVCRVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YGA
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|78103326|ref|YP_358553.1| ribosomal protein S12 [Phalaenopsis aphrodite subsp. formosana]
 gi|78103327|ref|YP_358552.1| ribosomal protein S12 [Phalaenopsis aphrodite subsp. formosana]
 gi|313199682|ref|YP_004021296.1| ribosomal protein S12 [Theobroma cacao]
 gi|313199726|ref|YP_004021340.1| ribosomal protein S12 [Theobroma cacao]
 gi|122249056|sp|Q3BAR5|RR12_PHAAO RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|58802856|gb|AAW82576.1| ribosomal protein S12 [Phalaenopsis aphrodite subsp. formosana]
 gi|58802857|gb|AAW82577.1| ribosomal protein S12 [Phalaenopsis aphrodite subsp. formosana]
 gi|309321246|gb|ADO64789.1| ribosomal protein S12 [Theobroma cacao]
 gi|309321290|gb|ADO64833.1| ribosomal protein S12 [Theobroma cacao]
 gi|328924804|gb|ADO64914.2| ribosomal protein S12 [Theobroma cacao]
 gi|328924837|gb|ADO64948.2| ribosomal protein S12 [Theobroma cacao]
          Length = 123

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNARQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|29839957|ref|NP_829063.1| 30S ribosomal protein S12 [Chlamydophila caviae GPIC]
 gi|62184830|ref|YP_219615.1| 30S ribosomal protein S12 [Chlamydophila abortus S26/3]
 gi|89898624|ref|YP_515734.1| 30S ribosomal protein S12 [Chlamydophila felis Fe/C-56]
 gi|329942511|ref|ZP_08291321.1| ribosomal protein S12 [Chlamydophila psittaci Cal10]
 gi|33301628|sp|Q824G2|RS12_CHLCV RecName: Full=30S ribosomal protein S12
 gi|81312993|sp|Q5L6S7|RS12_CHLAB RecName: Full=30S ribosomal protein S12
 gi|119366760|sp|Q253E9|RS12_CHLFF RecName: Full=30S ribosomal protein S12
 gi|29834304|gb|AAP04941.1| ribosomal protein S12 [Chlamydophila caviae GPIC]
 gi|62147897|emb|CAH63644.1| putative 30S ribosomal protein s12 [Chlamydophila abortus S26/3]
 gi|89331996|dbj|BAE81589.1| 30S ribosomal protein S12 [Chlamydophila felis Fe/C-56]
 gi|313847740|emb|CBY16730.1| putative 30S ribosomal protein s12 [Chlamydophila psittaci RD1]
 gi|325506559|gb|ADZ18197.1| 30S ribosomal protein S12 [Chlamydophila psittaci 6BC]
 gi|328815421|gb|EGF85409.1| ribosomal protein S12 [Chlamydophila psittaci Cal10]
 gi|328914387|gb|AEB55220.1| ribosomal protein S12 [Chlamydophila psittaci 6BC]
          Length = 123

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R+ S  +  K  AL+  PQ+RGVCL+V T TPKKPNSALRKV   RL++
Sbjct: 1   MPTINQLIRKKRQSSA-SRKKSPALQKCPQRRGVCLQVKTKTPKKPNSALRKVAWVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVIAY+ GEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD   VKNRKQ+RSRYGA
Sbjct: 60  GQEVIAYIGGEGHNLQEHSIVLVQGGRVKDLPGVRYHIVRGALDCAAVKNRKQSRSRYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|118579114|ref|YP_900364.1| 30S ribosomal protein S12 [Pelobacter propionicus DSM 2379]
 gi|158512560|sp|A1ALT6|RS12_PELPD RecName: Full=30S ribosomal protein S12
 gi|118501824|gb|ABK98306.1| SSU ribosomal protein S12P [Pelobacter propionicus DSM 2379]
          Length = 123

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  R+   R  +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRIGRENK-RDKSTAPALKCCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GVK+RK++RS+YGA
Sbjct: 60  GIEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSVGVKDRKKSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|4982071|gb|AAD36572.1|AE001799_4 ribosomal protein S12 [Thermotoga maritima MSB8]
          Length = 129

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  RK   +  +K  AL+GNPQKRGVC++V T+TPKKPNSALRK+ + RL++
Sbjct: 3   MPTINQLIRYGRK-PKKKKSKAPALQGNPQKRGVCIKVSTMTPKKPNSALRKIARVRLSN 61

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA GV+ R+Q+RS+YGA
Sbjct: 62  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDAAGVEGRRQSRSKYGA 121

Query: 121 ERPK 124
           +RPK
Sbjct: 122 KRPK 125


>gi|57242431|ref|ZP_00370369.1| ribosomal protein S12 [Campylobacter upsaliensis RM3195]
 gi|57016716|gb|EAL53499.1| ribosomal protein S12 [Campylobacter upsaliensis RM3195]
          Length = 129

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+NQL+RK RK      +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 3   VPTINQLVRKERKKILEK-SKSPALKNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 61

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV  R  +RS+YGA
Sbjct: 62  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGA 121

Query: 121 ERPK 124
           +RPK
Sbjct: 122 KRPK 125


>gi|189424405|ref|YP_001951582.1| 30S ribosomal protein S12 [Geobacter lovleyi SZ]
 gi|226708508|sp|B3E7T0|RS12_GEOLS RecName: Full=30S ribosomal protein S12
 gi|189420664|gb|ACD95062.1| ribosomal protein S12 [Geobacter lovleyi SZ]
          Length = 123

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR+ R+   R  +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRQGREKK-RDKSTAPALKSCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GVK R Q RS+YGA
Sbjct: 60  GIEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSVGVKGRMQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|254516901|ref|ZP_05128959.1| ribosomal protein S12 [gamma proteobacterium NOR5-3]
 gi|219674406|gb|EED30774.1| ribosomal protein S12 [gamma proteobacterium NOR5-3]
          Length = 123

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK      + V AL+G PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRKIEK-SDVPALQGCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RK  RS+YGA
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVADRKNGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|254553699|gb|ACT67308.1| ribosomal protein S12 [Joinvillea plicata]
          Length = 123

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTV QLIR  R+   R   K  AL+G PQ+RG C RVYT+ PKKPNSALRKV + RLTS
Sbjct: 1   MPTVKQLIRNARQ-PIRNVRKSAALKGCPQRRGTCARVYTINPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+YR+IRG LDA  VK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDAVAVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|33357889|pdb|1P6G|L Chain L, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 gi|33357966|pdb|1P87|L Chain L, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 gi|83754050|pdb|2AVY|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|83754106|pdb|2AW7|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 gi|118138064|pdb|2I2P|L Chain L, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|118138135|pdb|2I2U|L Chain L, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|157836034|pdb|2QOU|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The First 70s Ribosome,
           With Spectinomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|157836082|pdb|2QOW|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The Second 70s
           Ribosome, With Spectinomycin Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|157836138|pdb|2QOY|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 gi|157836186|pdb|2QP0|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 gi|158429709|pdb|2QAL|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429761|pdb|2QAN|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429819|pdb|2QB9|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429871|pdb|2QBB|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429923|pdb|2QBD|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           First 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429975|pdb|2QBF|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158430029|pdb|2QBH|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The First 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158430082|pdb|2QBJ|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The Second 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158431382|pdb|2Z4K|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The First 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158431435|pdb|2Z4M|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The Second 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|168988799|pdb|2VHO|L Chain L, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 3 Of 4)
 gi|168988820|pdb|2VHP|L Chain L, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 4 Of 4)
 gi|197107277|pdb|3DEG|D Chain D, Complex Of Elongating Escherichia Coli 70s Ribosome And
           Ef4(Lepa)-Gmppnp
 gi|197107289|pdb|3DF1|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|197107341|pdb|3DF3|L Chain L, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|218681842|pdb|3EP2|L Chain L, Model Of Phe-Trna(Phe) In The Ribosomal Pre-Accommodated
           State Revealed By Cryo-Em
 gi|218681860|pdb|3EQ3|L Chain L, Model Of Trna(Trp)-Ef-Tu In The Ribosomal Pre-Accommodated
           State Revealed By Cryo-Em
 gi|218681871|pdb|3EQ4|L Chain L, Model Of Trna(Leu)-Ef-Tu In The Ribosomal Pre-Accommodated
           State Revealed By Cryo-Em
 gi|224510713|pdb|3FIH|L Chain L, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 30s Subunit, Trnas And The Ternary
           Complex.
 gi|251837148|pdb|3IY8|L Chain L, Leishmania Tarentolae Mitonchondrial Ribosome Small
           Subunit
 gi|294662228|pdb|2WWL|L Chain L, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 30s, The P-Site
           Trna And The Tnac Leader Peptide (Part 1 Of 2).
 gi|308387976|pdb|3OFO|L Chain L, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|308387997|pdb|3OFP|L Chain L, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 gi|309320034|pdb|3OFA|L Chain L, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The First 70s Ribosome.
 gi|309320055|pdb|3OFB|L Chain L, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The Second 70s Ribosome.
 gi|309320138|pdb|3OFX|L Chain L, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|309320159|pdb|3OFY|L Chain L, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
 gi|315113623|pdb|3OAQ|L Chain L, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|315113644|pdb|3OAR|L Chain L, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 gi|329666003|pdb|3J00|L Chain L, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
          Length = 123

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 97/122 (79%), Gaps = 1/122 (0%)

Query: 3   TVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSGV 62
           TVNQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+G 
Sbjct: 2   TVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGF 60

Query: 63  EVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGAER 122
           EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG +R
Sbjct: 61  EVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKR 120

Query: 123 PK 124
           PK
Sbjct: 121 PK 122


>gi|225573399|ref|ZP_03782154.1| hypothetical protein RUMHYD_01591 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039209|gb|EEG49455.1| hypothetical protein RUMHYD_01591 [Blautia hydrogenotrophica DSM
           10507]
          Length = 137

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 100/136 (73%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKG------------SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+             S+ +  K T+   +PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRQTTVKKSTAPALQKSYNSLRKKTSDMSSPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NRKQARS+YGA+RPK
Sbjct: 121 ANRKQARSKYGAKRPK 136


>gi|297172931|gb|ADI23892.1| hypothetical protein [uncultured gamma proteobacterium
           HF4000_48J03]
          Length = 124

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK        V AL G PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MTTINQLVRKPRKRKVDK-NNVPALEGKPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV +RK +RS+YG 
Sbjct: 60  GYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDCSGVNDRKHSRSKYGT 119

Query: 121 ERPK 124
           ++P+
Sbjct: 120 KKPR 123


>gi|89095343|ref|ZP_01168260.1| ribosomal protein S12 [Oceanospirillum sp. MED92]
 gi|89080385|gb|EAR59640.1| ribosomal protein S12 [Oceanospirillum sp. MED92]
          Length = 124

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK   +  + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRKVQP-SDVRALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV  RKQ RS+YGA
Sbjct: 60  GFEVASYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCSGVNERKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|284009034|emb|CBA75983.1| 30S ribosomal protein S12 [Arsenophonus nasoniae]
          Length = 147

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR  +    + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 24  MATINQLVRKPRSSTV-VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 82

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YGA
Sbjct: 83  GYEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQGRSKYGA 142

Query: 121 ERPK 124
           ++PK
Sbjct: 143 KKPK 146


>gi|142850157|gb|ABO88478.1| ribosomal protein S12 [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 153

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 30  MATINQLVRKPRI-KLVVKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 88

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 89  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQARSKYGV 148

Query: 121 ERPK 124
           +RPK
Sbjct: 149 KRPK 152


>gi|148270417|ref|YP_001244877.1| 30S ribosomal protein S12 [Thermotoga petrophila RKU-1]
 gi|161579582|ref|NP_229305.2| 30S ribosomal protein S12 [Thermotoga maritima MSB8]
 gi|170289188|ref|YP_001739426.1| ribosomal protein S12 [Thermotoga sp. RQ2]
 gi|281412724|ref|YP_003346803.1| ribosomal protein S12 [Thermotoga naphthophila RKU-10]
 gi|14424464|sp|Q9X1J3|RS12_THEMA RecName: Full=30S ribosomal protein S12
 gi|166231894|sp|A5IM78|RS12_THEP1 RecName: Full=30S ribosomal protein S12
 gi|226712665|sp|B1LBP5|RS12_THESQ RecName: Full=30S ribosomal protein S12
 gi|147735961|gb|ABQ47301.1| SSU ribosomal protein S12P [Thermotoga petrophila RKU-1]
 gi|170176691|gb|ACB09743.1| ribosomal protein S12 [Thermotoga sp. RQ2]
 gi|281373827|gb|ADA67389.1| ribosomal protein S12 [Thermotoga naphthophila RKU-10]
          Length = 127

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 106/124 (85%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  RK   +  +K  AL+GNPQKRGVC++V T+TPKKPNSALRK+ + RL++
Sbjct: 1   MPTINQLIRYGRK-PKKKKSKAPALQGNPQKRGVCIKVSTMTPKKPNSALRKIARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y++IRG LDA GV+ R+Q+RS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDAAGVEGRRQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|54778765|gb|AAV39599.1| ribosomal protein S12 [synthetic construct]
          Length = 151

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 97/122 (79%), Gaps = 1/122 (0%)

Query: 3   TVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSGV 62
           TVNQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+G 
Sbjct: 27  TVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGF 85

Query: 63  EVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGAER 122
           EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG +R
Sbjct: 86  EVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKR 145

Query: 123 PK 124
           PK
Sbjct: 146 PK 147


>gi|296533983|ref|ZP_06896500.1| 30S ribosomal protein S12 [Roseomonas cervicalis ATCC 49957]
 gi|296265696|gb|EFH11804.1| 30S ribosomal protein S12 [Roseomonas cervicalis ATCC 49957]
          Length = 123

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 102/127 (80%), Gaps = 7/127 (5%)

Query: 1   MPTVNQLI---RKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKAR 57
           MPT+NQLI   R+P+        KV AL+G PQKRGVC RVYT TPKKPNSALRKV K R
Sbjct: 1   MPTINQLIANGREPKPSR----NKVPALQGCPQKRGVCTRVYTTTPKKPNSALRKVAKVR 56

Query: 58  LTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSR 117
           L +G+EV++Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD QG+  R++ RS 
Sbjct: 57  LVNGMEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGIAKRRKRRSL 116

Query: 118 YGAERPK 124
           YGA+RPK
Sbjct: 117 YGAKRPK 123


>gi|296274113|ref|YP_003656744.1| 30S ribosomal protein S12 [Arcobacter nitrofigilis DSM 7299]
 gi|296098287|gb|ADG94237.1| ribosomal protein S12 [Arcobacter nitrofigilis DSM 7299]
          Length = 127

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK      +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTINQLIRKERKRVVEK-SKSPALEKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV NR  ARS+YG 
Sbjct: 60  GYEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVANRTVARSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|119953178|ref|YP_945387.1| 30S ribosomal protein S12 [Borrelia turicatae 91E135]
 gi|254811070|sp|A1QZH5|RS12_BORT9 RecName: Full=30S ribosomal protein S12
 gi|119861949|gb|AAX17717.1| SSU ribosomal protein S12P [Borrelia turicatae 91E135]
          Length = 124

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPRK      A   AL+  PQ+RG+C RV TVTPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLIRKPRKSQKEKTAS-PALQNCPQRRGICTRVMTVTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG  D  GV NRKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGAKDTLGVNNRKQGRSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|139438561|ref|ZP_01772077.1| Hypothetical protein COLAER_01075 [Collinsella aerofaciens ATCC
           25986]
 gi|133776100|gb|EBA39920.1| Hypothetical protein COLAER_01075 [Collinsella aerofaciens ATCC
           25986]
          Length = 125

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R+ S    +K  AL+ N QKRGVC RV+T +PKKPNSALRKV + RL +
Sbjct: 1   MPTINQLVRQGRR-SVPKKSKNAALQHNSQKRGVCTRVFTTSPKKPNSALRKVARVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y VIRG  DA  V+NR QARS+YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVRDLPGVRYHVIRGAYDAAPVQNRMQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|226942772|ref|YP_002797845.1| 30S ribosomal protein S12 [Azotobacter vinelandii DJ]
 gi|259494641|sp|C1DKK7|RS12_AZOVD RecName: Full=30S ribosomal protein S12
 gi|226717699|gb|ACO76870.1| 30S ribosomal protein S12 [Azotobacter vinelandii DJ]
          Length = 123

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+R+PRK      + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRQPRK-RLVEKSDVPALQNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YGA
Sbjct: 60  GYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|113955318|ref|YP_729616.1| 30S ribosomal protein S12 [Synechococcus sp. CC9311]
 gi|119366815|sp|Q0ID56|RS12_SYNS3 RecName: Full=30S ribosomal protein S12
 gi|113882669|gb|ABI47627.1| ribosomal protein S12 [Synechococcus sp. CC9311]
          Length = 124

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ + +A  K  ALR  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRHERQ-TLKAKTKSPALRACPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+ G GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KAPK 123


>gi|149390332|ref|YP_001294122.1| ribosomal protein S12 [Chloranthus spicatus]
 gi|82754650|gb|ABB90064.1| ribosomal protein S12 [Solanum tuberosum]
 gi|146744252|gb|ABQ43324.1| ribosomal protein S12 [Chloranthus spicatus]
          Length = 123

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSQYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|290487430|gb|ADD30099.1| ribosomal protein S12 [Aucuba japonica]
          Length = 123

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVMKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|300718712|ref|YP_003743515.1| 30S ribosomal protein S12 [Erwinia billingiae Eb661]
 gi|299064548|emb|CAX61668.1| 30S ribosomal protein S12 [Erwinia billingiae Eb661]
          Length = 124

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|238018618|ref|ZP_04599044.1| hypothetical protein VEIDISOL_00453 [Veillonella dispar ATCC 17748]
 gi|269798555|ref|YP_003312455.1| ribosomal protein S12 [Veillonella parvula DSM 2008]
 gi|282849089|ref|ZP_06258477.1| ribosomal protein S12 [Veillonella parvula ATCC 17745]
 gi|294792788|ref|ZP_06757935.1| ribosomal protein S12 [Veillonella sp. 6_1_27]
 gi|303230113|ref|ZP_07316882.1| ribosomal protein S12 [Veillonella atypica ACS-134-V-Col7a]
 gi|303231173|ref|ZP_07317911.1| ribosomal protein S12 [Veillonella atypica ACS-049-V-Sch6]
 gi|313893230|ref|ZP_07826807.1| ribosomal protein S12 [Veillonella sp. oral taxon 158 str. F0412]
 gi|237865089|gb|EEP66379.1| hypothetical protein VEIDISOL_00453 [Veillonella dispar ATCC 17748]
 gi|269095184|gb|ACZ25175.1| ribosomal protein S12 [Veillonella parvula DSM 2008]
 gi|282581207|gb|EFB86602.1| ribosomal protein S12 [Veillonella parvula ATCC 17745]
 gi|294456687|gb|EFG25050.1| ribosomal protein S12 [Veillonella sp. 6_1_27]
 gi|302514080|gb|EFL56084.1| ribosomal protein S12 [Veillonella atypica ACS-049-V-Sch6]
 gi|302515174|gb|EFL57147.1| ribosomal protein S12 [Veillonella atypica ACS-134-V-Col7a]
 gi|313442583|gb|EFR60998.1| ribosomal protein S12 [Veillonella sp. oral taxon 158 str. F0412]
          Length = 124

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R  S    +   AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRM-SLTKKSTAPALQESPQKRGVCTRVYTATPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV+NR Q+RS+YGA
Sbjct: 60  AIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVQNRMQSRSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|153004769|ref|YP_001379094.1| 30S ribosomal protein S12 [Anaeromyxobacter sp. Fw109-5]
 gi|166231844|sp|A7HBL4|RS12_ANADF RecName: Full=30S ribosomal protein S12
 gi|152028342|gb|ABS26110.1| ribosomal protein S12 [Anaeromyxobacter sp. Fw109-5]
          Length = 123

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/123 (65%), Positives = 99/123 (80%), Gaps = 1/123 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RK R+       K  AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLVRKGRE-KLLTKKKAPALKESPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GV+ RKQ RS+YGA
Sbjct: 60  GFEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDAVGVQGRKQGRSKYGA 119

Query: 121 ERP 123
           +RP
Sbjct: 120 KRP 122


>gi|242278654|ref|YP_002990783.1| ribosomal protein S12 [Desulfovibrio salexigens DSM 2638]
 gi|259494645|sp|C6C181|RS12_DESAD RecName: Full=30S ribosomal protein S12
 gi|242121548|gb|ACS79244.1| ribosomal protein S12 [Desulfovibrio salexigens DSM 2638]
          Length = 123

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R+   +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRKGREKQLKR-KKTPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV +R+Q RS+YGA
Sbjct: 60  AIEVTAYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDTAGVADRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|94968249|ref|YP_590297.1| 30S ribosomal protein S12 [Candidatus Koribacter versatilis
           Ellin345]
 gi|119366753|sp|Q1ISC7|RS12_ACIBL RecName: Full=30S ribosomal protein S12
 gi|94550299|gb|ABF40223.1| SSU ribosomal protein S12P [Candidatus Koribacter versatilis
           Ellin345]
          Length = 124

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 99/125 (79%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRKG-SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT NQL+RK R    F+  +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT
Sbjct: 1   MPTFNQLVRKGRTAPKFKTASP--ALQSCPQKRGVCTRVYTQTPKKPNSALRKVARVRLT 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G+EV  Y+PG GHNLQEHS+V++ GGRVKDLPGV+Y V+RG LD+ GV NRKQ RS+YG
Sbjct: 59  NGIEVTTYIPGIGHNLQEHSIVLIRGGRVKDLPGVRYHVVRGTLDSVGVANRKQGRSKYG 118

Query: 120 AERPK 124
           A+RPK
Sbjct: 119 AKRPK 123


>gi|251787964|ref|YP_003002685.1| 30S ribosomal protein S12 [Dickeya zeae Ech1591]
 gi|271502253|ref|YP_003335279.1| 30S ribosomal protein S12 [Dickeya dadantii Ech586]
 gi|307132846|ref|YP_003884862.1| 30S ribosomal subunit protein S12 [Dickeya dadantii 3937]
 gi|247536585|gb|ACT05206.1| ribosomal protein S12 [Dickeya zeae Ech1591]
 gi|270345808|gb|ACZ78573.1| ribosomal protein S12 [Dickeya dadantii Ech586]
 gi|306530375|gb|ADN00306.1| 30S ribosomal subunit protein S12 [Dickeya dadantii 3937]
          Length = 124

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRSLKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|27151790|sp|P17293|RS12_THETH RecName: Full=30S ribosomal protein S12
 gi|48428594|sp|P61941|RS12_THET2 RecName: Full=30S ribosomal protein S12
 gi|62287395|sp|Q5SHN3|RS12_THET8 RecName: Full=30S ribosomal protein S12
 gi|110591334|pdb|2F4V|L Chain L, 30s Ribosome + Designer Antibiotic
 gi|119389723|pdb|2HGI|O Chain O, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           Showing How The 16s 3'-End Mimicks Mrna E And P Codons.
           This Entry 2hgi Contains 30s Ribosomal Subunit. The 50s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgj.
 gi|119389780|pdb|2HGP|O Chain O, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           With Translocated And Rotated Shine-Dalgarno Duplex.
           This Entry 2hgp Contains 30s Ribosomal Subunit. The 50s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgq.
 gi|119389836|pdb|2HGR|O Chain O, 70s T.Th. Ribosome Functional Complex With Mrna And E- And
           P-Site Trnas At 4.5a. This Entry 2hgr Contains 30s
           Ribosomal Subunit. The 50s Ribosomal Subunit Can Be
           Found In Pdb Entry 2hgu.
 gi|149242719|pdb|2OW8|MM Chain m, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
           Functional Interactions And Rearrangements. This File,
           2ow8, Contains The 30s Ribosome Subunit, Two Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File
           1vsa.
 gi|160285950|pdb|2QNH|MM Chain m, Interactions And Dynamics Of The Shine-Dalgarno Helix In
           The 70s Ribosome. This File, 2qnh, Contains The 30s
           Ribosome Subunit, Two Trna, And Mrna Molecules. 50s
           Ribosome Subunit Is In The File 1vsp.
 gi|211938830|pdb|2JL5|L Chain L, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome (Part 1 Of 4). This File
           Contains The 30s Subunit.
 gi|211938888|pdb|2JL7|L Chain L, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome (Part 3 Of 4). This File
           Contains The 30s Subunit.
 gi|237823540|pdb|2WH1|L Chain L, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 gi|237823599|pdb|2WH3|L Chain L, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome). This File Contains The
           30s Subunit.
 gi|260099997|pdb|3HUW|L Chain L, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 30s Subunit, Mrna, P-Site Trna And Ef-P For
           Molecule I.
 gi|260100053|pdb|3HUY|L Chain L, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 30s Subunit, Mrna, P-Site Trna And Ef-P For
           Molecule Ii.
 gi|261824495|pdb|2WRI|L Chain L, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State (Part 1 Of 4).
 gi|261824557|pdb|2WRK|L Chain L, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State (Part 3 Of 4).
 gi|281307178|pdb|3KIQ|LL Chain l, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 1 Of 4)
 gi|281307236|pdb|3KIS|LL Chain l, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 3 Of 4)
 gi|281307294|pdb|3KIU|LL Chain l, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 1 Of 4)
 gi|281307352|pdb|3KIX|LL Chain l, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 3 Of 4)
 gi|288965615|pdb|3KNH|L Chain L, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 30s Subunit For Molecule I
 gi|289526693|pdb|3KNJ|L Chain L, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 30s Subunit For Molecule Ii'
 gi|289526718|pdb|3KNL|L Chain L, The Structures Of Capreomycin Bound To The 70s Ribosome.
           This File Contains The 30s Subunit For Molecule I
 gi|289526743|pdb|3KNN|L Chain L, The Structures Of Capreomycin Bound To The 70s Ribosome.
           This File Contains The 30s Subunit For Molecule Ii
 gi|294979515|pdb|3I8G|O Chain O, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8g Contains 30s Ribosomal Subnit.The 50s
           Ribosomal Can Be Found In Pdb Entry 3i8f. Molecule B In
           The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
           (50s).
 gi|294979540|pdb|3I8H|O Chain O, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8h Contains 30s Ribosomal Subnit. The 50s
           Ribosomal Can Be Found In Pdb Entry 3i8i. Molecule A In
           The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
           (30s).
 gi|294979599|pdb|3I9B|O Chain O, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9b Contains 30s Ribosomal Subunit Of Molecule B.
           The 50s Subunit Can Be Found In Pdb Entry 3i9c. Molecule
           A In The S Asymmetric Unit Is Deposited As 3i9d (30s)
           And 3i9e (50s)
 gi|294979653|pdb|3I9D|O Chain O, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9d Contains 30s Ribosomal Subunit Of Molecule A.
           The 50s Subunit Can Be Found In Pdb Entry 3i9e. Molecule
           B In The S Asymmetric Unit Is Deposited As 3i9b (30s)
           And 3i9c (50s)
 gi|295982086|pdb|2X9R|L Chain L, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 gi|295982145|pdb|2X9T|L Chain L, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 gi|313754010|pdb|2XSY|L Chain L, Trna Tranlocation On The 70s Ribosome: The Pre-
           Translocational Translocation Intermediate Ti(Pre)
 gi|313754125|pdb|2XUY|L Chain L, Trna Tranlocation On The 70s Ribosome: The Post-
           Translocational Translocation Intermediate Ti(Post)
 gi|325533531|pdb|2Y0Y|L Chain L, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 gi|325533649|pdb|2Y12|L Chain L, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
          Length = 132

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 99/120 (82%), Gaps = 1/120 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   R  +KV AL+G P +RGVC  V TVTPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLVRKGRE-KVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGV DA GVK+RK++RS+YG 
Sbjct: 60  GYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGT 119


>gi|312130651|ref|YP_003997991.1| ssu ribosomal protein s12p [Leadbetterella byssophila DSM 17132]
 gi|311907197|gb|ADQ17638.1| SSU ribosomal protein S12P [Leadbetterella byssophila DSM 17132]
          Length = 137

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+ + +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTIQQLVRKGRE-TLQYNSKSPALDSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD  GV NRKQ RS+YGA
Sbjct: 60  QKEVNAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGALDTAGVNNRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|320352912|ref|YP_004194251.1| 30S ribosomal protein S12P [Desulfobulbus propionicus DSM 2032]
 gi|320121414|gb|ADW16960.1| SSU ribosomal protein S12P [Desulfobulbus propionicus DSM 2032]
          Length = 123

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  RK          AL+  PQKRGVC+RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRNRRK-KITKRTNTPALQNCPQKRGVCVRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV +R+Q RS+YGA
Sbjct: 60  GIEVTSYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTLGVNDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|315655891|ref|ZP_07908789.1| 30S ribosomal protein S12 [Mobiluncus curtisii ATCC 51333]
 gi|315489955|gb|EFU79582.1| 30S ribosomal protein S12 [Mobiluncus curtisii ATCC 51333]
          Length = 164

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+ QL+ + R  S R  +K  AL G+PQ+RGVC RVYT TPKKPNSALRKV + RL+S
Sbjct: 41  VPTIEQLVHQGRT-SKRTKSKTPALAGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLSS 99

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGV++RKQ RS+YGA
Sbjct: 100 GIEVSAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVRDRKQGRSKYGA 159

Query: 121 ERPK 124
           ++ K
Sbjct: 160 KKEK 163


>gi|169794097|ref|YP_001718416.1| ribosomal protein S12 [Manihot esculenta]
 gi|169794131|ref|YP_001718461.1| ribosomal protein S12 [Manihot esculenta]
 gi|313183846|ref|YP_004021644.1| ribosomal protein S12 [Prunus persica]
 gi|313183880|ref|YP_004021689.1| ribosomal protein S12 [Prunus persica]
 gi|325126889|ref|YP_004286081.1| ribosomal protein S12 [Fragaria vesca subsp. vesca]
 gi|325126924|ref|YP_004286126.1| ribosomal protein S12 [Fragaria vesca subsp. vesca]
 gi|326909449|ref|YP_004327686.1| ribosomal protein S12 [Hevea brasiliensis]
 gi|326909456|ref|YP_004327641.1| ribosomal protein S12 [Hevea brasiliensis]
 gi|157695909|gb|ABV66178.1| ribosomal protein S12 [Manihot esculenta]
 gi|157695943|gb|ABV66212.1| ribosomal protein S12 [Manihot esculenta]
 gi|290487474|gb|ADD30121.1| ribosomal protein S12 [Staphylea colchica]
 gi|308523563|gb|ADO33613.1| ribosomal protein S12 [Hevea brasiliensis]
 gi|308523570|gb|ADO33620.1| ribosomal protein S12 [Hevea brasiliensis]
 gi|309321458|gb|ADO64999.1| ribosomal protein S12 [Prunus persica]
 gi|309321492|gb|ADO65033.1| ribosomal protein S12 [Prunus persica]
 gi|324022801|gb|ADY15375.1| ribosomal protein S12 [Fragaria vesca subsp. vesca]
 gi|324022836|gb|ADY15410.1| ribosomal protein S12 [Fragaria vesca subsp. vesca]
          Length = 123

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  AL G PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVTKSPALGGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|168700812|ref|ZP_02733089.1| 30S ribosomal protein S12 [Gemmata obscuriglobus UQM 2246]
          Length = 124

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/122 (65%), Positives = 103/122 (84%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI+ PR    R+  K  A++G PQKRGVC  V T+TPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLIKSPRVPQ-RSKPKHPAMQGCPQKRGVCTVVKTMTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRV+DLPGV+Y ++RGVLD+QGV +RKQARS+YGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVRDLPGVRYHIVRGVLDSQGVTDRKQARSKYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|88704388|ref|ZP_01102102.1| 30S ribosomal protein S12 [Congregibacter litoralis KT71]
 gi|88701439|gb|EAQ98544.1| 30S ribosomal protein S12 [Congregibacter litoralis KT71]
          Length = 123

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK      + V AL+G PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRKIEK-SDVPALQGCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RK  RS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVADRKNGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|317046197|ref|YP_004072486.1| ribosomal protein S12 [Corynocarpus laevigata]
 gi|317046235|ref|YP_004072441.1| ribosomal protein S12 [Corynocarpus laevigata]
 gi|309252914|gb|ADO60334.1| ribosomal protein S12 [Corynocarpus laevigata]
 gi|309252952|gb|ADO60372.1| ribosomal protein S12 [Corynocarpus laevigata]
          Length = 123

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+       K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQPIIN-FTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|327479319|gb|AEA82629.1| 30S ribosomal protein S12 [Pseudomonas stutzeri DSM 4166]
          Length = 123

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+R+PRK      + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRQPRKRVVEK-SDVPALQNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YGA
Sbjct: 60  GYEVASYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|90020573|ref|YP_526400.1| 30S ribosomal protein S12 [Saccharophagus degradans 2-40]
 gi|119366804|sp|Q21M91|RS12_SACD2 RecName: Full=30S ribosomal protein S12
 gi|89950173|gb|ABD80188.1| SSU ribosomal protein S12P [Saccharophagus degradans 2-40]
          Length = 123

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK   +  + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRKVQK-SDVPALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RKQ RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVSDRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|237743824|ref|ZP_04574305.1| SSU ribosomal protein S12P [Fusobacterium sp. 7_1]
 gi|256028161|ref|ZP_05441995.1| 30S ribosomal protein S12 [Fusobacterium sp. D11]
 gi|260495821|ref|ZP_05815942.1| ribosomal protein S12 [Fusobacterium sp. 3_1_33]
 gi|289766094|ref|ZP_06525472.1| SSU ribosomal protein S12P [Fusobacterium sp. D11]
 gi|229432855|gb|EEO43067.1| SSU ribosomal protein S12P [Fusobacterium sp. 7_1]
 gi|260196668|gb|EEW94194.1| ribosomal protein S12 [Fusobacterium sp. 3_1_33]
 gi|289717649|gb|EFD81661.1| SSU ribosomal protein S12P [Fusobacterium sp. D11]
          Length = 122

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 99/121 (81%), Gaps = 1/121 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL++K R+ +     K  AL+GNPQ+RGVC+RVYT TPKKPNSALRKV + +LT+
Sbjct: 1   MPTLSQLVKKGRQ-TLTEKKKSPALQGNPQRRGVCIRVYTTTPKKPNSALRKVARVKLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PGEGHNLQEHS+V++ GGR KDLPGV+Y++IRG LD  GV  RKQ RSRYGA
Sbjct: 60  GIEVTCYIPGEGHNLQEHSIVLVRGGRTKDLPGVRYKIIRGALDTAGVAKRKQGRSRYGA 119

Query: 121 E 121
           +
Sbjct: 120 K 120


>gi|190572939|ref|YP_001970784.1| 30S ribosomal protein S12 [Stenotrophomonas maltophilia K279a]
 gi|194364529|ref|YP_002027139.1| 30S ribosomal protein S12 [Stenotrophomonas maltophilia R551-3]
 gi|254524311|ref|ZP_05136366.1| ribosomal protein S12 [Stenotrophomonas sp. SKA14]
 gi|226712656|sp|B4SKV8|RS12_STRM5 RecName: Full=30S ribosomal protein S12
 gi|226712657|sp|B2FQ40|RS12_STRMK RecName: Full=30S ribosomal protein S12
 gi|190010861|emb|CAQ44470.1| putative 30S ribosomal protein S12 [Stenotrophomonas maltophilia
           K279a]
 gi|194347333|gb|ACF50456.1| ribosomal protein S12 [Stenotrophomonas maltophilia R551-3]
 gi|219721902|gb|EED40427.1| ribosomal protein S12 [Stenotrophomonas sp. SKA14]
          Length = 124

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+ +    A   AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MATINQLVRKPRQATTYKSAS-PALDKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LDA GV  R+QARS+YGA
Sbjct: 60  QEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|117617539|ref|YP_858449.1| 30S ribosomal protein S12 [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|162209425|ref|YP_001140226.2| 30S ribosomal protein S12 [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|330831420|ref|YP_004394372.1| 30S ribosomal protein S12 [Aeromonas veronii B565]
 gi|158512306|sp|A0KQ98|RS12_AERHH RecName: Full=30S ribosomal protein S12
 gi|158514190|sp|A4SHV6|RS12_AERS4 RecName: Full=30S ribosomal protein S12
 gi|117558946|gb|ABK35894.1| ribosomal protein S12 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|328806556|gb|AEB51755.1| 30S ribosomal protein S12 [Aeromonas veronii B565]
          Length = 124

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRI-KLVVKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQARSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|242237852|ref|YP_002986033.1| ribosomal protein S12 [Dickeya dadantii Ech703]
 gi|242129909|gb|ACS84211.1| ribosomal protein S12 [Dickeya dadantii Ech703]
          Length = 124

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|312898073|ref|ZP_07757476.1| ribosomal protein S12 [Megasphaera micronuciformis F0359]
 gi|310620843|gb|EFQ04400.1| ribosomal protein S12 [Megasphaera micronuciformis F0359]
          Length = 123

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+ S +  +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRQTSVKK-STAPALKECPQKRGVCTRVYTATPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV +RKQ+RS+YGA
Sbjct: 60  SIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQSRSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKSK 123


>gi|152977966|ref|YP_001343595.1| 30S ribosomal protein S12 [Actinobacillus succinogenes 130Z]
 gi|150839689|gb|ABR73660.1| ribosomal protein S12 [Actinobacillus succinogenes 130Z]
          Length = 142

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 19  MATINQLVRKPRVKKV-VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTN 77

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG 
Sbjct: 78  GYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQARSKYGV 137

Query: 121 ERPK 124
           +RPK
Sbjct: 138 KRPK 141


>gi|297567289|ref|YP_003686261.1| 30S ribosomal protein S12 [Meiothermus silvanus DSM 9946]
 gi|296851738|gb|ADH64753.1| ribosomal protein S12 [Meiothermus silvanus DSM 9946]
          Length = 137

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/123 (65%), Positives = 102/123 (82%), Gaps = 1/123 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+NQL+RK R    +  +KV AL+G+P +RGVC  V TVTPKKPNSALRKV K RL+S
Sbjct: 4   LPTINQLLRKGRAPVIKK-SKVPALKGSPFRRGVCTVVRTVTPKKPNSALRKVAKVRLSS 62

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGV D QGVK+RK++RS+YGA
Sbjct: 63  QYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVFDTQGVKDRKKSRSKYGA 122

Query: 121 ERP 123
           ++P
Sbjct: 123 KKP 125


>gi|222084108|ref|YP_002519511.1| ribosomal protein S12 [Keteleeria davidiana]
 gi|220983660|dbj|BAH11426.1| ribosomal protein S12 [Keteleeria davidiana]
          Length = 123

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+       K  ALRG PQ+RGVC RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRNARQ-PIETRKKSPALRGCPQRRGVCARVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG  HNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIDHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAAGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|194477019|ref|YP_002049198.1| 30S ribosomal protein S12 [Paulinella chromatophora]
 gi|171192026|gb|ACB42988.1| 30S ribosomal protein S12 [Paulinella chromatophora]
          Length = 124

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLI+  R    R   K  ALR  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIQTERTRLTRK-TKSPALRACPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GVKNR+Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKNRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KTPK 123


>gi|88807941|ref|ZP_01123452.1| 30S ribosomal protein S12 [Synechococcus sp. WH 7805]
 gi|148238718|ref|YP_001224105.1| 30S ribosomal protein S12 [Synechococcus sp. WH 7803]
 gi|158513312|sp|A5GIP3|RS12_SYNPW RecName: Full=30S ribosomal protein S12
 gi|88787980|gb|EAR19136.1| 30S ribosomal protein S12 [Synechococcus sp. WH 7805]
 gi|147847257|emb|CAK22808.1| 30S ribosomal protein S12 [Synechococcus sp. WH 7803]
          Length = 124

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ S +A  K  AL+  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRTERQSS-KAKTKSPALKSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+ G GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KTPK 123


>gi|229542209|ref|ZP_04431269.1| ribosomal protein S12 [Bacillus coagulans 36D1]
 gi|229326629|gb|EEN92304.1| ribosomal protein S12 [Bacillus coagulans 36D1]
          Length = 139

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/136 (58%), Positives = 99/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKG------------SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT+NQL+RKPRK              + +  K+     +PQKRGVC RV T+TPKKPNS
Sbjct: 1   MPTINQLVRKPRKSKIEKSKSPALNKGYNSFKKINTDLSSPQKRGVCTRVGTMTPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK  + RLT+G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV
Sbjct: 61  ALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NRKQ RS+YG ++PK
Sbjct: 121 DNRKQGRSKYGTKKPK 136


>gi|290487468|gb|ADD30118.1| ribosomal protein S12 [Oxalis latifolia]
          Length = 123

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNIRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|158564294|sp|Q2LQ85|RS12_SYNAS RecName: Full=30S ribosomal protein S12
          Length = 123

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/125 (65%), Positives = 101/125 (80%), Gaps = 5/125 (4%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVT--ALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           MPT+NQL+R    G  RA  K +  AL G+PQ+RGVC+RVYT TPKKPNSALRKV + RL
Sbjct: 1   MPTINQLVRN---GRLRAAKKASTPALAGSPQRRGVCVRVYTSTPKKPNSALRKVARVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           TS  EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GV++RKQ RS+Y
Sbjct: 58  TSRYEVTSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVQDRKQGRSKY 117

Query: 119 GAERP 123
           GA++P
Sbjct: 118 GAKKP 122


>gi|108796740|ref|YP_636468.1| ribosomal protein S12 [Zygnema circumcarinatum]
 gi|122233023|sp|Q32RQ9|RR12_ZYGCR RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|61393724|gb|AAX45866.1| ribosomal protein S12 [Zygnema circumcarinatum]
          Length = 123

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ + +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRNTRQPT-QNRTKSPALKACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDA GVK+R Q RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAVGVKDRHQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|116227369|gb|ABJ86078.1| SSU ribosomal protein S12P [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 144

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT NQL+R  RK   R      AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 21  VPTFNQLVRNGRKPP-RWKTSSPALESCPQKRGVCTRVYTSTPKKPNSALRKVARVRLTN 79

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PG GHNLQEHS+V++ GGRVKDLPGV+Y VIRG LD  GV NRKQ+RS+YGA
Sbjct: 80  GIEVTTYIPGVGHNLQEHSIVLIRGGRVKDLPGVRYHVIRGALDTAGVANRKQSRSKYGA 139

Query: 121 ERPK 124
           +RPK
Sbjct: 140 KRPK 143


>gi|237753294|ref|ZP_04583774.1| 30S ribosomal protein S12 [Helicobacter winghamensis ATCC BAA-430]
 gi|229375561|gb|EEO25652.1| 30S ribosomal protein S12 [Helicobacter winghamensis ATCC BAA-430]
          Length = 130

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK   +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLIRKERKKVIKK-SKSPALVVCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGEGHNLQEHS+V++ GGRV+DLPGVKY +IRG LD  GV  R  +RS+YGA
Sbjct: 60  GFEVISYIPGEGHNLQEHSIVLIRGGRVRDLPGVKYHIIRGALDTAGVAKRTVSRSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|13518409|ref|NP_084768.1| ribosomal protein S12 [Oenothera elata subsp. hookeri]
 gi|169142734|ref|YP_001687161.1| ribosomal protein S12 [Oenothera argillicola]
 gi|169142773|ref|YP_001687116.1| ribosomal protein S12 [Oenothera argillicola]
 gi|169142884|ref|YP_001687307.1| ribosomal protein S12 [Oenothera glazioviana]
 gi|169142923|ref|YP_001687262.1| ribosomal protein S12 [Oenothera glazioviana]
 gi|169142969|ref|YP_001687391.1| ribosomal protein S12 [Oenothera biennis]
 gi|169143008|ref|YP_001687346.1| ribosomal protein S12 [Oenothera biennis]
 gi|169143055|ref|YP_001687475.1| ribosomal protein S12 [Oenothera parviflora]
 gi|169143094|ref|YP_001687430.1| ribosomal protein S12 [Oenothera parviflora]
 gi|14423921|sp|Q9MDK3|RR12_OENEH RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|6723773|emb|CAB67182.1| ribosomal protein S12 [Oenothera elata subsp. hookeri]
 gi|159792972|gb|ABW98728.1| ribosomal protein S12 [Oenothera argillicola]
 gi|159793011|gb|ABW98767.1| ribosomal protein S12 [Oenothera argillicola]
 gi|159793142|gb|ABW98896.1| ribosomal protein S12 [Oenothera biennis]
 gi|159793181|gb|ABW98935.1| ribosomal protein S12 [Oenothera biennis]
 gi|159895496|gb|ABX10061.1| ribosomal protein S12 [Oenothera glazioviana]
 gi|159895535|gb|ABX10100.1| ribosomal protein S12 [Oenothera glazioviana]
 gi|159895581|gb|ABX10145.1| ribosomal protein S12 [Oenothera parviflora]
 gi|159895620|gb|ABX10184.1| ribosomal protein S12 [Oenothera parviflora]
          Length = 123

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+ PKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCTRVYTINPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|315650212|ref|ZP_07903287.1| 30S ribosomal protein S12 [Eubacterium saburreum DSM 3986]
 gi|315487569|gb|EFU77877.1| 30S ribosomal protein S12 [Eubacterium saburreum DSM 3986]
          Length = 167

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 99/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGS------------FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+ S            F +  K +    +PQKRGVC  V T TPKKPNS
Sbjct: 29  MPTFNQLVRKGRQTSERKSTAPALQKGFNSLHKRSTDISSPQKRGVCTAVKTATPKKPNS 88

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 89  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGV 148

Query: 109 KNRKQARSRYGAERPK 124
            NRKQARS+YGA+RPK
Sbjct: 149 ANRKQARSKYGAKRPK 164


>gi|119478602|ref|ZP_01618524.1| 30S ribosomal protein S12 [marine gamma proteobacterium HTCC2143]
 gi|119448437|gb|EAW29687.1| 30S ribosomal protein S12 [marine gamma proteobacterium HTCC2143]
          Length = 123

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK   +  + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRKVQK-SDVPALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +R+Q RS+YGA
Sbjct: 60  GYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVTDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|133747|sp|P09899|RS12_MICLU RecName: Full=30S ribosomal protein S12
 gi|149851|gb|AAA25317.1| ribosomal protein S12 (gtg start codon) [Micrococcus luteus]
          Length = 124

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R           AL+GNP +RGVC RVYT TP KPNSA+RKV + RL  
Sbjct: 1   MPTIQQLVRKGRSPKV-VNTNGPALQGNPMRRGVCTRVYTTTPTKPNSAVRKVARVRLNG 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y+++RG LD QGVKNR QARSRYGA
Sbjct: 60  GIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDTQGVKNRGQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|331002973|ref|ZP_08326485.1| 30S ribosomal protein S12 [Lachnospiraceae oral taxon 107 str.
           F0167]
 gi|330413017|gb|EGG92392.1| 30S ribosomal protein S12 [Lachnospiraceae oral taxon 107 str.
           F0167]
          Length = 139

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 99/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGS------------FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+ S            F +  K +    +PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRQTSERKSTAPALQKGFNSLHKKSTDISSPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NRKQARS+YGA+RPK
Sbjct: 121 ANRKQARSKYGAKRPK 136


>gi|286143142|gb|ADC41601.1| 30S ribosomal protein S12 [Streptomyces limosus]
          Length = 109

 Score =  165 bits (418), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 76/102 (74%), Positives = 91/102 (89%)

Query: 21  KVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSGVEVIAYVPGEGHNLQEHSV 80
           K  AL G+PQ+RGVC RV+T TPKKPNSALRKV + RLTSG+EV AY+PGEGHNLQEHS+
Sbjct: 8   KTPALEGSPQRRGVCTRVFTTTPKKPNSALRKVARVRLTSGIEVTAYIPGEGHNLQEHSI 67

Query: 81  VMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGAER 122
           V++ GGRV+DLPGV+Y++IRG LD QGVKNRKQARSRYGA++
Sbjct: 68  VLVRGGRVRDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKK 109


>gi|291619184|ref|YP_003521926.1| RpsL [Pantoea ananatis LMG 20103]
 gi|291154214|gb|ADD78798.1| RpsL [Pantoea ananatis LMG 20103]
 gi|327395514|dbj|BAK12936.1| 30S ribosomal protein S12 RpsL [Pantoea ananatis AJ13355]
          Length = 124

 Score =  165 bits (418), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 84/126 (66%), Positives = 99/126 (78%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAK--VTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           M TVNQL+RKPR    R  AK  V AL   PQKRGVC RVYT TPKKPNSALRKV + RL
Sbjct: 1   MATVNQLVRKPR---VRKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           T+G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+Y
Sbjct: 58  TNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKY 117

Query: 119 GAERPK 124
           G ++PK
Sbjct: 118 GVKKPK 123


>gi|71842335|ref|YP_277423.1| ribosomal protein S12 [Emiliania huxleyi]
 gi|122233601|sp|Q4G344|RR12_EMIHU RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|60101578|gb|AAX13922.1| ribosomal protein S12 [Emiliania huxleyi]
          Length = 125

 Score =  165 bits (418), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+R  R+ S +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRFERQTSEKK-TKSPALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHN+QEHSVV++ GGRVKDLPG +Y V+RG LDA GVK+RKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNIQEHSVVLIRGGRVKDLPGCRYHVVRGSLDASGVKDRKQGRSKYGG 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|78484635|ref|YP_390560.1| 30S ribosomal protein S12 [Thiomicrospira crunogena XCL-2]
 gi|118597403|sp|Q31IY7|RS12_THICR RecName: Full=30S ribosomal protein S12
 gi|78362921|gb|ABB40886.1| SSU ribosomal protein S12P [Thiomicrospira crunogena XCL-2]
          Length = 124

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK   +  + V AL   PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKDKMKK-SNVPALEACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GV  RKQ RS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGSLDCAGVDGRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|297170812|gb|ADI21832.1| hypothetical protein [uncultured gamma proteobacterium
           HF0130_25M15]
          Length = 124

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (77%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAK--VTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           M T+NQL+RK RK   R   K  V AL G PQKRGVC RVYT TPKKPNSALRKV + RL
Sbjct: 1   MTTINQLVRKSRK---RKVIKNNVPALEGKPQKRGVCTRVYTTTPKKPNSALRKVARVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           T+G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  IRG LD  GV +RKQ RS+Y
Sbjct: 58  TNGYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTIRGALDCSGVNDRKQGRSKY 117

Query: 119 GAERPK 124
           GA++PK
Sbjct: 118 GAKKPK 123


>gi|322418359|ref|YP_004197582.1| 30S ribosomal protein S12 [Geobacter sp. M18]
 gi|320124746|gb|ADW12306.1| ribosomal protein S12 [Geobacter sp. M18]
          Length = 123

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  R+      +   ALR  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRHGRESKGEK-STAPALRSCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GVK R ++RS+YGA
Sbjct: 60  GVEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSVGVKGRMKSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|33151838|ref|NP_873191.1| 30S ribosomal protein S12 [Haemophilus ducreyi 35000HP]
 gi|7388118|sp|Q9Z6D2|RS12_HAEDU RecName: Full=30S ribosomal protein S12
 gi|4322482|gb|AAD16057.1| 30S ribosomal protein S12 [Haemophilus ducreyi]
 gi|33148059|gb|AAP95580.1| 30S ribosomal protein S12 [Haemophilus ducreyi 35000HP]
          Length = 124

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRVKKV-VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YG 
Sbjct: 60  GFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|282599829|ref|ZP_05972044.2| ribosomal protein S12 [Providencia rustigianii DSM 4541]
 gi|282567303|gb|EFB72838.1| ribosomal protein S12 [Providencia rustigianii DSM 4541]
          Length = 145

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RK R       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 22  MATINQLVRKSRSSKV-VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 80

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YGA
Sbjct: 81  GFEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGA 140

Query: 121 ERPK 124
           ++PK
Sbjct: 141 KKPK 144


>gi|147676650|ref|YP_001210865.1| 30S ribosomal protein S12 [Pelotomaculum thermopropionicum SI]
 gi|189040469|sp|A5D5I5|RS12_PELTS RecName: Full=30S ribosomal protein S12
 gi|146272747|dbj|BAF58496.1| ribosomal protein S12 [Pelotomaculum thermopropionicum SI]
          Length = 124

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QLIRK R+ + +  A   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLIRKGREEAVKKSA-APALKECPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GV+NR + RS+YG 
Sbjct: 60  GIEVTSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDSAGVQNRNRGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|88861462|ref|ZP_01136089.1| 30S ribosomal protein S12 [Pseudoalteromonas tunicata D2]
 gi|88816544|gb|EAR26372.1| 30S ribosomal protein S12 [Pseudoalteromonas tunicata D2]
          Length = 124

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+      +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRRSKV-VKSNSAALKACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV++  IRG LD  GV  R+QARS+YGA
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRFHTIRGALDCAGVSARRQARSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|290487458|gb|ADD30113.1| ribosomal protein S12 [Euonymus americanus]
          Length = 123

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   +   K  ALRG PQ+RG C+RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTLKQLIRNTRQ-PIKNVTKSPALRGCPQRRGTCIRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|304310011|ref|YP_003809609.1| 30S ribosomal protein S12 [gamma proteobacterium HdN1]
 gi|301795744|emb|CBL43943.1| 30S ribosomal protein S12 [gamma proteobacterium HdN1]
          Length = 131

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR       + V AL+G PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 6   MATVNQLVRKPRSPKVEK-SDVPALQGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 64

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV  Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GV NRKQARS+YG 
Sbjct: 65  GYEVTTYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGTLDTAGVNNRKQARSKYGT 124

Query: 121 ERPK 124
           +R K
Sbjct: 125 KRGK 128


>gi|108796842|ref|YP_636364.1| ribosomal protein S12 [Staurastrum punctulatum]
 gi|122245553|sp|Q32S12|RR12_STAPU RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|61393610|gb|AAX45751.1| ribosomal protein S12 [Staurastrum punctulatum]
          Length = 123

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+ +     K  ALR  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRNSRQPAENR-TKSPALRACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSV+++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVILVRGGRVKDLPGVRYHIVRGTLDAVGVKDRRQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|330850605|ref|YP_004376486.1| ribosomal protein S12 [Ptilidium pulcherrimum]
 gi|302024734|gb|ADK89580.1| ribosomal protein S12 [Ptilidium pulcherrimum]
          Length = 123

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+      AK  ALRG PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRNKRQ-PIENRAKSPALRGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDA GVK+R Q RS+YG 
Sbjct: 60  GFEITAYIPGMGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGTLDAVGVKDRHQGRSKYGV 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKSK 123


>gi|172048406|sp|A8Z6I5|RS12_CAMC1 RecName: Full=30S ribosomal protein S12
 gi|158604948|gb|ABW74765.1| ribosomal protein S12 [Campylobacter concisus 13826]
          Length = 131

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  RK      +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLVRNERK-KVTVKSKSPALKECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV  R  +RS+YGA
Sbjct: 60  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|124003866|ref|ZP_01688714.1| ribosomal protein S12 [Microscilla marina ATCC 23134]
 gi|123990921|gb|EAY30388.1| ribosomal protein S12 [Microscilla marina ATCC 23134]
          Length = 126

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK RK +  + +K  AL   PQ+RGVC RVYT TPKKPNSA+RKV + RLT+
Sbjct: 1   MPTIQQLVRKGRK-TLTSKSKSPALDRCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y +IRG LD  GV+ R Q RS+YGA
Sbjct: 60  GKEVNAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIIRGALDTAGVEGRSQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|325283653|ref|YP_004256194.1| ribosomal protein S12 [Deinococcus proteolyticus MRP]
 gi|324315462|gb|ADY26577.1| ribosomal protein S12 [Deinococcus proteolyticus MRP]
          Length = 154

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PTV QL+RK RK +     KV AL+G+P +RGVC  V T TPKKPNSA+RK+ + RL+S
Sbjct: 28  LPTVQQLVRKGRK-TVAKKTKVPALKGSPFRRGVCTVVKTTTPKKPNSAMRKIARVRLSS 86

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QGVK+R QARS+YG 
Sbjct: 87  GYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTQGVKDRNQARSKYGT 146

Query: 121 ERPK 124
           ++PK
Sbjct: 147 KKPK 150


>gi|299139125|ref|ZP_07032301.1| ribosomal protein S12 [Acidobacterium sp. MP5ACTX8]
 gi|298598805|gb|EFI54967.1| ribosomal protein S12 [Acidobacterium sp. MP5ACTX8]
          Length = 127

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT +QL+++ R  +    A   AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTFHQLVKQGRTPTRYKTAS-PALQGSPQRRGVCTRVYTQTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PG GHNLQEHS+V++ GGRVKDLPGV+Y V+RG LD+ GV NRKQ+RS+YGA
Sbjct: 60  GIEVTTYIPGIGHNLQEHSIVLIRGGRVKDLPGVRYHVVRGTLDSVGVANRKQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|307128701|ref|YP_003880731.1| 30S ribosomal protein S12 [Candidatus Sulcia muelleri CARI]
 gi|306483163|gb|ADM90033.1| 30S ribosomal protein S12 [Candidatus Sulcia muelleri CARI]
          Length = 126

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK RK   +  +K  AL   PQ+RGVC RVYT TPKKPNSA+RKV + RLT+
Sbjct: 1   MPTIQQLVRKVRK-KIKNKSKSMALNNCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y +IRG LD  GVK+RK+ARS+YGA
Sbjct: 60  GKEVNAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIIRGALDTAGVKDRKKARSKYGA 119

Query: 121 ERPK 124
           +  K
Sbjct: 120 KMTK 123


>gi|268316403|ref|YP_003290122.1| 30S ribosomal protein S12 [Rhodothermus marinus DSM 4252]
 gi|262333937|gb|ACY47734.1| ribosomal protein S12 [Rhodothermus marinus DSM 4252]
          Length = 124

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  RK      +K  AL G PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MPTIQQLIRLGRK-PKVKKSKSVALHGCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVIAY+PGEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LDA GV +R+++RS+YG 
Sbjct: 60  GEEVIAYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDAAGVADRRKSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|212711515|ref|ZP_03319643.1| hypothetical protein PROVALCAL_02588 [Providencia alcalifaciens DSM
           30120]
 gi|212685617|gb|EEB45145.1| hypothetical protein PROVALCAL_02588 [Providencia alcalifaciens DSM
           30120]
          Length = 124

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RK R       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKSRSSKV-VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YGA
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|289663453|ref|ZP_06485034.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289667615|ref|ZP_06488690.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 124

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+ +    A   AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MTTINQLVRKPRQATTYKSAS-PALDKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RGVLDA GV  R+Q RS+YGA
Sbjct: 60  QEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTLRGVLDAAGVAKRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|227874431|ref|ZP_03992611.1| ribosomal protein S12 [Oribacterium sinus F0268]
 gi|227839726|gb|EEJ50176.1| ribosomal protein S12 [Oribacterium sinus F0268]
          Length = 140

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 96/136 (70%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGS------------FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+ S            F +  K       PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRETSKKKSTAPALQKGFNSLQKRATTNSAPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVVM+ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGTRYHIIRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NR QARS+YGA+RPK
Sbjct: 121 ANRMQARSKYGAKRPK 136


>gi|225158917|ref|ZP_03725231.1| ribosomal protein S12 [Opitutaceae bacterium TAV2]
 gi|224802535|gb|EEG20793.1| ribosomal protein S12 [Opitutaceae bacterium TAV2]
          Length = 127

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   R  +K  AL GNP +RGVC++V T TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTINQLVRKGRR-QIRVKSKSPALDGNPFRRGVCVQVMTRTPKKPNSAIRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+P EGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LDA GV+ R+++RS+YG 
Sbjct: 60  GSEVISYIPDEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDATGVEKRRRSRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|85060264|ref|YP_455966.1| 30S ribosomal protein S12 [Sodalis glossinidius str. 'morsitans']
 gi|118597395|sp|Q2NQL4|RS12_SODGM RecName: Full=30S ribosomal protein S12
 gi|84780784|dbj|BAE75561.1| 30S ribosomal protein S12 [Sodalis glossinidius str. 'morsitans']
          Length = 124

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRSMKV-AKSNVPALDACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|309322133|ref|YP_003934045.1| ribosomal protein S12 [Geranium palmatum]
 gi|197131614|gb|ACH47325.1| ribosomal protein S12 [Geranium palmatum]
 gi|300069226|gb|ADJ66347.1| ribosomal protein S12 [Geranium palmatum]
          Length = 123

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT  QLIR  R+   R   K  ALRG PQ+RG C R YT+ PKKPNSALRKV + RLTS
Sbjct: 1   MPTTQQLIRNTRQ-PIRNATKSPALRGCPQRRGTCTRTYTINPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVE+ A++PG  HNLQEHSVV++ GGRVKDLPGVKYR++RG LDA GVK R+Q RS+YG 
Sbjct: 60  GVEITAFIPGIDHNLQEHSVVLVRGGRVKDLPGVKYRIVRGTLDAVGVKGRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|16330916|ref|NP_441644.1| 30S ribosomal protein S12 [Synechocystis sp. PCC 6803]
 gi|2500447|sp|P74230|RS12_SYNY3 RecName: Full=30S ribosomal protein S12
 gi|1653410|dbj|BAA18324.1| 30S ribosomal protein S12 [Synechocystis sp. PCC 6803]
          Length = 126

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R    +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSER-SKVQKKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+RKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDATGVKDRKQGRSKYGT 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KREK 123


>gi|320108401|ref|YP_004183991.1| 30S ribosomal protein S12 [Terriglobus saanensis SP1PR4]
 gi|319926922|gb|ADV83997.1| ribosomal protein S12 [Terriglobus saanensis SP1PR4]
          Length = 127

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT +QL++K R       A   AL+G+PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTFHQLVKKGRTAPNYKTAS-PALQGSPQRRGVCTRVYTQTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD+ GV  R Q+RS+YGA
Sbjct: 60  GIEVTSYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGTLDSVGVAKRLQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|302388707|ref|YP_003824528.1| SSU ribosomal protein S12P [Thermosediminibacter oceani DSM 16646]
 gi|302199335|gb|ADL06905.1| SSU ribosomal protein S12P [Thermosediminibacter oceani DSM 16646]
          Length = 124

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ R+   +  +K  AL+G PQKRGVC  V T TPKKPNSALRK+ + RLT+
Sbjct: 1   MPTINQLVRRGRQ-KVQHKSKSPALKGCPQKRGVCTVVKTTTPKKPNSALRKIARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDA GV NRKQ RS YGA
Sbjct: 60  GVEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGALDAAGVANRKQGRSLYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|197117318|ref|YP_002137745.1| 30S ribosomal protein S12 [Geobacter bemidjiensis Bem]
 gi|253701927|ref|YP_003023116.1| 30S ribosomal protein S12 [Geobacter sp. M21]
 gi|226708507|sp|B5EFP5|RS12_GEOBB RecName: Full=30S ribosomal protein S12
 gi|259494652|sp|C6E4R2|RS12_GEOSM RecName: Full=30S ribosomal protein S12
 gi|197086678|gb|ACH37949.1| ribosomal protein S12 [Geobacter bemidjiensis Bem]
 gi|251776777|gb|ACT19358.1| ribosomal protein S12 [Geobacter sp. M21]
          Length = 123

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIR  R+ S    +   ALR  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRHGRE-SKGDKSTAPALRSCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GVK R ++RS+YGA
Sbjct: 60  GVEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSVGVKGRMKSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|291326944|ref|ZP_06126425.2| ribosomal protein S12 [Providencia rettgeri DSM 1131]
 gi|291312251|gb|EFE52704.1| ribosomal protein S12 [Providencia rettgeri DSM 1131]
          Length = 145

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RK R       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 22  MATINQLVRKSRSSKV-VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 80

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YGA
Sbjct: 81  GFEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGA 140

Query: 121 ERPK 124
           ++PK
Sbjct: 141 KKPK 144


>gi|315639002|ref|ZP_07894172.1| 30S ribosomal protein S12 [Campylobacter upsaliensis JV21]
 gi|315480914|gb|EFU71548.1| 30S ribosomal protein S12 [Campylobacter upsaliensis JV21]
          Length = 129

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+NQL+RK RK      +K  AL+  PQ+RGVC RVYT TP+KPNSALRKV K RLTS
Sbjct: 3   VPTINQLVRKERKKVLEK-SKSPALKNCPQRRGVCTRVYTTTPRKPNSALRKVAKVRLTS 61

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV  R  +RS+YGA
Sbjct: 62  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGA 121

Query: 121 ERPK 124
           +RPK
Sbjct: 122 KRPK 125


>gi|149390502|ref|YP_001294294.1| ribosomal protein S12 [Illicium oligandrum]
 gi|229577733|ref|YP_002836069.1| ribosomal protein S12 [Megaleranthis saniculifolia]
 gi|229577778|ref|YP_002836114.1| ribosomal protein S12 [Megaleranthis saniculifolia]
 gi|147917455|gb|ABQ52579.1| ribosomal protein S12 [Illicium oligandrum]
 gi|226933861|gb|ACO91994.1| ribosomal protein S12 [Megaleranthis saniculifolia]
 gi|226933906|gb|ACO92039.1| ribosomal protein S12 [Megaleranthis saniculifolia]
          Length = 123

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   +   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIKNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|187918253|ref|YP_001883816.1| 30S ribosomal protein S12 [Borrelia hermsii DAH]
 gi|226708465|sp|B2S090|RS12_BORHD RecName: Full=30S ribosomal protein S12
 gi|119861101|gb|AAX16896.1| SSU ribosomal protein S12P [Borrelia hermsii DAH]
          Length = 124

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI+KPRK      A   AL+  PQ+RG+C RV TVTPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLIKKPRKSQKEKTAS-PALQNCPQRRGICTRVMTVTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG  D  GV NRKQ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGAKDTLGVNNRKQGRSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|294055240|ref|YP_003548898.1| ribosomal protein S12 [Coraliomargarita akajimensis DSM 45221]
 gi|293614573|gb|ADE54728.1| ribosomal protein S12 [Coraliomargarita akajimensis DSM 45221]
          Length = 124

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/124 (62%), Positives = 103/124 (83%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R PR    +A +K  AL+ NP +RGVC++V T TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTINQLVRNPRVVQ-KAQSKSRALKNNPFRRGVCVQVMTRTPKKPNSAIRKVAKVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EVIAY+P EGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD QGV+ R+++RS+YG 
Sbjct: 60  GIEVIAYIPDEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDCQGVEKRRRSRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|302671722|ref|YP_003831682.1| ribosomal protein S12 RpsL [Butyrivibrio proteoclasticus B316]
 gi|302396195|gb|ADL35100.1| ribosomal protein S12 RpsL [Butyrivibrio proteoclasticus B316]
          Length = 139

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/136 (58%), Positives = 98/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGS------------FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+ S            F +  K      +PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRQTSVKKSTAPALQKGFNSLHKKATATASPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            +RKQARS+YGA+RPK
Sbjct: 121 ADRKQARSKYGAKRPK 136


>gi|286143068|gb|ADC41564.1| 30S ribosomal protein S12 [Streptomyces coelicolor]
          Length = 109

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 76/102 (74%), Positives = 90/102 (88%)

Query: 21  KVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSGVEVIAYVPGEGHNLQEHSV 80
           K  AL G+PQ+RGVC RV+T TP KPNSALRKV + RLTSG+EV AY+PGEGHNLQEHS+
Sbjct: 8   KTPALEGSPQRRGVCTRVFTTTPNKPNSALRKVARVRLTSGIEVTAYIPGEGHNLQEHSI 67

Query: 81  VMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGAER 122
           V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA++
Sbjct: 68  VLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKK 109


>gi|182682616|ref|YP_001830776.1| 30S ribosomal protein S12 [Xylella fastidiosa M23]
 gi|182632726|gb|ACB93502.1| ribosomal protein S12 [Xylella fastidiosa M23]
          Length = 154

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+ S    A   AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 31  MATINQLVRKPRQASTYKSAS-PALDKCPQRRGVCTRVYTSTPKKPNSALRKVAKVRLTN 89

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LDA GV  R+Q RS+YGA
Sbjct: 90  QEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGA 149

Query: 121 ERPK 124
           +RPK
Sbjct: 150 KRPK 153


>gi|11466414|ref|NP_038418.1| ribosomal protein S12 [Mesostigma viride]
 gi|14423922|sp|Q9MUP2|RR12_MESVI RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|7259557|gb|AAF43858.1|AF166114_70 ribosomal protein S12 [Mesostigma viride]
          Length = 122

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 96/122 (78%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  RK  +    K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRSERKRVYNK-TKSPALKACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG+LD  GVK+R Q+RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGILDTAGVKDRAQSRSKYGV 119

Query: 121 ER 122
           +R
Sbjct: 120 KR 121


>gi|219673995|ref|YP_002456438.1| ribosomal protein S12 [Trifolium subterraneum]
 gi|193788964|gb|ACF20560.1| ribosomal protein S12 [Trifolium subterraneum]
          Length = 125

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/120 (67%), Positives = 96/120 (80%), Gaps = 1/120 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNGTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YGA
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGA 119


>gi|149195226|ref|ZP_01872316.1| 30S ribosomal protein S12 [Caminibacter mediatlanticus TB-2]
 gi|149134659|gb|EDM23145.1| 30S ribosomal protein S12 [Caminibacter mediatlanticus TB-2]
          Length = 127

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 97/122 (79%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK   +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLVRKGRKKVIKK-SKSPALVSCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GVK R  +RS+YG 
Sbjct: 60  GYEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVKGRVHSRSKYGT 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|124514448|gb|EAY55961.1| ribosomal protein S12 [Leptospirillum rubarum]
          Length = 124

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+ RK    A  K  AL   PQ+RGVC+RVYT TPKKPNSALRKV + R+T+
Sbjct: 1   MPTINQLVRQGRK-QMAAKGKSPALTRCPQRRGVCVRVYTTTPKKPNSALRKVARVRMTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y ++RG LDA GV NRKQ RS+YGA
Sbjct: 60  GFEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDAAGVANRKQGRSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|187251830|ref|YP_001876312.1| 30S ribosomal protein S12 [Elusimicrobium minutum Pei191]
 gi|226708500|sp|B2KEM9|RS12_ELUMP RecName: Full=30S ribosomal protein S12
 gi|186971990|gb|ACC98975.1| Ribosomal protein S12 [Elusimicrobium minutum Pei191]
          Length = 126

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQL+R+ R  + +   K  AL   PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTVNQLVRQGRTMN-KTKTKSPALMSCPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            VEV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y +IRG LDA GV+NRKQ RS YG 
Sbjct: 60  KVEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYHIIRGALDASGVENRKQGRSLYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|289066850|ref|YP_003434322.1| ribosomal protein S12 [Vigna radiata]
 gi|289066880|ref|YP_003434368.1| ribosomal protein S12 [Vigna radiata]
 gi|259020037|gb|ACV90235.1| ribosomal protein S12 [Vigna radiata]
 gi|259020067|gb|ACV90265.1| ribosomal protein S12 [Vigna radiata]
          Length = 122

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 99/124 (79%), Gaps = 2/124 (1%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTMKQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS YGA
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS-YGA 118

Query: 121 ERPK 124
           ++PK
Sbjct: 119 KKPK 122


>gi|253579261|ref|ZP_04856531.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849359|gb|EES77319.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 138

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 98/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGS------------FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+ S            F +  K    +  PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRQTSVKKSTAPALQKTFNSLRKKAVEQSAPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NRKQARS+YGA+RPK
Sbjct: 121 ANRKQARSKYGAKRPK 136


>gi|219849893|ref|YP_002464326.1| 30S ribosomal protein S12 [Chloroflexus aggregans DSM 9485]
 gi|219544152|gb|ACL25890.1| ribosomal protein S12 [Chloroflexus aggregans DSM 9485]
          Length = 151

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (74%), Gaps = 13/135 (9%)

Query: 1   MPTVNQLIRKPRKGSFRAC-------------AKVTALRGNPQKRGVCLRVYTVTPKKPN 47
           MPT+NQL+RKPRK   +                K+T  RG+PQKRGVC +V T+TPKKPN
Sbjct: 1   MPTINQLVRKPRKPVVKKTKAPALRFTYNSLKGKLTRGRGSPQKRGVCTKVTTMTPKKPN 60

Query: 48  SALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQG 107
           SALRK+ + RL++G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QG
Sbjct: 61  SALRKIARVRLSNGLEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTQG 120

Query: 108 VKNRKQARSRYGAER 122
           V  RKQ RS+YG ++
Sbjct: 121 VSGRKQGRSKYGTKK 135


>gi|286143156|gb|ADC41608.1| 30S ribosomal protein S12 [Streptomyces limosus]
          Length = 109

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 76/102 (74%), Positives = 90/102 (88%)

Query: 21  KVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSGVEVIAYVPGEGHNLQEHSV 80
           K  AL G+PQ+RGVC RV+T TP KPNSALRKV + RLTSG+EV AY+PGEGHNLQEHS+
Sbjct: 8   KTPALEGSPQRRGVCTRVFTTTPTKPNSALRKVARVRLTSGIEVTAYIPGEGHNLQEHSI 67

Query: 81  VMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGAER 122
           V++ GGRVKDLPGV+Y++IRG LD QGVKNRKQARSRYGA++
Sbjct: 68  VLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKK 109


>gi|163847917|ref|YP_001635961.1| 30S ribosomal protein S12 [Chloroflexus aurantiacus J-10-fl]
 gi|222525797|ref|YP_002570268.1| 30S ribosomal protein S12 [Chloroflexus sp. Y-400-fl]
 gi|163669206|gb|ABY35572.1| ribosomal protein S12 [Chloroflexus aurantiacus J-10-fl]
 gi|222449676|gb|ACM53942.1| ribosomal protein S12 [Chloroflexus sp. Y-400-fl]
          Length = 146

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (74%), Gaps = 13/135 (9%)

Query: 1   MPTVNQLIRKPRKGSFRAC-------------AKVTALRGNPQKRGVCLRVYTVTPKKPN 47
           MPT+NQL+RKPRK   +                K+T  RG+PQKRGVC +V T+TPKKPN
Sbjct: 1   MPTINQLVRKPRKPVVKKTKAPALRFTYNSLKGKLTRGRGSPQKRGVCTKVTTMTPKKPN 60

Query: 48  SALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQG 107
           SALRK+ + RL++G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD QG
Sbjct: 61  SALRKIARVRLSNGLEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTQG 120

Query: 108 VKNRKQARSRYGAER 122
           V  RKQ RS+YG ++
Sbjct: 121 VNGRKQGRSKYGTKK 135


>gi|238922792|ref|YP_002936305.1| 30S ribosomal protein S12 [Eubacterium rectale ATCC 33656]
 gi|238874464|gb|ACR74171.1| 30S ribosomal protein S12 [Eubacterium rectale ATCC 33656]
          Length = 154

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 98/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGS------------FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+ S            F +  K      +PQKRGVC  V T TPKKPNS
Sbjct: 16  MPTFNQLVRKGRQTSVKKSTAPALQRSFNSLQKKPINTSSPQKRGVCTAVKTATPKKPNS 75

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 76  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGV 135

Query: 109 KNRKQARSRYGAERPK 124
            NRKQARS+YGA+RPK
Sbjct: 136 ANRKQARSKYGAKRPK 151


>gi|224372234|ref|YP_002606606.1| ribosomal protein S12 [Nautilia profundicola AmH]
 gi|254811099|sp|B9L7J8|RS12_NAUPA RecName: Full=30S ribosomal protein S12
 gi|223589309|gb|ACM93045.1| ribosomal protein S12 [Nautilia profundicola AmH]
          Length = 127

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 97/122 (79%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK   +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLVRKGRKQVIKK-SKSPALVSCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+PGEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GVK R  +RS+YG 
Sbjct: 60  GYEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVKGRVHSRSKYGT 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|77359195|ref|YP_338770.1| 30S ribosomal protein S12 [Pseudoalteromonas haloplanktis TAC125]
 gi|90111794|sp|Q3ILP7|RS12_PSEHT RecName: Full=30S ribosomal protein S12
 gi|76874106|emb|CAI85327.1| 30S ribosomal protein S12 [Pseudoalteromonas haloplanktis TAC125]
          Length = 124

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/124 (62%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+      +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRRSKVTK-SNSAALKACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV++  +RG LD  GV +R+QARS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRFHTVRGALDCAGVSDRRQARSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|330444210|ref|YP_004377196.1| 30S ribosomal protein S12 [Chlamydophila pecorum E58]
 gi|328807320|gb|AEB41493.1| ribosomal protein S12 [Chlamydophila pecorum E58]
          Length = 123

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R+ S     K  AL+  PQ+RGVCL+V T TPKKPNSALRKV   RL++
Sbjct: 1   MPTINQLIRKKRRSS-EGRRKSPALQKCPQRRGVCLQVKTKTPKKPNSALRKVAWVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVIAY+ GEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD   VKNRKQ+RSRYGA
Sbjct: 60  GQEVIAYIGGEGHNLQEHSIVLVQGGRVKDLPGVRYHIVRGALDCAAVKNRKQSRSRYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|183597110|ref|ZP_02958603.1| hypothetical protein PROSTU_00351 [Providencia stuartii ATCC 25827]
 gi|188023773|gb|EDU61813.1| hypothetical protein PROSTU_00351 [Providencia stuartii ATCC 25827]
          Length = 124

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RK R       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKSRSSKV-VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|27364735|ref|NP_760263.1| 30S ribosomal protein S12 [Vibrio vulnificus CMCP6]
 gi|37681216|ref|NP_935825.1| 30S ribosomal protein S12 [Vibrio vulnificus YJ016]
 gi|320155127|ref|YP_004187506.1| 30S ribosomal protein S12p (S23e) [Vibrio vulnificus MO6-24/O]
 gi|29611851|sp|Q8DCR0|RS12_VIBVU RecName: Full=30S ribosomal protein S12
 gi|52783381|sp|Q7MH40|RS12_VIBVY RecName: Full=30S ribosomal protein S12
 gi|27360880|gb|AAO09790.1| ribosomal protein S12 [Vibrio vulnificus CMCP6]
 gi|37199967|dbj|BAC95796.1| ribosomal protein S12 [Vibrio vulnificus YJ016]
 gi|319930439|gb|ADV85303.1| SSU ribosomal protein S12p (S23e) [Vibrio vulnificus MO6-24/O]
          Length = 124

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 95/124 (76%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRAKQV-VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV NRKQ RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVNNRKQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|297182728|gb|ADI18884.1| ribosomal protein s12 [uncultured Pseudomonadales bacterium
           HF0010_05E14]
          Length = 124

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+    + + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MATINQLVRKPRRRKM-SKSDVPALQSCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +R Q RS+YGA
Sbjct: 60  GYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTSGVSDRTQRRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|256821657|ref|YP_003145620.1| 30S ribosomal protein S12 [Kangiella koreensis DSM 16069]
 gi|256795196|gb|ACV25852.1| ribosomal protein S12 [Kangiella koreensis DSM 16069]
          Length = 124

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR    +    V AL   PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRTKQVKK-TNVPALEACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHCVRGTLDLAGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|289423688|ref|ZP_06425487.1| ribosomal protein S12 [Peptostreptococcus anaerobius 653-L]
 gi|289155938|gb|EFD04604.1| ribosomal protein S12 [Peptostreptococcus anaerobius 653-L]
          Length = 140

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 98/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKG------------SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT+NQL+RK RK              + +  K       PQKRGVC  V TVTPKKPNS
Sbjct: 1   MPTINQLVRKSRKAVEKKSTAPALQKGYNSLYKKATDISAPQKRGVCTSVKTVTPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRKV + RLT+G+EV AY+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RG LD  GV
Sbjct: 61  ALRKVARVRLTNGIEVSAYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
             R+Q+RS+YGA+RPK
Sbjct: 121 DKRRQSRSKYGAKRPK 136


>gi|229915538|gb|ACQ90882.1| ribosomal protein S12 [Pedinomonas minor]
          Length = 124

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  RK       K  AL   PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTIQQLIRSARK-KLTQKTKSPALSSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTT 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R Q+RS+YG 
Sbjct: 60  GFEITAYIPGVGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAAGVKDRNQSRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|225376348|ref|ZP_03753569.1| hypothetical protein ROSEINA2194_01989 [Roseburia inulinivorans DSM
           16841]
 gi|225211724|gb|EEG94078.1| hypothetical protein ROSEINA2194_01989 [Roseburia inulinivorans DSM
           16841]
          Length = 139

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 98/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRG------------NPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+ S +        +G            +PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRQTSVKKSTAPALQKGYNSLQKRPTDAPSPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVVM+ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGTRYHIIRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NRKQARS+YGA+RPK
Sbjct: 121 ANRKQARSKYGAKRPK 136


>gi|224178090|ref|YP_002600936.1| ribosomal protein S12 [Pyramimonas parkeae]
 gi|215882757|gb|ACJ71130.1| ribosomal protein S12 [Pyramimonas parkeae]
          Length = 124

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  RK       K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRFQRK-KIEKKTKSPALQSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GVKNR Q+RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDTAGVKNRTQSRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|322379326|ref|ZP_08053702.1| 30S ribosomal protein S12 [Helicobacter suis HS1]
 gi|322380706|ref|ZP_08054845.1| 30S ribosomal protein S12 [Helicobacter suis HS5]
 gi|321146874|gb|EFX41635.1| 30S ribosomal protein S12 [Helicobacter suis HS5]
 gi|321148239|gb|EFX42763.1| 30S ribosomal protein S12 [Helicobacter suis HS1]
          Length = 138

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK   +   K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLIRKERKKILKK-TKSPALVECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+PGEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV  R  +RS+YGA
Sbjct: 60  KFEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNKRSVSRSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKTK 123


>gi|56707474|ref|YP_169370.1| 30S ribosomal protein S12 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|89255666|ref|YP_513027.1| 30S ribosomal protein S12 [Francisella tularensis subsp. holarctica
           LVS]
 gi|110669945|ref|YP_666502.1| 30S ribosomal protein S12 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|115314167|ref|YP_762890.1| 30S ribosomal protein S12 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|134302589|ref|YP_001122560.1| 30S ribosomal protein S12 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|156501616|ref|YP_001427681.1| 30S ribosomal protein S12 [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167009893|ref|ZP_02274824.1| ribosomal protein S12 [Francisella tularensis subsp. holarctica
           FSC200]
 gi|187932147|ref|YP_001892132.1| 30S ribosomal protein S12 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|224456555|ref|ZP_03665028.1| 30S ribosomal protein S12 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254367057|ref|ZP_04983093.1| 30S ribosomal protein S12 [Francisella tularensis subsp. holarctica
           257]
 gi|254370832|ref|ZP_04986837.1| 30S ribosomal protein S12 [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254874312|ref|ZP_05247022.1| 30S ribosomal protein S12 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|290953215|ref|ZP_06557836.1| 30S ribosomal protein S12 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295313583|ref|ZP_06804172.1| 30S ribosomal protein S12 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|61215790|sp|Q5NHX2|RS12_FRATT RecName: Full=30S ribosomal protein S12
 gi|119366770|sp|Q14JC4|RS12_FRAT1 RecName: Full=30S ribosomal protein S12
 gi|119366771|sp|Q2A5H4|RS12_FRATH RecName: Full=30S ribosomal protein S12
 gi|119366772|sp|Q0BNT1|RS12_FRATO RecName: Full=30S ribosomal protein S12
 gi|158513859|sp|A4IZT8|RS12_FRATW RecName: Full=30S ribosomal protein S12
 gi|166231861|sp|A7N9S2|RS12_FRATF RecName: Full=30S ribosomal protein S12
 gi|226708506|sp|B2SDY9|RS12_FRATM RecName: Full=30S ribosomal protein S12
 gi|48475428|gb|AAT44346.1| ribosomal protein S12 [Francisella tularensis subsp. holarctica]
 gi|54113279|gb|AAV29273.1| NT02FT0094 [synthetic construct]
 gi|56603966|emb|CAG44954.1| 30S ribosomal protein S12 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|89143497|emb|CAJ78673.1| 30S ribosomal protein S12 [Francisella tularensis subsp. holarctica
           LVS]
 gi|110320278|emb|CAL08337.1| 30S ribosomal protein S12 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|115129066|gb|ABI82253.1| ribosomal protein S12 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|134050366|gb|ABO47437.1| ribosomal protein S12 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|134252883|gb|EBA51977.1| 30S ribosomal protein S12 [Francisella tularensis subsp. holarctica
           257]
 gi|151569075|gb|EDN34729.1| 30S ribosomal protein S12 [Francisella tularensis subsp. tularensis
           FSC033]
 gi|156252219|gb|ABU60725.1| ribosomal protein S12 [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|187713056|gb|ACD31353.1| 30S ribosomal protein S12 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254840311|gb|EET18747.1| 30S ribosomal protein S12 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282158618|gb|ADA78009.1| 30S ribosomal protein S12 [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 124

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+  PRK S    +KV AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MATINQLVNNPRKRSV-VKSKVPALKACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV NRK  RS+YG 
Sbjct: 60  RFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTSGVNNRKHGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|315925261|ref|ZP_07921474.1| 30S ribosomal protein S12 [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315621432|gb|EFV01400.1| 30S ribosomal protein S12 [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 124

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/124 (62%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+++ RK +     K  AL+ NPQKRGVC  V T TPKKPNSALRK+ + +L +
Sbjct: 1   MPTINQLVKQGRK-TAELKTKTPALKQNPQKRGVCTAVRTATPKKPNSALRKIARVKLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHS+V++ GGRVKDLPGV+Y++IRG LD  GV++RKQARS+YGA
Sbjct: 60  GMEVTAYIPGIGHNLQEHSIVLVKGGRVKDLPGVRYKIIRGALDTAGVEDRKQARSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|153012189|ref|YP_001381684.1| ribosomal protein S12 [Medicago truncatula]
          Length = 127

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/128 (64%), Positives = 100/128 (78%), Gaps = 5/128 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVY----TVTPKKPNSALRKVIKA 56
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVY    T+TPKKPNSALRKV + 
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCTRVYVRLVTITPKKPNSALRKVARV 59

Query: 57  RLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARS 116
           RLTSG E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS
Sbjct: 60  RLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 119

Query: 117 RYGAERPK 124
           +YGA++PK
Sbjct: 120 KYGAKKPK 127


>gi|146281165|ref|YP_001171318.1| 30S ribosomal protein S12 [Pseudomonas stutzeri A1501]
 gi|158514169|sp|A4VHM5|RS12_PSEU5 RecName: Full=30S ribosomal protein S12
 gi|145569370|gb|ABP78476.1| 30S ribosomal protein S12 [Pseudomonas stutzeri A1501]
          Length = 123

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+R+PRK      + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRQPRKRVVEK-SDVPALQNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRV+DLPGV+Y  +RG LD  GVK+RKQ RS+YGA
Sbjct: 60  GYEVASYIGGEGHNLQEHSVVLIRGGRVRDLPGVRYHTVRGSLDTSGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|118413983|gb|ABK82403.1| ribosomal protein S12 [Campylobacter fetus subsp. fetus 82-40]
          Length = 132

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+NQL+RK RK      +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 6   VPTINQLVRKERKKVI-VKSKSPALKECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 64

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+ GEGHNLQEHS+V++ GGRVKDLPGVKY ++RG LD  GV  R  +RS+YGA
Sbjct: 65  GFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGA 124

Query: 121 ERPK 124
           +RPK
Sbjct: 125 KRPK 128


>gi|124302966|ref|YP_001023725.1| ribosomal protein S12 [Angiopteris evecta]
 gi|158512826|sp|A2T357|RR12_ANGEV RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|113367278|gb|ABG79660.1| ribosomal protein S12 [Angiopteris evecta]
          Length = 123

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+ QLIR  R+       K  ALRG PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MSTIQQLIRNTRQ-PIEDRTKSPALRGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+RKQ RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRKQGRSQYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|9107858|gb|AAF85428.1|AE004069_9 30S ribosomal protein S12 [Xylella fastidiosa 9a5c]
          Length = 132

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+ S    A   AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 9   MATINQLVRKPRQASTYKSAS-PALDKCPQRRGVCTRVYTSTPKKPNSALRKVAKVRLTN 67

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LDA GV  R+Q RS+YGA
Sbjct: 68  QEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGA 127

Query: 121 ERPK 124
           +RPK
Sbjct: 128 KRPK 131


>gi|229821628|ref|YP_002883154.1| ribosomal protein S12 [Beutenbergia cavernae DSM 12333]
 gi|259494642|sp|C5C0J6|RS12_BEUC1 RecName: Full=30S ribosomal protein S12
 gi|229567541|gb|ACQ81392.1| ribosomal protein S12 [Beutenbergia cavernae DSM 12333]
          Length = 124

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/124 (62%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK RK       K  AL+G+PQ+RGVC RVYT TP+KPNSALRKV + +L+S
Sbjct: 1   MPTIQQLVRKGRKDKA-TKTKTPALKGSPQRRGVCTRVYTTTPRKPNSALRKVARVKLSS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHS+V++ GGRV DLPGV+Y+++RG LD QGV+ R+QARSRYGA
Sbjct: 60  QMEVTAYIPGVGHNLQEHSIVLVRGGRVADLPGVRYKIVRGALDTQGVRGRQQARSRYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKEK 123


>gi|169331636|ref|ZP_02860829.1| hypothetical protein ANASTE_00020 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259698|gb|EDS73664.1| hypothetical protein ANASTE_00020 [Anaerofustis stercorihominis DSM
           17244]
          Length = 121

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 98/122 (80%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPTVNQL+RK RK       K  AL+ NPQKRGVC  V T TPKKPNSA+RK+ + RL +
Sbjct: 1   MPTVNQLVRKGRK-ELVYKTKSPALKSNPQKRGVCTVVRTATPKKPNSAMRKIARVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVVM+ GGRVKDLPGV+Y++IRG LD QGV +RKQ+RS+YGA
Sbjct: 60  GMEVTAYIPGIGHNLQEHSVVMVKGGRVKDLPGVRYKIIRGALDTQGVADRKQSRSKYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|78044960|ref|YP_361124.1| 30S ribosomal protein S12 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|90111772|sp|Q3A9R0|RS12_CARHZ RecName: Full=30S ribosomal protein S12
 gi|77997075|gb|ABB15974.1| ribosomal protein S12 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 126

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+      +   AL+G PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRE-KVAVKSSAPALKGCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+ G GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV+NR Q RS+YG 
Sbjct: 60  GIEVTAYIGGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDCAGVQNRNQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|46579709|ref|YP_010517.1| 30S ribosomal protein S12 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602814|ref|YP_967214.1| 30S ribosomal protein S12 [Desulfovibrio vulgaris DP4]
 gi|52783369|sp|Q72CI5|RS12_DESVH RecName: Full=30S ribosomal protein S12
 gi|158513914|sp|A1VEC1|RS12_DESVV RecName: Full=30S ribosomal protein S12
 gi|46449124|gb|AAS95776.1| ribosomal protein S12 [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563043|gb|ABM28787.1| SSU ribosomal protein S12P [Desulfovibrio vulgaris DP4]
 gi|311233501|gb|ADP86355.1| ribosomal protein S12 [Desulfovibrio vulgaris RCH1]
          Length = 123

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK  +       K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRK-ERKKVVKRKKTPALQACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RG LD  GV++R+Q RS+YGA
Sbjct: 60  GLEVTAYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIVRGTLDTSGVQDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|228470692|ref|ZP_04055543.1| ribosomal protein S12 [Porphyromonas uenonis 60-3]
 gi|313887071|ref|ZP_07820770.1| ribosomal protein S12 [Porphyromonas asaccharolytica PR426713P-I]
 gi|228307549|gb|EEK16545.1| ribosomal protein S12 [Porphyromonas uenonis 60-3]
 gi|312923482|gb|EFR34292.1| ribosomal protein S12 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332176638|gb|AEE12328.1| ribosomal protein S12 [Porphyromonas asaccharolytica DSM 20707]
          Length = 125

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+ +F    K  AL   PQ+RGVC+RVYT TPKKPNSA+RKV + RLT+
Sbjct: 1   MPTIQQLVRKGRE-TFEEKGKSPALGSCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD  GV  R+Q RS+YGA
Sbjct: 60  GKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTAGVDGRRQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|34556893|ref|NP_906708.1| 30S ribosomal protein S12 [Wolinella succinogenes DSM 1740]
 gi|52783380|sp|Q7MA55|RS12_WOLSU RecName: Full=30S ribosomal protein S12
 gi|34482608|emb|CAE09608.1| S12 HOMOLOG [Wolinella succinogenes]
          Length = 134

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/118 (68%), Positives = 95/118 (80%), Gaps = 1/118 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK RK + +  +K  AL   PQ+RGVC RVYT TPKKPNSALRKV K RLTS
Sbjct: 1   MPTINQLIRKERKKAIKK-SKSPALVNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           G EVI+Y+PGEGHNLQEHS+V++ GGRVKDLPGVKY +IRG LD  GV+ R  +RS+Y
Sbjct: 60  GFEVISYIPGEGHNLQEHSIVLIRGGRVKDLPGVKYHIIRGALDTAGVQKRNVSRSKY 117


>gi|19704890|ref|NP_602385.1| 30S ribosomal protein S12 [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|237738895|ref|ZP_04569376.1| SSU ribosomal protein S12P [Fusobacterium sp. 2_1_31]
 gi|237741362|ref|ZP_04571843.1| SSU ribosomal protein S12P [Fusobacterium sp. 4_1_13]
 gi|254302108|ref|ZP_04969466.1| ribosomal protein S12 [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
 gi|256846533|ref|ZP_05551990.1| ribosomal protein S12 [Fusobacterium sp. 3_1_36A2]
 gi|294781843|ref|ZP_06747175.1| ribosomal protein S12 [Fusobacterium sp. 1_1_41FAA]
 gi|294784123|ref|ZP_06749424.1| ribosomal protein S12 [Fusobacterium sp. 3_1_27]
 gi|296328709|ref|ZP_06871225.1| 30S ribosomal protein S12 [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
 gi|22096110|sp|Q8RIL9|RS12_FUSNN RecName: Full=30S ribosomal protein S12
 gi|19712781|gb|AAL93684.1| SSU ribosomal protein S12P [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
 gi|148322300|gb|EDK87550.1| ribosomal protein S12 [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
 gi|229423998|gb|EEO39045.1| SSU ribosomal protein S12P [Fusobacterium sp. 2_1_31]
 gi|229430894|gb|EEO41106.1| SSU ribosomal protein S12P [Fusobacterium sp. 4_1_13]
 gi|256718302|gb|EEU31858.1| ribosomal protein S12 [Fusobacterium sp. 3_1_36A2]
 gi|294481654|gb|EFG29423.1| ribosomal protein S12 [Fusobacterium sp. 1_1_41FAA]
 gi|294488193|gb|EFG35538.1| ribosomal protein S12 [Fusobacterium sp. 3_1_27]
 gi|296154175|gb|EFG94977.1| 30S ribosomal protein S12 [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
          Length = 122

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 99/121 (81%), Gaps = 1/121 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL++K R+ +     K  AL+GNPQ+RGVC+RVYT TPKKPNSALRKV + +LT+
Sbjct: 1   MPTLSQLVKKGRQ-TLTEKKKSPALQGNPQRRGVCIRVYTTTPKKPNSALRKVARVKLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PGEGHNLQEHS+V++ GGR KDLPGV+Y++IRG LD  GV  RKQ RS+YGA
Sbjct: 60  GIEVTCYIPGEGHNLQEHSIVLVRGGRTKDLPGVRYKIIRGALDTAGVAKRKQGRSKYGA 119

Query: 121 E 121
           +
Sbjct: 120 K 120


>gi|159161274|ref|YP_001542511.1| ribosomal protein S12 [Cuscuta exaltata]
 gi|159161299|ref|YP_001542552.1| ribosomal protein S12 [Cuscuta exaltata]
 gi|158938699|gb|ABW83716.1| ribosomal protein S12 [Cuscuta exaltata]
 gi|158938724|gb|ABW83741.1| ribosomal protein S12 [Cuscuta exaltata]
          Length = 123

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   +   K  AL G PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIKNVTKSPALGGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|78779987|ref|YP_398099.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9312]
 gi|115305666|sp|Q318N2|RS12_PROM9 RecName: Full=30S ribosomal protein S12
 gi|78713486|gb|ABB50663.1| SSU ribosomal protein S12P [Prochlorococcus marinus str. MIT 9312]
          Length = 124

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QLI   RK   R   K  AL+  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTISQLIGSERKRLTRK-TKSPALKSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV+L GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KAPK 123


>gi|33862067|ref|NP_893628.1| 30S ribosomal protein S12 [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
 gi|52783391|sp|Q7UZY4|RS12_PROMP RecName: Full=30S ribosomal protein S12
 gi|33634285|emb|CAE19970.1| 30S ribosomal protein S12 [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
 gi|91070535|gb|ABE11441.1| 30S ribosomal protein S12 [uncultured Prochlorococcus marinus clone
           HOT0M-5C8]
          Length = 125

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QLI   RK   R   K  AL+  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTISQLIGSERKRLTRK-TKSPALKSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV+L GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KAPK 123


>gi|71899534|ref|ZP_00681690.1| Ribosomal protein S12, bacterial and chloroplast form [Xylella
           fastidiosa Ann-1]
 gi|71730663|gb|EAO32738.1| Ribosomal protein S12, bacterial and chloroplast form [Xylella
           fastidiosa Ann-1]
          Length = 165

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+ S    A   AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 42  MATINQLVRKPRQASTYKSAS-PALDKCPQRRGVCTRVYTSTPKKPNSALRKVAKVRLTN 100

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LDA GV  R+Q RS+YGA
Sbjct: 101 QEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVVKRRQGRSKYGA 160

Query: 121 ERPK 124
           +RPK
Sbjct: 161 KRPK 164


>gi|22711991|ref|NP_683767.1| ribosomal protein S12 [Chaetosphaeridium globosum]
 gi|25009148|sp|Q8MA18|RR12_CHAGL RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|22416995|gb|AAM96595.1| ribosomal protein S12 [Chaetosphaeridium globosum]
          Length = 123

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+       K  ALR  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRN-RREPIENRTKSPALRSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GVK+R Q RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDSVGVKDRHQGRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|307243447|ref|ZP_07525603.1| ribosomal protein S12 [Peptostreptococcus stomatis DSM 17678]
 gi|306493171|gb|EFM65168.1| ribosomal protein S12 [Peptostreptococcus stomatis DSM 17678]
          Length = 140

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 98/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKG------------SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT+NQL+RK RK              + +  K       PQKRGVC  V TVTPKKPNS
Sbjct: 1   MPTINQLVRKSRKAVEKKSTAPALQKGYNSLYKKATDISAPQKRGVCTSVKTVTPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRKV + RLT+G+EV AY+PGEGHNLQEHSVVM+ GGRVKDLPGV+Y ++RG LD  GV
Sbjct: 61  ALRKVARVRLTNGIEVSAYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
             R+Q+RS+YGA+RPK
Sbjct: 121 DARRQSRSKYGAKRPK 136


>gi|55981666|ref|YP_144963.1| 30S ribosomal protein S12 [Thermus thermophilus HB8]
 gi|10835596|pdb|1FJG|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With The Antibiotics Streptomycin,
           Spectinomycin, And Paromomycin
 gi|13096405|pdb|1HR0|L Chain L, Crystal Structure Of Initiation Factor If1 Bound To The
           30s Ribosomal Subunit
 gi|13399803|pdb|1HNW|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Tetracycline
 gi|13399825|pdb|1HNX|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Pactamycin
 gi|13399847|pdb|1HNZ|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Hygromycin B
 gi|14278021|pdb|1GIX|O Chain O, Crystal Structure Of The Ribosome At 5.5 A Resolution.
           This File, 1gix, Contains The 30s Ribosome Subunit,
           Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is
           In The File 1giy
 gi|14278067|pdb|1IBK|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With The Antibiotic Paromomycin
 gi|14278088|pdb|1IBL|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With A Messenger Rna Fragment And
           Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
           Site And With The Antibiotic Paromomycin
 gi|14278112|pdb|1IBM|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With A Messenger Rna Fragment And
           Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
           Site
 gi|15826131|pdb|1JGO|O Chain O, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgo, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
 gi|15826156|pdb|1JGP|O Chain O, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgp, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
 gi|15826181|pdb|1JGQ|O Chain O, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgq, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
 gi|20663897|pdb|1J5E|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit
 gi|24987758|pdb|1MJ1|O Chain O, Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIBOSOMAL
           Proteins Into A 13 A Cryo-Em Map Of The Coli 70s
           Ribosome
 gi|27065887|pdb|1N32|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Bound To Codon And Near-Cognate Transfer Rna
           Anticodon Stem-Loop Mismatched At The First Codon
           Position At The A Site With Paromomycin
 gi|27065914|pdb|1N33|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Bound To Codon And Near-Cognate Transfer Rna
           Anticodon Stem-Loop Mismatched At The Second Codon
           Position At The A Site With Paromomycin
 gi|27065941|pdb|1N34|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In The Presence Of Codon And
           Crystallographically Disordered Near-Cognate Transfer
           Rna Anticodon Stem-Loop Mismatched At The First Codon
           Position
 gi|27065967|pdb|1N36|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In The Presence Of Crystallographically
           Disordered Codon And Near-Cognate Transfer Rna Anticodon
           Stem-Loop Mismatched At The Second Codon Position
 gi|28373710|pdb|1ML5|O Chain O, Structure Of The E. Coli Ribosomal Termination Complex
           With Release Factor 2
 gi|29726520|pdb|1MVR|O Chain O, Decoding Center & Peptidyl Transferase Center From The X-
           Ray Structure Of The Thermus Thermophilus 70s Ribosome,
           Aligned To The Low Resolution Cryo-Em Map Of E.Coli 70s
           Ribosome
 gi|58177411|pdb|1XMO|L Chain L, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed
           With Aag-Mrna In The Decoding Center
 gi|58177434|pdb|1XMQ|L Chain L, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The
           Decoding Center
 gi|58177475|pdb|1XNQ|L Chain L, Structure Of An Inosine-Adenine Wobble Base Pair Complex
           In The Context Of The Decoding Center
 gi|58177498|pdb|1XNR|L Chain L, Crystal Structure Of An Inosine-Cytosine Wobble Base Pair
           In The Context Of The Decoding Center
 gi|66361065|pdb|1YL4|O Chain O, Crystal Structure Of 70s Ribosome With Thrs Operator And
           Trnas. 30s Subunit. The Coordinates For The 50s Subunit
           Are In The Pdb Entry 1yl3
 gi|88192247|pdb|2B64|L Chain L, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf1
           From A Crystal Structure Of The Whole Ribosomal Complex.
           This File Contains The 30s Subunit, Trnas, Mrna And
           Release Factor Rf1 From A Crystal Structure Of The Whole
           Ribosomal Complex". The Entire Crystal Structure
           Contains One 70s Ribosome, Trnas, Mrna And Release
           Factor Rf1 And Is Described In Remark 400.
 gi|88192310|pdb|2B9M|L Chain L, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2
           From A Crystal Structure Of The Whole Ribosomal Complex.
           This File Contains The 30s Ribosomal Subunit, Trnas,
           Mrna And Release Factor Rf2 From A Crystal Structure Of
           The Whole Ribosomal Complex". The Entire Crystal
           Structure Contains One 70s Ribosome, Trnas, Mrna And
           Release Factor Rf2 And Is Described In Remark 400.
 gi|88192366|pdb|2B9O|L Chain L, 30s Ribosomal Subunit, Trnas And Mrna From A Crystal
           Structure Of The Whole Ribosomal Complex With A Stop
           Codon In The A-Site. This File Contains The 30s Subunit,
           Trnas And Mrna From A Crystal Structure Of The Whole
           Ribosomal Complex With A Stop Codon In The A-Site And Is
           Described In Remark 400.
 gi|116667665|pdb|2HHH|L Chain L, Crystal Structure Of Kasugamycin Bound To The 30s
           Ribosomal Subunit
 gi|116668208|pdb|2J00|L Chain L, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 1 Of 4).
           This File Contains The 30s Subunit, Mrna, A-, P- And
           E-Site Trnas And Paromomycin For Molecule I.
 gi|116668269|pdb|2J02|L Chain L, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 3 Of 4)
           This File Contains The 30s Subunit, Mrna, A-, P- And
           E-Site Trnas And Paromomycin For Molecule Ii.
 gi|149243629|pdb|2UU9|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Valine-Asl With Cmo5u In
           Position 34 Bound To An Mrna With A Gug-Codon In The
           A-Site And Paromomycin.
 gi|149243656|pdb|2UUA|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Valine-Asl With Cmo5u In
           Position 34 Bound To An Mrna With A Guc-Codon In The
           A-Site And Paromomycin.
 gi|149243683|pdb|2UUB|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Valine-Asl With Cmo5u In
           Position 34 Bound To An Mrna With A Guu-Codon In The
           A-Site And Paromomycin.
 gi|149243710|pdb|2UUC|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Valine-Asl With Cmo5u In
           Position 34 Bound To An Mrna With A Gua-Codon In The
           A-Site And Paromomycin.
 gi|149243849|pdb|2UXC|L Chain L, Crystal Structure Of An Extended Trna Anticodon Stem Loop
           In Complex With Its Cognate Mrna Ucgu In The Context Of
           The Thermus Thermophilus 30s Subunit.
 gi|157836419|pdb|2UXB|L Chain L, Crystal Structure Of An Extended Trna Anticodon Stem Loop
           In Complex With Its Cognate Mrna Gggu In The Context Of
           The Thermus Thermophilus 30s Subunit.
 gi|157836496|pdb|2V46|L Chain L, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 1 Of 4). This File Contains The 30s
           Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For
           Molecule 1.
 gi|157836552|pdb|2V48|L Chain L, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 3 Of 4). This File Contains The 30s
           Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For
           Molecule 2.
 gi|158430911|pdb|2UXD|L Chain L, Crystal Structure Of An Extended Trna Anticodon Stem Loop
           In Complex With Its Cognate Mrna Cggg In The Context Of
           The Thermus Thermophilus 30s Subunit.
 gi|165760894|pdb|2OM7|E Chain E, Structural Basis For Interaction Of The Ribosome With The
           Switch Regions Of Gtp-Bound Elongation Factors
 gi|186972860|pdb|2VQE|L Chain L, Modified Uridines With C5-Methylene Substituents At The
           First Position Of The Trna Anticodon Stabilize U-G
           Wobble Pairing During Decoding
 gi|186972883|pdb|2VQF|L Chain L, Modified Uridines With C5-Methylene Substituents At The
           First Position Of The Trna Anticodon Stabilize U-G
           Wobble Pairing During Decoding
 gi|226887385|pdb|2WDG|L Chain L, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna.  This File
           Contains The 30s Subunit A-,P-, And E-Site Trnas And
           Paromomycin For Molecule I.
 gi|226887410|pdb|2WDH|L Chain L, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna.  This File
           Contains The 30s Subunit A-,P-, And E-Site Trnas And
           Paromomycin For Molecule Ii.
 gi|226887499|pdb|2WDK|L Chain L, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 30s
           Subunit A-,P-, And E-Site Trnas And Paromomycin For
           Molecule I.
 gi|226887556|pdb|2WDM|L Chain L, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 30s
           Subunit A-,P-, And E-Site Trnas And Paromomycin For
           Molecule Ii.
 gi|261824619|pdb|2WRN|L Chain L, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 1 Of 4).
 gi|261824678|pdb|2WRQ|L Chain L, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 3 Of 4).
 gi|307567973|pdb|2XFZ|L Chain L, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 1 Of 4)
 gi|307568031|pdb|2XG1|L Chain L, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 3 Of 4)
 gi|307776623|pdb|3OTO|L Chain L, Crystal Structure Of The 30s Ribosomal Subunit From A Ksga
           Mutant Of Thermus Thermophilus (Hb8)
 gi|309320246|pdb|3OGE|L Chain L, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Chloramphenicol. This File Contains The 30s Subunit
           Of One 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|309320267|pdb|3OGY|L Chain L, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Chloramphenicol. This File Contains The 30s Subunit
           Of One 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|309320348|pdb|3OHC|L Chain L, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 30s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 gi|309320369|pdb|3OHD|L Chain L, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 30s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 gi|309320450|pdb|3OHY|L Chain L, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 30s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320501|pdb|3OI0|L Chain L, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 30s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320552|pdb|3OI2|L Chain L, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 30s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320603|pdb|3OI4|L Chain L, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 30s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|312207684|pdb|2XQD|L Chain L, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The 70s
           Ribosome With A Gtp Analog
 gi|325533413|pdb|2Y0U|L Chain L, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 gi|325533472|pdb|2Y0W|L Chain L, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 gi|581812|emb|CAA36418.1| unnamed protein product [Thermus thermophilus]
 gi|55773079|dbj|BAD71520.1| 30S ribosomal protein S12 [Thermus thermophilus HB8]
          Length = 135

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 99/120 (82%), Gaps = 1/120 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+NQL+RK R+   R  +KV AL+G P +RGVC  V TVTPKKPNSALRKV K RLTS
Sbjct: 4   LPTINQLVRKGRE-KVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTS 62

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGV DA GVK+RK++RS+YG 
Sbjct: 63  GYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGT 122


>gi|290487428|gb|ADD30098.1| ribosomal protein S12 [Antirrhinum majus]
          Length = 123

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHS V++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSSVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|109629811|gb|ABG35127.1| mutant RpsL [Serratia marcescens]
          Length = 124

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/125 (65%), Positives = 99/125 (79%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRKGSFRAC-AKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           M T+NQL+RKPR  S +A  + V AL   PQKRGVC RVYT TP KPNSALRKV + RLT
Sbjct: 1   MATINQLVRKPR--SVKAAKSNVPALEACPQKRGVCTRVYTTTPIKPNSALRKVCRVRLT 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG
Sbjct: 59  NGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYG 118

Query: 120 AERPK 124
            ++PK
Sbjct: 119 VKKPK 123


>gi|15594732|ref|NP_212521.1| 30S ribosomal protein S12 [Borrelia burgdorferi B31]
 gi|51598644|ref|YP_072832.1| 30S ribosomal protein S12 [Borrelia garinii PBi]
 gi|111115216|ref|YP_709834.1| 30S ribosomal protein S12 [Borrelia afzelii PKo]
 gi|195941263|ref|ZP_03086645.1| 30S ribosomal protein S12 [Borrelia burgdorferi 80a]
 gi|216263876|ref|ZP_03435870.1| ribosomal protein S12 [Borrelia afzelii ACA-1]
 gi|216264579|ref|ZP_03436571.1| ribosomal protein S12 [Borrelia burgdorferi 156a]
 gi|218249247|ref|YP_002374904.1| ribosomal protein S12 [Borrelia burgdorferi ZS7]
 gi|219684539|ref|ZP_03539482.1| ribosomal protein S12 [Borrelia garinii PBr]
 gi|219685456|ref|ZP_03540274.1| ribosomal protein S12 [Borrelia garinii Far04]
 gi|221217723|ref|ZP_03589191.1| ribosomal protein S12 [Borrelia burgdorferi 72a]
 gi|223888739|ref|ZP_03623330.1| ribosomal protein S12 [Borrelia burgdorferi 64b]
 gi|224531524|ref|ZP_03672156.1| ribosomal protein S12 [Borrelia valaisiana VS116]
 gi|224533131|ref|ZP_03673731.1| ribosomal protein S12 [Borrelia burgdorferi WI91-23]
 gi|224533844|ref|ZP_03674432.1| ribosomal protein S12 [Borrelia burgdorferi CA-11.2a]
 gi|224534636|ref|ZP_03675210.1| ribosomal protein S12 [Borrelia spielmanii A14S]
 gi|225549181|ref|ZP_03770156.1| ribosomal protein S12 [Borrelia burgdorferi 94a]
 gi|225552367|ref|ZP_03773307.1| ribosomal protein S12 [Borrelia sp. SV1]
 gi|226320548|ref|ZP_03796109.1| ribosomal protein S12 [Borrelia burgdorferi 29805]
 gi|226321702|ref|ZP_03797228.1| ribosomal protein S12 [Borrelia burgdorferi Bol26]
 gi|3914886|sp|O51348|RS12_BORBU RecName: Full=30S ribosomal protein S12
 gi|60390794|sp|Q661N1|RS12_BORGA RecName: Full=30S ribosomal protein S12
 gi|119366757|sp|Q0SNC0|RS12_BORAP RecName: Full=30S ribosomal protein S12
 gi|226708463|sp|B7J1V9|RS12_BORBZ RecName: Full=30S ribosomal protein S12
 gi|22037152|gb|AAM89910.1|AF400111_1 ribosomal protein S12 [Borrelia burgdorferi]
 gi|2688295|gb|AAB91503.1| ribosomal protein S12 (rpsL) [Borrelia burgdorferi B31]
 gi|51573215|gb|AAU07240.1| ribosomal protein S12 [Borrelia garinii PBi]
 gi|110890490|gb|ABH01658.1| ribosomal protein S12 [Borrelia afzelii PKo]
 gi|215979920|gb|EEC20742.1| ribosomal protein S12 [Borrelia afzelii ACA-1]
 gi|215981052|gb|EEC21859.1| ribosomal protein S12 [Borrelia burgdorferi 156a]
 gi|218164435|gb|ACK74496.1| ribosomal protein S12 [Borrelia burgdorferi ZS7]
 gi|219671901|gb|EED28955.1| ribosomal protein S12 [Borrelia garinii PBr]
 gi|219673012|gb|EED30033.1| ribosomal protein S12 [Borrelia garinii Far04]
 gi|221192400|gb|EEE18619.1| ribosomal protein S12 [Borrelia burgdorferi 72a]
 gi|223885555|gb|EEF56654.1| ribosomal protein S12 [Borrelia burgdorferi 64b]
 gi|224510989|gb|EEF81395.1| ribosomal protein S12 [Borrelia valaisiana VS116]
 gi|224511858|gb|EEF82259.1| ribosomal protein S12 [Borrelia burgdorferi WI91-23]
 gi|224513137|gb|EEF83500.1| ribosomal protein S12 [Borrelia burgdorferi CA-11.2a]
 gi|224514105|gb|EEF84425.1| ribosomal protein S12 [Borrelia spielmanii A14S]
 gi|225370407|gb|EEG99845.1| ribosomal protein S12 [Borrelia burgdorferi 94a]
 gi|225371365|gb|EEH00795.1| ribosomal protein S12 [Borrelia sp. SV1]
 gi|226232891|gb|EEH31644.1| ribosomal protein S12 [Borrelia burgdorferi Bol26]
 gi|226234046|gb|EEH32766.1| ribosomal protein S12 [Borrelia burgdorferi 29805]
 gi|312148302|gb|ADQ30961.1| ribosomal protein S12 [Borrelia burgdorferi JD1]
 gi|312149610|gb|ADQ29681.1| ribosomal protein S12 [Borrelia burgdorferi N40]
          Length = 124

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPRK      A   AL+  PQ+RG+C RV TVTPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLIRKPRKSQTEKTAS-PALQNCPQRRGICTRVMTVTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG  D  GV NRK+ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGAKDTLGVNNRKKGRSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|7524807|ref|NP_045809.1| ribosomal protein S12 [Chlorella vulgaris]
 gi|3024564|sp|P56354|RR12_CHLVU RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|2224400|dbj|BAA57884.1| 30S ribosomal protein S12 [Chlorella vulgaris]
          Length = 123

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+R  R        K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRSART-RLSKKTKSPALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GVK+R Q+RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDSAGVKDRSQSRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|28202218|ref|NP_777387.1| ribosomal protein S12 [Anthoceros formosae]
 gi|41688682|sp|Q85BW6|RR12_ANTFO RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|27807920|dbj|BAC55395.1| ribosomal protein S12 [Anthoceros formosae]
 gi|27808039|dbj|BAC55469.1| ribosomal protein S12 [Anthoceros formosae]
          Length = 123

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   ++  K  AL+G PQ+RGVC RVYT TPKKPNSALRKV + +LTS
Sbjct: 1   MPTIQQLIRSKRQ-LVKSRTKSPALQGCPQRRGVCTRVYTTTPKKPNSALRKVARVKLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GVK+RKQ RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDTVGVKDRKQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|167768223|ref|ZP_02440276.1| hypothetical protein CLOSS21_02779 [Clostridium sp. SS2/1]
 gi|317497819|ref|ZP_07956131.1| ribosomal protein S12 [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167709747|gb|EDS20326.1| hypothetical protein CLOSS21_02779 [Clostridium sp. SS2/1]
 gi|316894932|gb|EFV17102.1| ribosomal protein S12 [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 143

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/136 (58%), Positives = 97/136 (71%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGS------------FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK RK S            F +  K      +PQKRGVC  V T TPKKPNS
Sbjct: 6   MPTFNQLVRKGRKTSVKKSTAPALQKGFNSLKKKATDTSSPQKRGVCTAVKTATPKKPNS 65

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y ++RG LD  GV
Sbjct: 66  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIVRGTLDTAGV 125

Query: 109 KNRKQARSRYGAERPK 124
            NR QARS+YGA+RPK
Sbjct: 126 ANRMQARSKYGAKRPK 141


>gi|126090322|ref|YP_001041765.1| 30S ribosomal protein S12 [Shewanella baltica OS155]
 gi|152998744|ref|YP_001364425.1| 30S ribosomal protein S12 [Shewanella baltica OS185]
 gi|160873321|ref|YP_001552637.1| 30S ribosomal protein S12 [Shewanella baltica OS195]
 gi|217975206|ref|YP_002359957.1| 30S ribosomal protein S12 [Shewanella baltica OS223]
 gi|304412760|ref|ZP_07394362.1| ribosomal protein S12 [Shewanella baltica OS183]
 gi|307307424|ref|ZP_07587159.1| ribosomal protein S12 [Shewanella baltica BA175]
 gi|166231886|sp|A6WHS3|RS12_SHEB8 RecName: Full=30S ribosomal protein S12
 gi|189040478|sp|A9KW97|RS12_SHEB9 RecName: Full=30S ribosomal protein S12
 gi|254811105|sp|B8EBL0|RS12_SHEB2 RecName: Full=30S ribosomal protein S12
 gi|125999942|gb|ABN64010.1| ribosomal protein S12 [Shewanella baltica OS155]
 gi|151363362|gb|ABS06362.1| ribosomal protein S12 [Shewanella baltica OS185]
 gi|160858843|gb|ABX47377.1| ribosomal protein S12 [Shewanella baltica OS195]
 gi|217500341|gb|ACK48534.1| ribosomal protein S12 [Shewanella baltica OS223]
 gi|304348840|gb|EFM13256.1| ribosomal protein S12 [Shewanella baltica OS183]
 gi|306910212|gb|EFN40645.1| ribosomal protein S12 [Shewanella baltica BA175]
 gi|315265548|gb|ADT92401.1| ribosomal protein S12 [Shewanella baltica OS678]
          Length = 124

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR         V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRAPKVDK-TNVPALNACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  IRG LD  GV +R+Q+RS+YGA
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTIRGALDCAGVTSRRQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|262273386|ref|ZP_06051200.1| SSU ribosomal protein S12p (S23e) [Grimontia hollisae CIP 101886]
 gi|262222364|gb|EEY73675.1| SSU ribosomal protein S12p (S23e) [Grimontia hollisae CIP 101886]
          Length = 124

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRMKQV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RKQ RS+YG 
Sbjct: 60  GYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVNDRKQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|260588988|ref|ZP_05854901.1| ribosomal protein S12 [Blautia hansenii DSM 20583]
 gi|260540767|gb|EEX21336.1| ribosomal protein S12 [Blautia hansenii DSM 20583]
          Length = 146

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 100/136 (73%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKG------------SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL++K R+             S+ +  K T+   +PQKRGVC  V T TPKKPNS
Sbjct: 10  MPTFNQLVKKGRQTTVKKSTAPALQKSYNSLQKKTSDMSSPQKRGVCTAVKTATPKKPNS 69

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 70  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGV 129

Query: 109 KNRKQARSRYGAERPK 124
            NR+QARS+YGA+RPK
Sbjct: 130 ANRRQARSKYGAKRPK 145


>gi|167629462|ref|YP_001679961.1| 30S ribosomal protein s12 [Heliobacterium modesticaldum Ice1]
 gi|226708509|sp|B0TC51|RS12_HELMI RecName: Full=30S ribosomal protein S12
 gi|167592202|gb|ABZ83950.1| 30S ribosomal protein s12 [Heliobacterium modesticaldum Ice1]
          Length = 138

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QLIRK R+      +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLIRKGRE-VLTEKSTAPALKECPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVEV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  G +NR Q RS+YG 
Sbjct: 60  GVEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTAGTQNRNQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|46199635|ref|YP_005302.1| 30S ribosomal protein S12 [Thermus thermophilus HB27]
 gi|209156507|pdb|3D5A|L Chain L, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 30s Subunit, Release
           Factor 1 (Rf1), Two Trna, And Mrna Molecules Of One 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes As Described In Remark 400.
 gi|209156563|pdb|3D5C|L Chain L, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 30s Subunit, Release
           Factor 1 (Rf1), Two Trna, And Mrna Molecules Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes As Described In Remark 400.
 gi|218766784|pdb|3F1E|L Chain L, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           30s Subunit, Rf2, Two Trna, And Mrna Molecules Of One
           70s Ribosome. The Entire Crystal Structure Contains Two
           70s Ribosomes As Described In Remark 400.
 gi|218766840|pdb|3F1G|L Chain L, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           30s Subunit, Rf2, Two Trna, And Mrna Molecules Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes As Described In Remark 400.
 gi|46197261|gb|AAS81675.1| SSU ribosomal protein S12P [Thermus thermophilus HB27]
          Length = 134

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 99/120 (82%), Gaps = 1/120 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT+NQL+RK R+   R  +KV AL+G P +RGVC  V TVTPKKPNSALRKV K RLTS
Sbjct: 3   LPTINQLVRKGRE-KVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTS 61

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGV DA GVK+RK++RS+YG 
Sbjct: 62  GYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGT 121


>gi|37524438|ref|NP_927782.1| 30S ribosomal protein S12 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|52783383|sp|Q7N9B4|RS12_PHOLL RecName: Full=30S ribosomal protein S12
 gi|36783862|emb|CAE12724.1| ribosomal protein S12 [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 124

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRSMKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YG 
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|123966924|ref|YP_001012005.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9515]
 gi|156637363|sp|A2BYN7|RS12_PROM5 RecName: Full=30S ribosomal protein S12
 gi|123201290|gb|ABM72898.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9515]
          Length = 125

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QLI   RK   R   K  AL+  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTISQLIGSERKRLTRK-TKSPALKSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV+L GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KAPK 123


>gi|225550139|ref|ZP_03771099.1| ribosomal protein S12 [Borrelia burgdorferi 118a]
 gi|225369251|gb|EEG98704.1| ribosomal protein S12 [Borrelia burgdorferi 118a]
          Length = 124

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRKPRK      A   AL+  PQ+RG+C RV TVTPKKPNSALRKV + RL++
Sbjct: 1   MPTINQLIRKPRKSQTEKTAS-RALQNCPQRRGICTRVMTVTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG  D  GV NRK+ RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGAKDTLGVNNRKKGRSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|88799213|ref|ZP_01114792.1| 30S ribosomal protein S12 [Reinekea sp. MED297]
 gi|88777972|gb|EAR09168.1| 30S ribosomal protein S12 [Reinekea sp. MED297]
          Length = 124

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 95/124 (76%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK    A A V AL   PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRVTEASA-VRALEACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV  RK  RS+YG 
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDTSGVNERKNGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|156618847|ref|YP_001430088.1| ribosomal protein S12 [Cuscuta reflexa]
 gi|156618875|ref|YP_001430157.1| ribosomal protein S12 [Cuscuta reflexa]
 gi|156556032|emb|CAM98415.1| ribosomal protein S12 [Cuscuta reflexa]
          Length = 123

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   +   K  AL G PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIKNVTKSPALGGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSQYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|15640386|ref|NP_230013.1| 30S ribosomal protein S12 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121730315|ref|ZP_01682682.1| ribosomal protein S12 [Vibrio cholerae V52]
 gi|227080571|ref|YP_002809122.1| ribosomal protein S12 [Vibrio cholerae M66-2]
 gi|229506845|ref|ZP_04396353.1| SSU ribosomal protein S12p (S23e) [Vibrio cholerae BX 330286]
 gi|229508649|ref|ZP_04398143.1| SSU ribosomal protein S12p (S23e) [Vibrio cholerae B33]
 gi|229516031|ref|ZP_04405482.1| SSU ribosomal protein S12p (S23e) [Vibrio cholerae RC9]
 gi|229519933|ref|ZP_04409364.1| SSU ribosomal protein S12p (S23e) [Vibrio cholerae TM 11079-80]
 gi|229526977|ref|ZP_04416373.1| SSU ribosomal protein S12p (S23e) [Vibrio cholerae 12129(1)]
 gi|229606359|ref|YP_002877007.1| 30S ribosomal protein S12 [Vibrio cholerae MJ-1236]
 gi|254292151|ref|ZP_04962923.1| ribosomal protein S12 [Vibrio cholerae AM-19226]
 gi|254851671|ref|ZP_05241021.1| 30S ribosomal protein S12 [Vibrio cholerae MO10]
 gi|255747158|ref|ZP_05421101.1| SSU ribosomal protein S12p (S23e) [Vibrio cholera CIRS 101]
 gi|258623510|ref|ZP_05718512.1| 30S ribosomal protein S12 [Vibrio mimicus VM573]
 gi|262163587|ref|ZP_06031330.1| SSU ribosomal protein S12p (S23e) [Vibrio mimicus VM223]
 gi|262172543|ref|ZP_06040221.1| SSU ribosomal protein S12p (S23e) [Vibrio mimicus MB-451]
 gi|262401549|ref|ZP_06078116.1| SSU ribosomal protein S12p (S23e) [Vibrio sp. RC586]
 gi|14423920|sp|Q9KUZ9|RS12_VIBCH RecName: Full=30S ribosomal protein S12
 gi|254811116|sp|C3LR91|RS12_VIBCM RecName: Full=30S ribosomal protein S12
 gi|9654776|gb|AAF93532.1| ribosomal protein S12 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121627933|gb|EAX60504.1| ribosomal protein S12 [Vibrio cholerae V52]
 gi|150421950|gb|EDN13925.1| ribosomal protein S12 [Vibrio cholerae AM-19226]
 gi|227008459|gb|ACP04671.1| ribosomal protein S12 [Vibrio cholerae M66-2]
 gi|227012215|gb|ACP08425.1| ribosomal protein S12 [Vibrio cholerae O395]
 gi|229335500|gb|EEO00981.1| SSU ribosomal protein S12p (S23e) [Vibrio cholerae 12129(1)]
 gi|229343061|gb|EEO08048.1| SSU ribosomal protein S12p (S23e) [Vibrio cholerae TM 11079-80]
 gi|229346934|gb|EEO11901.1| SSU ribosomal protein S12p (S23e) [Vibrio cholerae RC9]
 gi|229354284|gb|EEO19213.1| SSU ribosomal protein S12p (S23e) [Vibrio cholerae B33]
 gi|229355950|gb|EEO20869.1| SSU ribosomal protein S12p (S23e) [Vibrio cholerae BX 330286]
 gi|229369014|gb|ACQ59437.1| SSU ribosomal protein S12p (S23e) [Vibrio cholerae MJ-1236]
 gi|254847376|gb|EET25790.1| 30S ribosomal protein S12 [Vibrio cholerae MO10]
 gi|255735207|gb|EET90609.1| SSU ribosomal protein S12p (S23e) [Vibrio cholera CIRS 101]
 gi|258584222|gb|EEW08969.1| 30S ribosomal protein S12 [Vibrio mimicus VM573]
 gi|261893619|gb|EEY39605.1| SSU ribosomal protein S12p (S23e) [Vibrio mimicus MB-451]
 gi|262027954|gb|EEY46616.1| SSU ribosomal protein S12p (S23e) [Vibrio mimicus VM223]
 gi|262352264|gb|EEZ01393.1| SSU ribosomal protein S12p (S23e) [Vibrio sp. RC586]
 gi|327483219|gb|AEA77626.1| SSU ribosomal protein S12p (S23e) [Vibrio cholerae LMA3894-4]
          Length = 124

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRAKQV-VKSNVPALAACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RKQARS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVNDRKQARSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|113461783|ref|YP_719852.1| 30S ribosomal protein S12 [Haemophilus somnus 129PT]
 gi|170718095|ref|YP_001785129.1| 30S ribosomal protein S12 [Haemophilus somnus 2336]
 gi|119366774|sp|Q0I535|RS12_HAES1 RecName: Full=30S ribosomal protein S12
 gi|189040463|sp|B0UWC6|RS12_HAES2 RecName: Full=30S ribosomal protein S12
 gi|112823826|gb|ABI25915.1| SSU ribosomal protein S12P [Haemophilus somnus 129PT]
 gi|168826224|gb|ACA31595.1| ribosomal protein S12 [Haemophilus somnus 2336]
          Length = 124

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRVKKV-VKSNVPALESCPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQSRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|26987190|ref|NP_742615.1| 30S ribosomal protein S12 [Pseudomonas putida KT2440]
 gi|104779750|ref|YP_606248.1| 30S ribosomal protein S12 [Pseudomonas entomophila L48]
 gi|148545734|ref|YP_001265836.1| 30S ribosomal protein S12 [Pseudomonas putida F1]
 gi|170723911|ref|YP_001751599.1| 30S ribosomal protein S12 [Pseudomonas putida W619]
 gi|325271160|ref|ZP_08137716.1| 30S ribosomal protein S12 [Pseudomonas sp. TJI-51]
 gi|38258504|sp|Q88QP0|RS12_PSEPK RecName: Full=30S ribosomal protein S12
 gi|122985974|sp|Q1IFX1|RS12_PSEE4 RecName: Full=30S ribosomal protein S12
 gi|166231879|sp|A5VXP2|RS12_PSEP1 RecName: Full=30S ribosomal protein S12
 gi|226712637|sp|B1JDW9|RS12_PSEPW RecName: Full=30S ribosomal protein S12
 gi|24981827|gb|AAN66079.1|AE016237_3 ribosomal protein S12 [Pseudomonas putida KT2440]
 gi|95108737|emb|CAK13431.1| 30S ribosomal protein S12 [Pseudomonas entomophila L48]
 gi|148509792|gb|ABQ76652.1| SSU ribosomal protein S12P [Pseudomonas putida F1]
 gi|169761914|gb|ACA75230.1| ribosomal protein S12 [Pseudomonas putida W619]
 gi|313496814|gb|ADR58180.1| RpsL [Pseudomonas putida BIRD-1]
 gi|324103712|gb|EGC01003.1| 30S ribosomal protein S12 [Pseudomonas sp. TJI-51]
          Length = 123

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+R+PRK S    + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRQPRKRSVEK-SDVPALQNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK R Q RS+YG 
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKGRNQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|331083291|ref|ZP_08332404.1| 30S ribosomal protein S12 [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330404372|gb|EGG83917.1| 30S ribosomal protein S12 [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 137

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 100/136 (73%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKG------------SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL++K R+             S+ +  K T+   +PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVKKGRQTTVKKSTAPALQKSYNSLQKKTSDMSSPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NR+QARS+YGA+RPK
Sbjct: 121 ANRRQARSKYGAKRPK 136


>gi|291523711|emb|CBK89298.1| SSU ribosomal protein S12P [Eubacterium rectale DSM 17629]
 gi|291528827|emb|CBK94413.1| SSU ribosomal protein S12P [Eubacterium rectale M104/1]
          Length = 139

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 98/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGS------------FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+ S            F +  K      +PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRQTSVKKSTAPALQRSFNSLQKKPINTSSPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NRKQARS+YGA+RPK
Sbjct: 121 ANRKQARSKYGAKRPK 136


>gi|139389464|ref|YP_001123094.1| ribosomal protein S12 [Olimarabidopsis pumila]
 gi|158513592|sp|A4QJX7|RR12B_OLIPU RecName: Full=30S ribosomal protein S12-B, chloroplastic
 gi|134286358|dbj|BAF49985.1| ribosomal protein S12 [Olimarabidopsis pumila]
          Length = 124

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/125 (65%), Positives = 99/125 (79%), Gaps = 2/125 (1%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVY-TVTPKKPNSALRKVIKARLT 59
           MPT+ QLIR  R+   R   K  ALRG PQ+RG C RVY T+TPKKPNSALRKV + RLT
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVTKSPALRGCPQRRGTCTRVYSTITPKKPNSALRKVARVRLT 59

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           SG E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG
Sbjct: 60  SGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYG 119

Query: 120 AERPK 124
            ++PK
Sbjct: 120 VKKPK 124


>gi|206895261|ref|YP_002247339.1| ribosomal protein S12 [Coprothermobacter proteolyticus DSM 5265]
 gi|206737878|gb|ACI16956.1| ribosomal protein S12 [Coprothermobacter proteolyticus DSM 5265]
          Length = 129

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           +PT NQL++  R+   +  +K  AL GNPQKRGVCL V T+TPKKPNSALRK+ + RL++
Sbjct: 4   LPTFNQLVKYGRE-KVKTKSKSQALEGNPQKRGVCLVVRTMTPKKPNSALRKIARVRLSN 62

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV+AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RGV DA GV++R+Q RS+YGA
Sbjct: 63  GYEVLAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGVYDAAGVEDRRQGRSKYGA 122

Query: 121 ERPK 124
           +RPK
Sbjct: 123 KRPK 126


>gi|27151791|sp|P30060|RR12_EPIVI RecName: Full=Plastid 30S ribosomal protein S12
          Length = 124

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 97/121 (80%), Gaps = 1/121 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIRK R+ +     K  ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRKKRQPNLNV-TKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+E+ AY+PG GHNLQEHS V++ GGRVKDLPGV+Y +IRG LDA GVK+R+Q RS+YG 
Sbjct: 60  GIEITAYIPGIGHNLQEHSSVLVRGGRVKDLPGVRYHIIRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 E 121
           +
Sbjct: 120 K 120


>gi|182412055|ref|YP_001817121.1| 30S ribosomal protein S12 [Opitutus terrae PB90-1]
 gi|226712626|sp|B1ZNF2|RS12_OPITP RecName: Full=30S ribosomal protein S12
 gi|177839269|gb|ACB73521.1| ribosomal protein S12 [Opitutus terrae PB90-1]
          Length = 126

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 102/124 (82%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R+   R  +K  AL GNP +RGVC++V T TPKKPNSA+RKV K RLT+
Sbjct: 1   MPTINQLVRKGRR-KVRTKSKSPALDGNPFRRGVCVQVMTRTPKKPNSAIRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EVI+Y+P EGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LDA GV+ R+++RS+YG 
Sbjct: 60  GNEVISYIPDEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDATGVEKRRRSRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|313673472|ref|YP_004051583.1| SSU ribosomal protein s12p [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940228|gb|ADR19420.1| SSU ribosomal protein S12P [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 124

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  R+       K  AL+ NPQKRGVC+RVYT TPKKPNSALRKV + RL +
Sbjct: 1   MPTLNQLVRHGREVILNRT-KSPALKNNPQKRGVCVRVYTTTPKKPNSALRKVARVRLVN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y++IRG LD  GVKNR ++RS+YG 
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGTLDTAGVKNRNKSRSKYGV 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|307823437|ref|ZP_07653666.1| ribosomal protein S12 [Methylobacter tundripaludum SV96]
 gi|307735422|gb|EFO06270.1| ribosomal protein S12 [Methylobacter tundripaludum SV96]
          Length = 124

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRAKKIEK-SNVPALEACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y V+RG LDA GV NRK  RS+YG 
Sbjct: 60  GAEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGSLDASGVTNRKCGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|56416536|ref|YP_153610.1| 30S ribosomal protein S12 [Anaplasma marginale str. St. Maries]
 gi|222474904|ref|YP_002563319.1| 30S ribosomal protein S12 (rpsL) [Anaplasma marginale str. Florida]
 gi|254994755|ref|ZP_05276945.1| 30S ribosomal protein S12 [Anaplasma marginale str. Mississippi]
 gi|255002876|ref|ZP_05277840.1| 30S ribosomal protein S12 [Anaplasma marginale str. Puerto Rico]
 gi|255004008|ref|ZP_05278809.1| 30S ribosomal protein S12 [Anaplasma marginale str. Virginia]
 gi|269959049|ref|YP_003328838.1| 30S ribosomal protein S12 [Anaplasma centrale str. Israel]
 gi|81359252|sp|Q5PBH4|RS12_ANAMM RecName: Full=30S ribosomal protein S12
 gi|254811062|sp|B9KHV1|RS12_ANAMF RecName: Full=30S ribosomal protein S12
 gi|56387768|gb|AAV86355.1| 30S ribosomal protein S12 [Anaplasma marginale str. St. Maries]
 gi|222419040|gb|ACM49063.1| 30S ribosomal protein S12 (rpsL) [Anaplasma marginale str. Florida]
 gi|269848880|gb|ACZ49524.1| 30S ribosomal protein S12 [Anaplasma centrale str. Israel]
          Length = 124

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 101/123 (82%), Gaps = 2/123 (1%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R+PR+    +  K  AL+ NPQKR VC++VYT TPKKPNSALRKV + R+  
Sbjct: 1   MPTINQLVRRPRR-PRESANKAPALQHNPQKRAVCVKVYTTTPKKPNSALRKVARVRIAG 59

Query: 61  -GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
            G EVIAY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA+GV+ RK+ARS+YG
Sbjct: 60  YGSEVIAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDAKGVQGRKKARSKYG 119

Query: 120 AER 122
            +R
Sbjct: 120 VKR 122


>gi|254785058|ref|YP_003072486.1| ribosomal protein S12 [Teredinibacter turnerae T7901]
 gi|259494664|sp|C5BQ41|RS12_TERTT RecName: Full=30S ribosomal protein S12
 gi|237685344|gb|ACR12608.1| ribosomal protein S12 [Teredinibacter turnerae T7901]
          Length = 123

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK   +  + V AL   PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRKRKAKT-SDVRALEACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RK+ RS+YG 
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDTSGVNDRKRGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|254973725|ref|ZP_05270197.1| 30S ribosomal protein S12 [Clostridium difficile QCD-66c26]
 gi|255091116|ref|ZP_05320594.1| 30S ribosomal protein S12 [Clostridium difficile CIP 107932]
 gi|255099228|ref|ZP_05328205.1| 30S ribosomal protein S12 [Clostridium difficile QCD-63q42]
 gi|255305010|ref|ZP_05349182.1| 30S ribosomal protein S12 [Clostridium difficile ATCC 43255]
 gi|255312770|ref|ZP_05354353.1| 30S ribosomal protein S12 [Clostridium difficile QCD-76w55]
 gi|255515530|ref|ZP_05383206.1| 30S ribosomal protein S12 [Clostridium difficile QCD-97b34]
 gi|255648624|ref|ZP_05395526.1| 30S ribosomal protein S12 [Clostridium difficile QCD-37x79]
 gi|255654157|ref|ZP_05399566.1| 30S ribosomal protein S12 [Clostridium difficile QCD-23m63]
 gi|306518747|ref|ZP_07405094.1| 30S ribosomal protein S12 [Clostridium difficile QCD-32g58]
          Length = 140

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 98/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKG------------SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT+NQL+RK RK              + +  K       PQKRGVC  V TVTPKKPNS
Sbjct: 1   MPTINQLVRKSRKALEKKSTAPALQKGYNSLNKKVTDASAPQKRGVCTSVKTVTPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRKV + RLT+G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV
Sbjct: 61  ALRKVARVRLTNGIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
             R+Q+RS+YGA+RPK
Sbjct: 121 DKRRQSRSKYGAKRPK 136


>gi|15896389|ref|NP_349738.1| 30S ribosomal protein S12 [Clostridium acetobutylicum ATCC 824]
 gi|20140168|sp|Q97EH2|RS12_CLOAB RecName: Full=30S ribosomal protein S12
 gi|15026206|gb|AAK81078.1|AE007809_4 Ribosomal protein S12 [Clostridium acetobutylicum ATCC 824]
 gi|325510545|gb|ADZ22181.1| 30S ribosomal protein S12 [Clostridium acetobutylicum EA 2018]
          Length = 125

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RK RK +  A +   AL+  PQKRGVC  V T TPKKPNSALRK+ + RLT+
Sbjct: 1   MPTISQLVRKGRK-TLAAKSTAPALKECPQKRGVCTVVKTTTPKKPNSALRKIARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GV +RKQARS+YGA
Sbjct: 60  GYEVTAYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDAAGVADRKQARSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|28199865|ref|NP_780179.1| 30S ribosomal protein S12 [Xylella fastidiosa Temecula1]
 gi|71275245|ref|ZP_00651532.1| Ribosomal protein S12, bacterial and chloroplast form [Xylella
           fastidiosa Dixon]
 gi|71899987|ref|ZP_00682133.1| Ribosomal protein S12, bacterial and chloroplast form [Xylella
           fastidiosa Ann-1]
 gi|77747617|ref|NP_299908.2| 30S ribosomal protein S12 [Xylella fastidiosa 9a5c]
 gi|170731244|ref|YP_001776677.1| 30S ribosomal protein S12 [Xylella fastidiosa M12]
 gi|54039347|sp|P66380|RS12_XYLFT RecName: Full=30S ribosomal protein S12
 gi|54042119|sp|P66379|RS12_XYLFA RecName: Full=30S ribosomal protein S12
 gi|226712674|sp|B0U5X5|RS12_XYLFM RecName: Full=30S ribosomal protein S12
 gi|28057986|gb|AAO29828.1| 30S ribosomal protein S12 [Xylella fastidiosa Temecula1]
 gi|71164054|gb|EAO13769.1| Ribosomal protein S12, bacterial and chloroplast form [Xylella
           fastidiosa Dixon]
 gi|71730274|gb|EAO32359.1| Ribosomal protein S12, bacterial and chloroplast form [Xylella
           fastidiosa Ann-1]
 gi|167966037|gb|ACA13047.1| 30S ribosomal protein S12 [Xylella fastidiosa M12]
 gi|307578899|gb|ADN62868.1| 30S ribosomal protein S12 [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 124

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+ S    A   AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MATINQLVRKPRQASTYKSAS-PALDKCPQRRGVCTRVYTSTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LDA GV  R+Q RS+YGA
Sbjct: 60  QEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|262067235|ref|ZP_06026847.1| ribosomal protein S12 [Fusobacterium periodonticum ATCC 33693]
 gi|291379049|gb|EFE86567.1| ribosomal protein S12 [Fusobacterium periodonticum ATCC 33693]
          Length = 122

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 99/121 (81%), Gaps = 1/121 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL++K R+ +     K  AL+GNPQ+RGVC+RVYT TPKKPNSALRKV + +LT+
Sbjct: 1   MPTLSQLVKKGRQ-TLTEKRKSPALQGNPQRRGVCIRVYTTTPKKPNSALRKVARVKLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PGEGHNLQEHS+V++ GGR KDLPGV+Y++IRG LD  GV  RKQ RS+YGA
Sbjct: 60  GIEVTCYIPGEGHNLQEHSIVLVRGGRTKDLPGVRYKIIRGALDTAGVAKRKQGRSKYGA 119

Query: 121 E 121
           +
Sbjct: 120 K 120


>gi|260681841|ref|YP_003213126.1| 30S ribosomal protein S12 [Clostridium difficile CD196]
 gi|260685439|ref|YP_003216572.1| 30S ribosomal protein S12 [Clostridium difficile R20291]
 gi|296449804|ref|ZP_06891572.1| 30S ribosomal protein S12 [Clostridium difficile NAP08]
 gi|296877868|ref|ZP_06901889.1| 30S ribosomal protein S12 [Clostridium difficile NAP07]
 gi|260208004|emb|CBA60177.1| 30S ribosomal protein S12 [Clostridium difficile CD196]
 gi|260211455|emb|CBE01570.1| 30S ribosomal protein S12 [Clostridium difficile R20291]
 gi|296261348|gb|EFH08175.1| 30S ribosomal protein S12 [Clostridium difficile NAP08]
 gi|296431122|gb|EFH16948.1| 30S ribosomal protein S12 [Clostridium difficile NAP07]
          Length = 141

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 98/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKG------------SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT+NQL+RK RK              + +  K       PQKRGVC  V TVTPKKPNS
Sbjct: 2   MPTINQLVRKSRKALEKKSTAPALQKGYNSLNKKVTDASAPQKRGVCTSVKTVTPKKPNS 61

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRKV + RLT+G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV
Sbjct: 62  ALRKVARVRLTNGIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGTLDTAGV 121

Query: 109 KNRKQARSRYGAERPK 124
             R+Q+RS+YGA+RPK
Sbjct: 122 DKRRQSRSKYGAKRPK 137


>gi|226951216|ref|ZP_03821680.1| 30S ribosomal protein S12 [Acinetobacter sp. ATCC 27244]
 gi|262373247|ref|ZP_06066526.1| ribosomal protein S12 [Acinetobacter junii SH205]
 gi|294649603|ref|ZP_06727021.1| 30S ribosomal protein S12 [Acinetobacter haemolyticus ATCC 19194]
 gi|226838046|gb|EEH70429.1| 30S ribosomal protein S12 [Acinetobacter sp. ATCC 27244]
 gi|262313272|gb|EEY94357.1| ribosomal protein S12 [Acinetobacter junii SH205]
 gi|292824512|gb|EFF83297.1| 30S ribosomal protein S12 [Acinetobacter haemolyticus ATCC 19194]
          Length = 124

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T NQLIRK R       +KV AL+  PQ+RGVC RVYT TPKKPNSA+RKV + RLTS
Sbjct: 1   MATTNQLIRKGRTTLIEK-SKVPALKACPQRRGVCTRVYTTTPKKPNSAMRKVCRVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+R Q+RS+YGA
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDCAGVKDRNQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|162286748|ref|YP_001083900.2| 30S ribosomal protein S12 [Acinetobacter baumannii ATCC 17978]
 gi|169634059|ref|YP_001707795.1| 30S ribosomal protein S12 [Acinetobacter baumannii SDF]
 gi|169796953|ref|YP_001714746.1| 30S ribosomal protein S12 [Acinetobacter baumannii AYE]
 gi|184157135|ref|YP_001845474.1| 30S ribosomal protein S12 [Acinetobacter baumannii ACICU]
 gi|213156641|ref|YP_002318302.1| ribosomal protein S12 [Acinetobacter baumannii AB0057]
 gi|215484414|ref|YP_002326647.1| ribosomal protein S12 [Acinetobacter baumannii AB307-0294]
 gi|239501184|ref|ZP_04660494.1| 30S ribosomal protein S12 [Acinetobacter baumannii AB900]
 gi|255318596|ref|ZP_05359827.1| ribosomal protein S12 [Acinetobacter radioresistens SK82]
 gi|260555756|ref|ZP_05827976.1| ribosomal protein S12 [Acinetobacter baumannii ATCC 19606]
 gi|262379177|ref|ZP_06072333.1| ribosomal protein S12 [Acinetobacter radioresistens SH164]
 gi|294842393|ref|ZP_06787076.1| 30S ribosomal protein S12 [Acinetobacter sp. 6014059]
 gi|301347378|ref|ZP_07228119.1| 30S ribosomal protein S12 [Acinetobacter baumannii AB056]
 gi|301512016|ref|ZP_07237253.1| 30S ribosomal protein S12 [Acinetobacter baumannii AB058]
 gi|301596496|ref|ZP_07241504.1| 30S ribosomal protein S12 [Acinetobacter baumannii AB059]
 gi|158513668|sp|A3M304|RS12_ACIBT RecName: Full=30S ribosomal protein S12
 gi|226708442|sp|B7GYN0|RS12_ACIB3 RecName: Full=30S ribosomal protein S12
 gi|226708443|sp|B7I7R9|RS12_ACIB5 RecName: Full=30S ribosomal protein S12
 gi|226708444|sp|B2HUQ2|RS12_ACIBC RecName: Full=30S ribosomal protein S12
 gi|226708445|sp|B0VTG5|RS12_ACIBS RecName: Full=30S ribosomal protein S12
 gi|226708446|sp|B0V8W3|RS12_ACIBY RecName: Full=30S ribosomal protein S12
 gi|169149880|emb|CAM87771.1| 30S ribosomal protein S12 [Acinetobacter baumannii AYE]
 gi|169152851|emb|CAP01880.1| 30S ribosomal protein S12 [Acinetobacter baumannii]
 gi|183208729|gb|ACC56127.1| putative 30S ribosomal protein S12 [Acinetobacter baumannii ACICU]
 gi|193076619|gb|ABO11298.2| 30S ribosomal protein S12 [Acinetobacter baumannii ATCC 17978]
 gi|213055801|gb|ACJ40703.1| ribosomal protein S12 [Acinetobacter baumannii AB0057]
 gi|213987275|gb|ACJ57574.1| ribosomal protein S12 [Acinetobacter baumannii AB307-0294]
 gi|255304278|gb|EET83464.1| ribosomal protein S12 [Acinetobacter radioresistens SK82]
 gi|260410667|gb|EEX03965.1| ribosomal protein S12 [Acinetobacter baumannii ATCC 19606]
 gi|262298634|gb|EEY86547.1| ribosomal protein S12 [Acinetobacter radioresistens SH164]
 gi|322507033|gb|ADX02487.1| rpsL [Acinetobacter baumannii 1656-2]
 gi|323516901|gb|ADX91282.1| 30S ribosomal protein S12 [Acinetobacter baumannii TCDC-AB0715]
          Length = 124

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T NQLIRK R  +    +KV AL+  PQ+RGVC RVYT TPKKPNSA+RKV + RLTS
Sbjct: 1   MATTNQLIRKGRT-TLVEKSKVPALKACPQRRGVCTRVYTTTPKKPNSAMRKVCRVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+R Q+RS+YGA
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDCAGVKDRNQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|237809516|ref|YP_002893956.1| 30S ribosomal protein S12 [Tolumonas auensis DSM 9187]
 gi|259494665|sp|C4LBU6|RS12_TOLAT RecName: Full=30S ribosomal protein S12
 gi|237501777|gb|ACQ94370.1| ribosomal protein S12 [Tolumonas auensis DSM 9187]
          Length = 124

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRVKQV-VKSSVPALNACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|291459926|ref|ZP_06599316.1| ribosomal protein S12 [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291417267|gb|EFE90986.1| ribosomal protein S12 [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 140

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 96/136 (70%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGS------------FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+ S            F +  K       PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRETSRKKSTAPALQRGFNSLRKRATTNDAPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVVM+ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGTRYHIIRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NR QARS+YGA+RPK
Sbjct: 121 ANRMQARSKYGAKRPK 136


>gi|167748165|ref|ZP_02420292.1| hypothetical protein ANACAC_02909 [Anaerostipes caccae DSM 14662]
 gi|317472303|ref|ZP_07931631.1| ribosomal protein S12 [Anaerostipes sp. 3_2_56FAA]
 gi|167652157|gb|EDR96286.1| hypothetical protein ANACAC_02909 [Anaerostipes caccae DSM 14662]
 gi|316900260|gb|EFV22246.1| ribosomal protein S12 [Anaerostipes sp. 3_2_56FAA]
          Length = 137

 Score =  164 bits (414), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 80/136 (58%), Positives = 98/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGS------------FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK RK S            F +  K +    +PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRKTSTKKSTAPALQKSFNSLKKRSVNASSPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y ++RG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIVRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NR QARS+YGA+RPK
Sbjct: 121 ANRMQARSKYGAKRPK 136


>gi|258406190|ref|YP_003198932.1| 30S ribosomal protein S12 [Desulfohalobium retbaense DSM 5692]
 gi|257798417|gb|ACV69354.1| ribosomal protein S12 [Desulfohalobium retbaense DSM 5692]
          Length = 123

 Score =  164 bits (414), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 101/124 (81%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI K  +       K  AL+  PQ+RGVC+RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLISK-GRKKMVKRKKRAALQQCPQRRGVCVRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPGV+Y VIRG LD  GV++R+Q+RS+YGA
Sbjct: 60  GIEVTSYIPGEGHNLQEHSVVLVRGGRVKDLPGVRYTVIRGTLDTAGVQDRRQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|172072891|ref|YP_001806652.1| ribosomal protein S12 [Cryptomeria japonica]
 gi|171854910|dbj|BAG16650.1| ribosomal protein S12 [Cryptomeria japonica]
 gi|239794279|dbj|BAH73276.1| ribosomal protein S12 [Cryptomeria japonica]
 gi|239794361|dbj|BAH73357.1| ribosomal protein S12 [Cryptomeria japonica]
          Length = 123

 Score =  164 bits (414), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+       K  ALRG PQ++GVC RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRNARQ-PIENRTKSPALRGCPQRKGVCARVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             E+ AY+PG  HNLQEHSVV++ GGRVKDLPGVKY +IRG+LDA  VKNRKQ RS+YG 
Sbjct: 60  KYEITAYIPGIDHNLQEHSVVLVRGGRVKDLPGVKYHIIRGILDAVSVKNRKQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|327195230|ref|YP_004339012.1| ribosomal protein S12 [Coccomyxa sp. C-169]
 gi|325070726|gb|ADY75454.1| ribosomal protein S12 [Coccomyxa sp. C-169]
          Length = 126

 Score =  164 bits (414), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 102/125 (81%), Gaps = 1/125 (0%)

Query: 1   MPTVNQLIR-KPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT++Q+I+ K  +   R   K  AL+ +PQK+GVCLRV+T TPKKPNSALRKV K RLT
Sbjct: 1   MPTIHQIIKTKNERPPKRVRRKTPALKQSPQKQGVCLRVFTRTPKKPNSALRKVAKVRLT 60

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +  EV AY+PGEGHNLQEHSVV++ GGRVKDLPGVKY V+RGVLDAQGV  R+Q+RS+YG
Sbjct: 61  NYAEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVKYHVVRGVLDAQGVVQRRQSRSKYG 120

Query: 120 AERPK 124
           A+R K
Sbjct: 121 AKRRK 125


>gi|52424217|ref|YP_087354.1| 30S ribosomal protein S12 [Mannheimia succiniciproducens MBEL55E]
 gi|60390793|sp|Q65W91|RS12_MANSM RecName: Full=30S ribosomal protein S12
 gi|52306269|gb|AAU36769.1| RpsL protein [Mannheimia succiniciproducens MBEL55E]
          Length = 124

 Score =  164 bits (414), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRVKKV-VKSNVPALQACPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|288925719|ref|ZP_06419651.1| ribosomal protein S12 [Prevotella buccae D17]
 gi|315606508|ref|ZP_07881523.1| 30S ribosomal protein S12 [Prevotella buccae ATCC 33574]
 gi|288337657|gb|EFC76011.1| ribosomal protein S12 [Prevotella buccae D17]
 gi|315251914|gb|EFU31888.1| 30S ribosomal protein S12 [Prevotella buccae ATCC 33574]
          Length = 127

 Score =  164 bits (414), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RK RK +  + +K  AL   PQ+RGVC+RVYT TPKKPNSA+RKV + RLT+
Sbjct: 1   MPTISQLVRKGRKEAV-STSKSPALDNCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EV +Y+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD  GV NR Q RS+YGA
Sbjct: 60  QKEVNSYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVANRTQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|253987821|ref|YP_003039177.1| 30s ribosomal protein s12 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779271|emb|CAQ82432.1| 30s ribosomal protein s12 [Photorhabdus asymbiotica]
          Length = 162

 Score =  164 bits (414), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 39  MATINQLVRKPRSMKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 97

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YG 
Sbjct: 98  GYEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQGRSKYGV 157

Query: 121 ERPK 124
           ++PK
Sbjct: 158 KKPK 161


>gi|146308928|ref|YP_001189393.1| 30S ribosomal protein S12 [Pseudomonas mendocina ymp]
 gi|330505212|ref|YP_004382081.1| 30S ribosomal protein S12 [Pseudomonas mendocina NK-01]
 gi|166231878|sp|A4XZ95|RS12_PSEMY RecName: Full=30S ribosomal protein S12
 gi|145577129|gb|ABP86661.1| SSU ribosomal protein S12P [Pseudomonas mendocina ymp]
 gi|328919498|gb|AEB60329.1| 30S ribosomal protein S12 [Pseudomonas mendocina NK-01]
          Length = 123

 Score =  164 bits (414), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+R+PRK      + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRQPRKRIVEK-SDVPALQNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YG 
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKDRKQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|57238894|ref|YP_180030.1| 30S ribosomal protein S12 [Ehrlichia ruminantium str. Welgevonden]
 gi|58578824|ref|YP_197036.1| 30S ribosomal protein S12 [Ehrlichia ruminantium str. Welgevonden]
 gi|58616882|ref|YP_196081.1| 30S ribosomal protein S12 [Ehrlichia ruminantium str. Gardel]
 gi|75356609|sp|Q5FFE9|RS12_EHRRG RecName: Full=30S ribosomal protein S12
 gi|81353039|sp|Q5HC14|RS12_EHRRW RecName: Full=30S ribosomal protein S12
 gi|57160973|emb|CAH57879.1| 30S ribosomal protein S12 [Ehrlichia ruminantium str. Welgevonden]
 gi|58416494|emb|CAI27607.1| 30S ribosomal protein S12 [Ehrlichia ruminantium str. Gardel]
 gi|58417450|emb|CAI26654.1| 30S ribosomal protein S12 [Ehrlichia ruminantium str. Welgevonden]
          Length = 123

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 101/123 (82%), Gaps = 2/123 (1%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R PRK S     K  AL+ NPQKR VC++VYT TP+KPNSALRKV + ++  
Sbjct: 1   MPTINQLVRSPRK-SRALLNKAPALQHNPQKRAVCVKVYTTTPRKPNSALRKVARVKIAG 59

Query: 61  -GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
            G EVIAY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD++GV+NRK+ARS+YG
Sbjct: 60  YGSEVIAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDSRGVQNRKKARSKYG 119

Query: 120 AER 122
            ++
Sbjct: 120 VKK 122


>gi|291166055|gb|EFE28101.1| 30S ribosomal protein S12 [Filifactor alocis ATCC 35896]
          Length = 139

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 99/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKG------------SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT+NQL+RK R+              F A  K      +PQKRGVC  V TVTPKKPNS
Sbjct: 1   MPTINQLVRKGREAVEYKSTAPALQKGFNALKKRATNLNSPQKRGVCTAVKTVTPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRKV + RLT+G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  G+
Sbjct: 61  ALRKVARVRLTNGIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTAGI 120

Query: 109 KNRKQARSRYGAERPK 124
           + R+QARS+YG +RPK
Sbjct: 121 EKRRQARSKYGTKRPK 136


>gi|291560241|emb|CBL39041.1| SSU ribosomal protein S12P [butyrate-producing bacterium SSC/2]
          Length = 138

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 80/136 (58%), Positives = 97/136 (71%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGS------------FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK RK S            F +  K      +PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRKTSVKKSTAPALQKGFNSLKKKATDTSSPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y ++RG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIVRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NR QARS+YGA+RPK
Sbjct: 121 ANRMQARSKYGAKRPK 136


>gi|258513635|ref|YP_003189857.1| 30S ribosomal protein S12 [Desulfotomaculum acetoxidans DSM 771]
 gi|257777340|gb|ACV61234.1| ribosomal protein S12 [Desulfotomaculum acetoxidans DSM 771]
          Length = 124

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+ K R  S    +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVHKGR-SSLITKSTAPALKECPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV+NR ++RS+YG 
Sbjct: 60  GIEVTSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTAGVQNRNRSRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|33864046|ref|NP_895606.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9313]
 gi|124024052|ref|YP_001018359.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9303]
 gi|52783392|sp|Q7V503|RS12_PROMM RecName: Full=30S ribosomal protein S12
 gi|156637362|sp|A2CC84|RS12_PROM3 RecName: Full=30S ribosomal protein S12
 gi|33635630|emb|CAE21954.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9313]
 gi|123964338|gb|ABM79094.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9303]
          Length = 125

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  ALR  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRTERQHLTRK-TKSPALRACPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GVK+R Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRSQSRSKYGA 119

Query: 121 ERPK 124
           +  K
Sbjct: 120 KASK 123


>gi|11465755|ref|NP_053899.1| ribosomal protein S12 [Porphyra purpurea]
 gi|1710692|sp|P51289|RR12_PORPU RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|1276755|gb|AAC08175.1| 30S ribosomal protein S12 [Porphyra purpurea]
          Length = 124

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 78/124 (62%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+R  R+       K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRSERR-KINKKTKSPALKSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHN+QEHSVV++ GGR+KDLPGV+Y V+RG LDA GVK+R+++RS+YG 
Sbjct: 60  GFEVTAYIPGVGHNIQEHSVVLIRGGRIKDLPGVRYHVVRGTLDAAGVKDRRKSRSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|153812159|ref|ZP_01964827.1| hypothetical protein RUMOBE_02556 [Ruminococcus obeum ATCC 29174]
 gi|149831814|gb|EDM86900.1| hypothetical protein RUMOBE_02556 [Ruminococcus obeum ATCC 29174]
 gi|295108952|emb|CBL22905.1| SSU ribosomal protein S12P [Ruminococcus obeum A2-162]
          Length = 138

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 80/136 (58%), Positives = 98/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKG------------SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+             +F +  K    +  PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRQTAVKKSTAPALQRTFNSLRKKAVEQSAPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NRKQARS+YGA+RPK
Sbjct: 121 ANRKQARSKYGAKRPK 136


>gi|83648857|ref|YP_437292.1| 30S ribosomal protein S12 [Hahella chejuensis KCTC 2396]
 gi|115305657|sp|Q2S907|RS12_HAHCH RecName: Full=30S ribosomal protein S12
 gi|83636900|gb|ABC32867.1| ribosomal protein S12 [Hahella chejuensis KCTC 2396]
          Length = 124

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL+G PQ+RGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRSRKV-AKSDVPALQGCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +R+Q RS+YGA
Sbjct: 60  GYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTAGVNDRRQGRSKYGA 119

Query: 121 ERPK 124
           +R K
Sbjct: 120 KRGK 123


>gi|328958735|ref|YP_004376121.1| 30S ribosomal protein S12 [Carnobacterium sp. 17-4]
 gi|328675059|gb|AEB31105.1| 30S ribosomal protein S12 [Carnobacterium sp. 17-4]
          Length = 136

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 98/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRG------------NPQKRGVCLRVYTVTPKKPNS 48
           MPT+NQL+RKPRK            RG            +PQKRGVC RV T+TPKKPNS
Sbjct: 1   MPTINQLVRKPRKSKIEKSESPALNRGYNSKRKKQTTVNSPQKRGVCTRVGTMTPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK  + RL++ +EV AY+PGEGHNLQEHSVV+L GGRVKDLPGV+Y ++RG LD  GV
Sbjct: 61  ALRKYARVRLSNLIEVTAYIPGEGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            +RKQ+RS+YG +RPK
Sbjct: 121 ADRKQSRSKYGTKRPK 136


>gi|294142938|ref|YP_003558916.1| 30S ribosomal protein S12 [Shewanella violacea DSS12]
 gi|293329407|dbj|BAJ04138.1| ribosomal protein S12 [Shewanella violacea DSS12]
          Length = 124

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 95/124 (76%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR         V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRSPKV-VKTNVPALNACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  IRG LD  GV +R+Q RS+YGA
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTIRGALDCAGVSDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|219872017|ref|YP_002476392.1| 30S ribosomal protein S12 [Haemophilus parasuis SH0165]
 gi|254811089|sp|B8F7Z2|RS12_HAEPS RecName: Full=30S ribosomal protein S12
 gi|219692221|gb|ACL33444.1| 30S ribosomal protein S12 [Haemophilus parasuis SH0165]
          Length = 124

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRVKKV-VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|90994479|ref|YP_536969.1| ribosomal protein S12 [Porphyra yezoensis]
 gi|122238238|sp|Q1XDJ9|RR12_PORYE RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|90819043|dbj|BAE92412.1| 30S ribosomal protein S12 [Porphyra yezoensis]
 gi|116266154|gb|ABJ91315.1| 30S ribosomal protein S12 [Porphyra yezoensis]
          Length = 124

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 78/124 (62%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+R  R+   +   K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRSERRKIHKK-TKSPALQSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHN+QEHSVV++ GGR+KDLPGV+Y V+RG LDA GVK+R+++RS+YG 
Sbjct: 60  GFEVTAYIPGVGHNIQEHSVVLIRGGRIKDLPGVRYHVVRGTLDAAGVKDRRKSRSKYGT 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|16272525|ref|NP_438739.1| 30S ribosomal protein S12 [Haemophilus influenzae Rd KW20]
 gi|68249207|ref|YP_248319.1| 30S ribosomal protein S12 [Haemophilus influenzae 86-028NP]
 gi|126208865|ref|YP_001054090.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae L20]
 gi|145629759|ref|ZP_01785554.1| 30S ribosomal protein S7 [Haemophilus influenzae 22.1-21]
 gi|145631886|ref|ZP_01787643.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
           [Haemophilus influenzae R3021]
 gi|145633462|ref|ZP_01789191.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
           [Haemophilus influenzae 3655]
 gi|145635869|ref|ZP_01791559.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
           [Haemophilus influenzae PittAA]
 gi|145637944|ref|ZP_01793585.1| 30S ribosomal protein S7 [Haemophilus influenzae PittHH]
 gi|145638509|ref|ZP_01794118.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
           [Haemophilus influenzae PittII]
 gi|145640559|ref|ZP_01796143.1| 30S ribosomal protein S7 [Haemophilus influenzae R3021]
 gi|148825139|ref|YP_001289892.1| 30S ribosomal protein S12 [Haemophilus influenzae PittEE]
 gi|148827805|ref|YP_001292558.1| 30S ribosomal protein S12 [Haemophilus influenzae PittGG]
 gi|165976831|ref|YP_001652424.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|190150807|ref|YP_001969332.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|229845661|ref|ZP_04465785.1| 30S ribosomal protein S12 [Haemophilus influenzae 6P18H1]
 gi|229847408|ref|ZP_04467508.1| 30S ribosomal protein S12 [Haemophilus influenzae 7P49H1]
 gi|240950123|ref|ZP_04754416.1| 30S ribosomal protein S12 [Actinobacillus minor NM305]
 gi|251793283|ref|YP_003008011.1| 30S ribosomal protein S12 [Aggregatibacter aphrophilus NJ8700]
 gi|257465600|ref|ZP_05629971.1| 30S ribosomal protein S12 [Actinobacillus minor 202]
 gi|260581442|ref|ZP_05849254.1| ribosomal protein S12 [Haemophilus influenzae RdAW]
 gi|260583256|ref|ZP_05851033.1| ribosomal protein S12 [Haemophilus influenzae NT127]
 gi|261492682|ref|ZP_05989231.1| ribosomal protein S12 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495879|ref|ZP_05992309.1| ribosomal protein S12 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|303250883|ref|ZP_07337076.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303253800|ref|ZP_07339935.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307246980|ref|ZP_07529044.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307248444|ref|ZP_07530464.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307250661|ref|ZP_07532598.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307253053|ref|ZP_07534937.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307255972|ref|ZP_07537768.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307257479|ref|ZP_07539245.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307259752|ref|ZP_07541472.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307262538|ref|ZP_07544180.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307264074|ref|ZP_07545671.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|315634950|ref|ZP_07890232.1| 30S ribosomal protein S12 [Aggregatibacter segnis ATCC 33393]
 gi|319775497|ref|YP_004137985.1| 30S ribosomal subunit protein S12 [Haemophilus influenzae F3047]
 gi|319897902|ref|YP_004136099.1| 30S ribosomal subunit protein s12 [Haemophilus influenzae F3031]
 gi|322515663|ref|ZP_08068638.1| 30S ribosomal protein S12 [Actinobacillus ureae ATCC 25976]
 gi|325576760|ref|ZP_08147375.1| 30S ribosomal protein S12 [Haemophilus parainfluenzae ATCC 33392]
 gi|329122462|ref|ZP_08251048.1| 30S ribosomal protein S12 [Haemophilus aegyptius ATCC 11116]
 gi|52783784|sp|P63195|RS12_PASHA RecName: Full=30S ribosomal protein S12
 gi|52783785|sp|P63196|RS12_HAEIN RecName: Full=30S ribosomal protein S12; AltName: Full=Streptomycin
           resistance protein
 gi|81336389|sp|Q4QMT8|RS12_HAEI8 RecName: Full=30S ribosomal protein S12
 gi|158513511|sp|A3N249|RS12_ACTP2 RecName: Full=30S ribosomal protein S12
 gi|166231862|sp|A5U9Q8|RS12_HAEIE RecName: Full=30S ribosomal protein S12
 gi|166231863|sp|A5UHB9|RS12_HAEIG RecName: Full=30S ribosomal protein S12
 gi|226708449|sp|B3H2G5|RS12_ACTP7 RecName: Full=30S ribosomal protein S12
 gi|226708450|sp|B0BQZ5|RS12_ACTPJ RecName: Full=30S ribosomal protein S12
 gi|6690556|gb|AAF24190.1|AF160257_1 ribosomal protein S12 [Mannheimia haemolytica]
 gi|148985|gb|AAA25003.1| StrA [Haemophilus influenzae]
 gi|1573569|gb|AAC22239.1| ribosomal protein S12 (rps12) [Haemophilus influenzae Rd KW20]
 gi|68057406|gb|AAX87659.1| 30S ribosomal protein S12 [Haemophilus influenzae 86-028NP]
 gi|126097657|gb|ABN74485.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|144977998|gb|EDJ87782.1| 30S ribosomal protein S7 [Haemophilus influenzae 22.1-21]
 gi|144982489|gb|EDJ90052.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
           [Haemophilus influenzae R3021]
 gi|144985831|gb|EDJ92439.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
           [Haemophilus influenzae 3655]
 gi|145266881|gb|EDK06895.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
           [Haemophilus influenzae PittAA]
 gi|145268858|gb|EDK08820.1| 30S ribosomal protein S7 [Haemophilus influenzae PittHH]
 gi|145272104|gb|EDK12012.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
           [Haemophilus influenzae PittII]
 gi|145275145|gb|EDK15007.1| 30S ribosomal protein S7 [Haemophilus influenzae 22.4-21]
 gi|148715299|gb|ABQ97509.1| 30S ribosomal protein S12 [Haemophilus influenzae PittEE]
 gi|148719047|gb|ABR00175.1| 30S ribosomal protein S12 [Haemophilus influenzae PittGG]
 gi|165876932|gb|ABY69980.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|189915938|gb|ACE62190.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|229809646|gb|EEP45372.1| 30S ribosomal protein S12 [Haemophilus influenzae 7P49H1]
 gi|229811399|gb|EEP47104.1| 30S ribosomal protein S12 [Haemophilus influenzae 6P18H1]
 gi|240295392|gb|EER46165.1| 30S ribosomal protein S12 [Actinobacillus minor NM305]
 gi|247534678|gb|ACS97924.1| ribosomal protein S12 [Aggregatibacter aphrophilus NJ8700]
 gi|257451260|gb|EEV25303.1| 30S ribosomal protein S12 [Actinobacillus minor 202]
 gi|260091888|gb|EEW75839.1| ribosomal protein S12 [Haemophilus influenzae RdAW]
 gi|260093709|gb|EEW77620.1| ribosomal protein S12 [Haemophilus influenzae NT127]
 gi|261308471|gb|EEY09744.1| ribosomal protein S12 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261311648|gb|EEY12802.1| ribosomal protein S12 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|301155103|emb|CBW14566.1| 30S ribosomal subunit protein S12 [Haemophilus parainfluenzae T3T1]
 gi|301169297|emb|CBW28895.1| 30S ribosomal subunit protein S12 [Haemophilus influenzae 10810]
 gi|302647384|gb|EFL77605.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302650298|gb|EFL80461.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306852122|gb|EFM84363.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306855012|gb|EFM87195.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306857269|gb|EFM89388.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306859464|gb|EFM91493.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306861062|gb|EFM93060.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306863991|gb|EFM95908.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306866142|gb|EFM98010.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306867773|gb|EFM99607.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306870552|gb|EFN02299.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|309750013|gb|ADO79997.1| 30S ribosomal subunit protein S12 [Haemophilus influenzae R2866]
 gi|309972267|gb|ADO95468.1| 30S ribosomal subunit protein S12 [Haemophilus influenzae R2846]
 gi|315476502|gb|EFU67252.1| 30S ribosomal protein S12 [Aggregatibacter segnis ATCC 33393]
 gi|317433408|emb|CBY81789.1| 30S ribosomal subunit protein S12 [Haemophilus influenzae F3031]
 gi|317450088|emb|CBY86302.1| 30S ribosomal subunit protein S12 [Haemophilus influenzae F3047]
 gi|322118264|gb|EFX90551.1| 30S ribosomal protein S12 [Actinobacillus ureae ATCC 25976]
 gi|325160966|gb|EGC73084.1| 30S ribosomal protein S12 [Haemophilus parainfluenzae ATCC 33392]
 gi|327473216|gb|EGF18637.1| 30S ribosomal protein S12 [Haemophilus aegyptius ATCC 11116]
          Length = 124

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRVKKV-VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|193211846|ref|YP_001997799.1| 30S ribosomal protein S12 [Chlorobaculum parvum NCIB 8327]
 gi|226708476|sp|B3QR56|RS12_CHLP8 RecName: Full=30S ribosomal protein S12
 gi|193085323|gb|ACF10599.1| ribosomal protein S12 [Chlorobaculum parvum NCIB 8327]
          Length = 129

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 99/125 (79%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVT-ALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT+ QLIR  R  S +A    + AL   PQKRGVC RVYT TPKKPNSALRKV + RL+
Sbjct: 1   MPTIQQLIRHGR--SMKASKTASPALEKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLS 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           + +EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD  GV +RKQ+RS+YG
Sbjct: 59  NKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYG 118

Query: 120 AERPK 124
           A++PK
Sbjct: 119 AKQPK 123


>gi|145597444|ref|YP_001161519.1| 30S ribosomal protein S12 [Yersinia pestis Pestoides F]
 gi|158514062|sp|A4TGY4|RS12_YERPP RecName: Full=30S ribosomal protein S12
 gi|145209140|gb|ABP38547.1| SSU ribosomal protein S12P [Yersinia pestis Pestoides F]
          Length = 124

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRSMKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ+RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGV 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKQK 123


>gi|309322068|ref|YP_003933867.1| ribosomal protein S12 [Erodium texanum]
 gi|197131608|gb|ACH47322.1| ribosomal protein S12 [Erodium texanum]
 gi|300069161|gb|ADJ66283.1| ribosomal protein S12 [Erodium texanum]
          Length = 123

 Score =  164 bits (414), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 95/124 (76%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT  QLIR  R+   R   K  ALRG PQ+RG C R YT+ PKKPNSALRKV + RLTS
Sbjct: 1   MPTTQQLIRNARQ-PVRNATKAPALRGCPQRRGTCTRTYTINPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ A++PG  HNLQEHSVV++ GGRVKDLPGVKYR++RG LDA GVK R+Q RS+YG 
Sbjct: 60  GFEITAFIPGIDHNLQEHSVVLVRGGRVKDLPGVKYRIVRGTLDAVGVKGRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|24371824|ref|NP_715866.1| 30S ribosomal protein S12 [Shewanella oneidensis MR-1]
 gi|113968539|ref|YP_732332.1| 30S ribosomal protein S12 [Shewanella sp. MR-4]
 gi|114045702|ref|YP_736252.1| 30S ribosomal protein S12 [Shewanella sp. MR-7]
 gi|27151673|sp|P59166|RS12_SHEON RecName: Full=30S ribosomal protein S12
 gi|119366807|sp|Q0HNU2|RS12_SHESM RecName: Full=30S ribosomal protein S12
 gi|119366808|sp|Q0I0B0|RS12_SHESR RecName: Full=30S ribosomal protein S12
 gi|24345633|gb|AAN53311.1|AE015472_3 ribosomal protein S12 [Shewanella oneidensis MR-1]
 gi|113883223|gb|ABI37275.1| SSU ribosomal protein S12P [Shewanella sp. MR-4]
 gi|113887144|gb|ABI41195.1| SSU ribosomal protein S12P [Shewanella sp. MR-7]
          Length = 124

 Score =  164 bits (414), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR         V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRAPKVDK-TNVPALNACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GV +R+Q+RS+YGA
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCAGVTSRRQSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|78186065|ref|YP_374108.1| 30S ribosomal protein S12 [Chlorobium luteolum DSM 273]
 gi|115305665|sp|Q3B6G6|RS12_PELLD RecName: Full=30S ribosomal protein S12
 gi|78165967|gb|ABB23065.1| SSU ribosomal protein S12P [Chlorobium luteolum DSM 273]
          Length = 129

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R       A   AL   PQKRGVC RVYT TPKKPNSALRKV + RL++
Sbjct: 1   MPTIQQLIRHGRSVKVSKTAS-PALEKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD  GV +RKQ+RS+YGA
Sbjct: 60  KIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGTLDTSGVSDRKQSRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KQPK 123


>gi|34541545|ref|NP_906024.1| 30S ribosomal protein S12 [Porphyromonas gingivalis W83]
 gi|52783382|sp|Q7MTK9|RS12_PORGI RecName: Full=30S ribosomal protein S12
 gi|34397862|gb|AAQ66923.1| ribosomal protein S12 [Porphyromonas gingivalis W83]
          Length = 134

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+RK R+ SF   +K  AL   PQ+RGVC+RVYT TPKKPNSA+RKV + RLT+
Sbjct: 1   MPTIQQLVRKGRE-SFADKSKSPALNSCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD  GV  R Q RS+YGA
Sbjct: 60  SKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVNGRTQRRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|21230359|ref|NP_636276.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769647|ref|YP_244409.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|325916482|ref|ZP_08178751.1| SSU ribosomal protein S12P [Xanthomonas vesicatoria ATCC 35937]
 gi|23822079|sp|Q8PC54|RS12_XANCP RecName: Full=30S ribosomal protein S12
 gi|81304398|sp|Q4URD4|RS12_XANC8 RecName: Full=30S ribosomal protein S12
 gi|21111914|gb|AAM40200.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66574979|gb|AAY50389.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|325537271|gb|EGD08998.1| SSU ribosomal protein S12P [Xanthomonas vesicatoria ATCC 35937]
          Length = 124

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+ +    A   AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MATINQLVRKPRQATTYKSAS-PALDKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LDA GV  R+Q RS+YGA
Sbjct: 60  QEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|21241732|ref|NP_641314.1| 30S ribosomal protein S12 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|78046549|ref|YP_362724.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|84625049|ref|YP_452421.1| 30S ribosomal protein S12 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|122879275|ref|YP_202228.6| 30S ribosomal protein S12 [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|166710822|ref|ZP_02242029.1| 30S ribosomal protein S12 [Xanthomonas oryzae pv. oryzicola BLS256]
 gi|188575483|ref|YP_001912412.1| 30S ribosomal protein S12 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|294627837|ref|ZP_06706416.1| 30S ribosomal protein S12 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294664235|ref|ZP_06729610.1| 30S ribosomal protein S12 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325926962|ref|ZP_08188240.1| SSU ribosomal protein S12P [Xanthomonas perforans 91-118]
 gi|23822081|sp|Q8PNS8|RS12_XANAC RecName: Full=30S ribosomal protein S12
 gi|90111828|sp|Q3BWY9|RS12_XANC5 RecName: Full=30S ribosomal protein S12
 gi|90111829|sp|Q5GWS8|RS12_XANOR RecName: Full=30S ribosomal protein S12
 gi|118597405|sp|Q2NZY0|RS12_XANOM RecName: Full=30S ribosomal protein S12
 gi|226712672|sp|B2SQQ3|RS12_XANOP RecName: Full=30S ribosomal protein S12
 gi|21107102|gb|AAM35850.1| 30S ribosomal protein S12 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|78034979|emb|CAJ22624.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|84368989|dbj|BAE70147.1| 30S ribosomal protein S12 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188519935|gb|ACD57880.1| ribosomal protein S12 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|292597751|gb|EFF41909.1| 30S ribosomal protein S12 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292605994|gb|EFF49270.1| 30S ribosomal protein S12 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325542674|gb|EGD14138.1| SSU ribosomal protein S12P [Xanthomonas perforans 91-118]
          Length = 124

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+ +    A   AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MTTINQLVRKPRQATTYKSAS-PALDKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LDA GV  R+Q RS+YGA
Sbjct: 60  QEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|290968250|ref|ZP_06559793.1| ribosomal protein S12 [Megasphaera genomosp. type_1 str. 28L]
 gi|290781732|gb|EFD94317.1| ribosomal protein S12 [Megasphaera genomosp. type_1 str. 28L]
          Length = 123

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 78/124 (62%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+RK R+ S  + +   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLVRKGRQDSI-SKSTAPALKNCPQKRGVCTRVYTATPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV +R+Q+RS+YGA
Sbjct: 60  AIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVSDRQQSRSKYGA 119

Query: 121 ERPK 124
           ++ K
Sbjct: 120 KKAK 123


>gi|237737534|ref|ZP_04568015.1| SSU ribosomal protein S12P [Fusobacterium mortiferum ATCC 9817]
 gi|229419414|gb|EEO34461.1| SSU ribosomal protein S12P [Fusobacterium mortiferum ATCC 9817]
          Length = 122

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 99/122 (81%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL++  R  +     K  AL+GNPQ+RGVC+RVYT TPKKPNSALRKV + +LT+
Sbjct: 1   MPTLSQLVKNGRD-TLSEKKKSPALQGNPQRRGVCVRVYTTTPKKPNSALRKVARVKLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PGEGHNLQEHS+V++ GGR KDLPGV+Y+VIRG LD  GV  RKQ+RS+YGA
Sbjct: 60  GIEVTCYIPGEGHNLQEHSIVLVRGGRTKDLPGVRYKVIRGALDTAGVAKRKQSRSKYGA 119

Query: 121 ER 122
           ++
Sbjct: 120 KK 121


>gi|313884475|ref|ZP_07818236.1| ribosomal protein S12 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620259|gb|EFR31687.1| ribosomal protein S12 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 137

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 83/139 (59%), Positives = 105/139 (75%), Gaps = 18/139 (12%)

Query: 1   MPTVNQLIRKPRKG---------------SFRACAKVTALRGNPQKRGVCLRVYTVTPKK 45
           MPT+NQLIRKPRK                SF+  +++T +  +PQKRGVC RV T+TPKK
Sbjct: 1   MPTINQLIRKPRKSKTSKSNSPALNVGYNSFKR-SQITTM--SPQKRGVCTRVGTMTPKK 57

Query: 46  PNSALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDA 105
           PNSALRK  + RL++ +EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD 
Sbjct: 58  PNSALRKYARVRLSNLMEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT 117

Query: 106 QGVKNRKQARSRYGAERPK 124
            GV +RKQ+RS+YGA+RPK
Sbjct: 118 SGVNDRKQSRSKYGAKRPK 136


>gi|323703907|ref|ZP_08115539.1| ribosomal protein S12 [Desulfotomaculum nigrificans DSM 574]
 gi|323531123|gb|EGB21030.1| ribosomal protein S12 [Desulfotomaculum nigrificans DSM 574]
          Length = 124

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 81/125 (64%), Positives = 102/125 (81%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRKGS-FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT+NQLIRK R+   +++ A   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT
Sbjct: 1   MPTINQLIRKGREEVVYKSTA--PALKECPQKRGVCTRVYTTTPKKPNSALRKVARVRLT 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GV+NR + RS+YG
Sbjct: 59  NGIEVTSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDSAGVQNRNRGRSKYG 118

Query: 120 AERPK 124
            +RPK
Sbjct: 119 TKRPK 123


>gi|90417540|ref|ZP_01225461.1| ribosomal protein S12 [marine gamma proteobacterium HTCC2207]
 gi|90330632|gb|EAS45922.1| ribosomal protein S12 [marine gamma proteobacterium HTCC2207]
          Length = 124

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPRK    + + V AL+  PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MATINQLVRKPRKRKV-SKSDVPALQACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV  R Q RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTAGVNGRSQRRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|34762378|ref|ZP_00143380.1| SSU ribosomal protein S12P [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
 gi|27887960|gb|EAA25026.1| SSU ribosomal protein S12P [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
          Length = 122

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 99/121 (81%), Gaps = 1/121 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL++K R+ +     K  AL+GNPQ+RGVC+RVYT TPKKPNSALRKV + +LT+
Sbjct: 1   MPTLSQLVKKGRQ-TLIEKKKSPALQGNPQRRGVCIRVYTTTPKKPNSALRKVARVKLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV  Y+PGEGHNLQEHS+V++ GGR KDLPGV+Y++IRG LD  GV  RKQ RS+YGA
Sbjct: 60  GIEVTCYIPGEGHNLQEHSIVLVRGGRTKDLPGVRYKIIRGALDTAGVAKRKQGRSKYGA 119

Query: 121 E 121
           +
Sbjct: 120 K 120


>gi|197131612|gb|ACH47324.1| ribosomal protein S12 [Geranium macrorrhizum]
          Length = 123

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT  QLIR  R+   R   K  ALRG PQ+RG C R YT+ PKKPNSALRKV + RLTS
Sbjct: 1   MPTTQQLIRNTRQ-PIRNATKSPALRGCPQRRGRCTRTYTINPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GVE+ A++PG  HNLQEHSVV++ GGRVKDLPGVKYR++RG LDA GVK R+Q RS+YG 
Sbjct: 60  GVEITAFIPGIDHNLQEHSVVLVRGGRVKDLPGVKYRIVRGTLDAVGVKGRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|240146973|ref|ZP_04745574.1| ribosomal protein S12 [Roseburia intestinalis L1-82]
 gi|257200887|gb|EEU99171.1| ribosomal protein S12 [Roseburia intestinalis L1-82]
 gi|291535406|emb|CBL08518.1| SSU ribosomal protein S12P [Roseburia intestinalis M50/1]
 gi|291537951|emb|CBL11062.1| SSU ribosomal protein S12P [Roseburia intestinalis XB6B4]
          Length = 139

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 80/136 (58%), Positives = 98/136 (72%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRG------------NPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+ S +        +G            +PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRQTSVKKSTAPALQKGYNSLQKRPTNTSSPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y +IRG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NRKQARS+YGA+RPK
Sbjct: 121 ANRKQARSKYGAKRPK 136


>gi|134298088|ref|YP_001111584.1| 30S ribosomal protein S12 [Desulfotomaculum reducens MI-1]
 gi|172044215|sp|A4J106|RS12_DESRM RecName: Full=30S ribosomal protein S12
 gi|134050788|gb|ABO48759.1| SSU ribosomal protein S12P [Desulfotomaculum reducens MI-1]
          Length = 124

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 81/125 (64%), Positives = 102/125 (81%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRKGS-FRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT+NQLIRK R+   +++ A   AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT
Sbjct: 1   MPTINQLIRKGREQVVYKSTA--PALKECPQKRGVCTRVYTTTPKKPNSALRKVARVRLT 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           +G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GV+NR + RS+YG
Sbjct: 59  NGIEVTSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDSAGVQNRNRGRSKYG 118

Query: 120 AERPK 124
            +RPK
Sbjct: 119 TKRPK 123


>gi|148655342|ref|YP_001275547.1| 30S ribosomal protein S12 [Roseiflexus sp. RS-1]
 gi|156743953|ref|YP_001434082.1| 30S ribosomal protein S12 [Roseiflexus castenholzii DSM 13941]
 gi|166231885|sp|A5USJ4|RS12_ROSS1 RecName: Full=30S ribosomal protein S12
 gi|189040475|sp|A7NR68|RS12_ROSCS RecName: Full=30S ribosomal protein S12
 gi|148567452|gb|ABQ89597.1| SSU ribosomal protein S12P [Roseiflexus sp. RS-1]
 gi|156235281|gb|ABU60064.1| ribosomal protein S12 [Roseiflexus castenholzii DSM 13941]
          Length = 144

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 102/135 (75%), Gaps = 13/135 (9%)

Query: 1   MPTVNQLIRKPRKGSFRAC-------------AKVTALRGNPQKRGVCLRVYTVTPKKPN 47
           MPT+NQL+RKPRK   +                K+T  +G+P KRGVC +V T+TPKKPN
Sbjct: 1   MPTINQLVRKPRKRVTKKVKAPALRFSLNVLKGKLTRGKGSPFKRGVCTQVRTMTPKKPN 60

Query: 48  SALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQG 107
           SALRK+ + RL++G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDAQG
Sbjct: 61  SALRKIARVRLSNGMEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDAQG 120

Query: 108 VKNRKQARSRYGAER 122
           V NRKQ RS+YG ++
Sbjct: 121 VANRKQGRSKYGTKK 135


>gi|148653660|ref|YP_001280753.1| 30S ribosomal protein S12 [Psychrobacter sp. PRwf-1]
 gi|172048557|sp|A5WGL2|RS12_PSYWF RecName: Full=30S ribosomal protein S12
 gi|148572744|gb|ABQ94803.1| SSU ribosomal protein S12P [Psychrobacter sp. PRwf-1]
          Length = 124

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T NQLIRK RK   +  + V AL+  PQ+RGVC RVYT TPKKPNSA+RKV + RLTS
Sbjct: 1   MATTNQLIRKGRK-VLKEKSGVPALQACPQRRGVCTRVYTTTPKKPNSAMRKVCRVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YGA
Sbjct: 60  GYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|110227103|ref|YP_665582.1| ribosomal protein S12 [Populus alba]
 gi|110227125|ref|YP_665538.1| ribosomal protein S12 [Populus alba]
 gi|122247654|sp|Q14FB1|RR12_POPAL RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|109945541|dbj|BAE97229.1| ribosomal protein S12 [Populus alba]
 gi|109945563|dbj|BAE97251.1| ribosomal protein S12 [Populus alba]
 gi|290487436|gb|ADD30102.1| ribosomal protein S12 [Ilex cornuta]
 gi|290487466|gb|ADD30117.1| ribosomal protein S12 [Liquidambar styraciflua]
          Length = 123

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  AL G PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVTKSPALGGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|328949281|ref|YP_004366618.1| ribosomal protein S12 [Treponema succinifaciens DSM 2489]
 gi|328449605|gb|AEB15321.1| ribosomal protein S12 [Treponema succinifaciens DSM 2489]
          Length = 124

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK R+ S +   K  AL+  PQKRGVC RV T+TPKKPNSALRK+ + RL++
Sbjct: 1   MPTINQLIRKGRQSSAKR-TKAPALQSCPQKRGVCTRVMTMTPKKPNSALRKIARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG  D  GV  RK+ARS+YGA
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGTKDTLGVDGRKRARSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|86158373|ref|YP_465158.1| 30S ribosomal protein S12 [Anaeromyxobacter dehalogenans 2CP-C]
 gi|197122335|ref|YP_002134286.1| 30S ribosomal protein S12 [Anaeromyxobacter sp. K]
 gi|220917117|ref|YP_002492421.1| ribosomal protein S12 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|110825780|sp|Q2IJ91|RS12_ANADE RecName: Full=30S ribosomal protein S12
 gi|226708455|sp|B4UB95|RS12_ANASK RecName: Full=30S ribosomal protein S12
 gi|254811061|sp|B8J856|RS12_ANAD2 RecName: Full=30S ribosomal protein S12
 gi|85774884|gb|ABC81721.1| SSU ribosomal protein S12P [Anaeromyxobacter dehalogenans 2CP-C]
 gi|196172184|gb|ACG73157.1| ribosomal protein S12 [Anaeromyxobacter sp. K]
 gi|219954971|gb|ACL65355.1| ribosomal protein S12 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 123

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 80/122 (65%), Positives = 99/122 (81%), Gaps = 1/122 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+R+ R+   +   K  AL+ +PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTISQLVRRGRE-RLQVKKKAPALKESPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LDA GV+ RKQ RS+YGA
Sbjct: 60  GFEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAVGVQGRKQGRSKYGA 119

Query: 121 ER 122
           +R
Sbjct: 120 KR 121


>gi|58427806|gb|AAW76843.1| 30S ribosomal protein S12 [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 163

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+ +    A   AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 40  MTTINQLVRKPRQATTYKSAS-PALDKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 98

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LDA GV  R+Q RS+YGA
Sbjct: 99  QEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGA 158

Query: 121 ERPK 124
           +RPK
Sbjct: 159 KRPK 162


>gi|91208947|ref|YP_538960.1| ribosomal protein S12 [Gossypium hirsutum]
 gi|91208960|ref|YP_538959.1| ribosomal protein S12 [Gossypium hirsutum]
 gi|325210955|ref|YP_004286028.1| ribosomal protein S12 [Gossypium thurberi]
 gi|122248428|sp|Q2L8Y5|RR12_GOSHI RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|85687461|gb|ABC73673.1| ribosomal protein S12 [Gossypium hirsutum]
 gi|85687474|gb|ABC73686.1| ribosomal protein S12 [Gossypium hirsutum]
 gi|290775817|gb|ADD62313.1| ribosomal protein S12 [Gossypium thurberi]
          Length = 123

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  AL G PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNARQ-PIRNVTKSPALGGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|469218|dbj|BAA03487.1| altered ribosomal protein S12 [Cloning vector pKF2]
 gi|469221|dbj|BAA03489.1| altered ribosomal protein S12 [Cloning vector pKF3]
 gi|1199493|dbj|BAA08267.1| altered ribosomal protein S12 [Cloning vector pKF4]
 gi|1707359|dbj|BAA01520.1| altered ribosomal protein S12 [unidentified cloning vector]
 gi|1711293|dbj|BAA01521.1| altered ribosomal protein S12 [unidentified cloning vector]
          Length = 124

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR     A + V AL   PQKRG+C RVYT TPKKPNSALRK+ + RLT+
Sbjct: 1   MATVNQLVRKPRARKV-AKSNVPALEACPQKRGICTRVYTTTPKKPNSALRKLCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPG++Y  +RG LD  GVK+R+Q RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGIRYHTVRGALDCSGVKDRRQDRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|331268137|ref|YP_004347786.1| ribosomal protein S12 [Chlorella variabilis]
 gi|325296314|gb|ADZ05034.1| ribosomal protein S12 [Chlorella variabilis]
          Length = 123

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 95/124 (76%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QL+R  R        K  AL   PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLVRSART-RLSKKTKSPALNSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+ GVK+R Q+RS+YG 
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDSAGVKDRSQSRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|188992859|ref|YP_001904869.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167734619|emb|CAP52829.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. campestris]
          Length = 164

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+ +    A   AL   PQ+RGVC RVYT TP+KPNSALRKV K RLT+
Sbjct: 41  MATINQLVRKPRQATTYKSAS-PALDKCPQRRGVCTRVYTTTPRKPNSALRKVAKVRLTN 99

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EVI+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LDA GV  R+Q RS+YGA
Sbjct: 100 QEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGA 159

Query: 121 ERPK 124
           +RPK
Sbjct: 160 KRPK 163


>gi|220930960|ref|YP_002507868.1| ribosomal protein S12 [Halothermothrix orenii H 168]
 gi|254811090|sp|B8D0B9|RS12_HALOH RecName: Full=30S ribosomal protein S12
 gi|219992270|gb|ACL68873.1| ribosomal protein S12 [Halothermothrix orenii H 168]
          Length = 123

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLIRK  +   +      AL+G+PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLIRK-GRKKVKKKKTAPALQGSPQKRGVCTRVYTATPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GV+ RKQ RS+YG 
Sbjct: 60  GIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDAAGVEGRKQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|33866667|ref|NP_898226.1| 30S ribosomal protein S12 [Synechococcus sp. WH 8102]
 gi|52783389|sp|Q7U4D4|RS12_SYNPX RecName: Full=30S ribosomal protein S12
 gi|33633445|emb|CAE08650.1| 30S ribosomal protein S12 [Synechococcus sp. WH 8102]
          Length = 124

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R    +A  K  AL+  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRTER-SRLKAKTKSPALKSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+ G GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIGGVGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KTPK 123


>gi|197131610|gb|ACH47323.1| ribosomal protein S12 [Geranium carolinianum]
          Length = 123

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT  QLIR  R+   R   K  ALRG PQ+RG C R YT+ PKKPNSALRKV + RLTS
Sbjct: 1   MPTTRQLIRNTRQ-PIRNATKTPALRGCPQRRGTCTRTYTINPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           GV++ A++PG  HNLQEHSVV++ GGRVKDLPGVKYR++RG LDA GVK R+Q RS+YG 
Sbjct: 60  GVKITAFIPGIDHNLQEHSVVLVRGGRVKDLPGVKYRIVRGTLDAVGVKGRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|114561331|ref|YP_748844.1| 30S ribosomal protein S12 [Shewanella frigidimarina NCIMB 400]
 gi|119366806|sp|Q089Q9|RS12_SHEFN RecName: Full=30S ribosomal protein S12
 gi|114332624|gb|ABI70006.1| SSU ribosomal protein S12P [Shewanella frigidimarina NCIMB 400]
          Length = 124

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 95/124 (76%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M TVNQL+RKPR         V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATVNQLVRKPRTPKVEK-TNVPALNACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GV +R+Q RS+YGA
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCAGVTSRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|77165792|ref|YP_344317.1| 30S ribosomal protein S12 [Nitrosococcus oceani ATCC 19707]
 gi|300114741|ref|YP_003761316.1| 30S ribosomal protein S12 [Nitrosococcus watsonii C-113]
 gi|300114753|ref|YP_003761328.1| 30S ribosomal protein S12 [Nitrosococcus watsonii C-113]
 gi|90111787|sp|Q3J8Q9|RS12_NITOC RecName: Full=30S ribosomal protein S12
 gi|76884106|gb|ABA58787.1| SSU ribosomal protein S12P [Nitrosococcus oceani ATCC 19707]
 gi|299540678|gb|ADJ28995.1| ribosomal protein S12 [Nitrosococcus watsonii C-113]
 gi|299540690|gb|ADJ29007.1| ribosomal protein S12 [Nitrosococcus watsonii C-113]
          Length = 124

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR    +  + V AL+  PQKRGVC RVYT TPKKPNSA+RKV + RLT+
Sbjct: 1   MATINQLVRKPRV-RQKQKSNVPALQACPQKRGVCTRVYTTTPKKPNSAMRKVARIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV +R+Q RS+YGA
Sbjct: 60  GMEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDTAGVGDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|326792612|ref|YP_004310433.1| ribosomal protein S12 [Clostridium lentocellum DSM 5427]
 gi|326543376|gb|ADZ85235.1| ribosomal protein S12 [Clostridium lentocellum DSM 5427]
          Length = 139

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 97/136 (71%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKG------------SFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK RK              F +  K      +PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRKEIEKKSTAPALQKGFNSLRKRPTDISSPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RLT+G+EV AY+PGEGHNLQEHSVV++ GGRVKDLPG +Y ++RG LD  GV
Sbjct: 61  ALRKIARVRLTNGIEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIVRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NRKQARS+YGA+RPK
Sbjct: 121 ANRKQARSKYGAKRPK 136


>gi|119358196|ref|YP_912840.1| 30S ribosomal protein S12 [Chlorobium phaeobacteroides DSM 266]
 gi|158512607|sp|A1BJ39|RS12_CHLPD RecName: Full=30S ribosomal protein S12
 gi|119355545|gb|ABL66416.1| SSU ribosomal protein S12P [Chlorobium phaeobacteroides DSM 266]
          Length = 135

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 99/125 (79%), Gaps = 3/125 (2%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVT-ALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT 59
           MPT+ QLIR  R  S +A    + AL   PQKRGVC RVYT TPKKPNSALRKV + RL+
Sbjct: 1   MPTIQQLIRSGR--SIKASKTASPALEKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLS 58

Query: 60  SGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
           + +EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD  GV +RKQ+RS+YG
Sbjct: 59  NKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYG 118

Query: 120 AERPK 124
           A++PK
Sbjct: 119 AKQPK 123


>gi|325921476|ref|ZP_08183331.1| SSU ribosomal protein S12P [Xanthomonas gardneri ATCC 19865]
 gi|325548023|gb|EGD19022.1| SSU ribosomal protein S12P [Xanthomonas gardneri ATCC 19865]
          Length = 124

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR+ +    A   AL   PQ+RGVC RVYT TPKKPNSALRKV K RLT+
Sbjct: 1   MTTINQLVRKPRQATTYKSAS-PALDKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             E+I+Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LDA GV  R+Q RS+YGA
Sbjct: 60  QEEIISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|159899793|ref|YP_001546040.1| 30S ribosomal protein S12 [Herpetosiphon aurantiacus ATCC 23779]
 gi|159892832|gb|ABX05912.1| ribosomal protein S12 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 146

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 100/135 (74%), Gaps = 13/135 (9%)

Query: 1   MPTVNQLIRKPRKGSFRAC-------------AKVTALRGNPQKRGVCLRVYTVTPKKPN 47
           MPT+NQLIRKPRK   +                K+T   G PQKRGVC +V T+TPKKPN
Sbjct: 1   MPTINQLIRKPRKPVVKKTKAPALRFIYNSLKGKLTRGNGAPQKRGVCTQVKTMTPKKPN 60

Query: 48  SALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQG 107
           SALRKV + RL++ +EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD+QG
Sbjct: 61  SALRKVARVRLSNQMEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSQG 120

Query: 108 VKNRKQARSRYGAER 122
           V NRKQ RS+YG ++
Sbjct: 121 VNNRKQGRSKYGTKK 135


>gi|122239805|sp|Q5SD27|RR12_HUPLU RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|113306474|gb|AAT80701.2| ribosomal protein S12 [Huperzia lucidula]
          Length = 123

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+       K  AL+G PQ+RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRNQRQ-PVENRTKSPALQGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVKNR+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKNRQQGRSKYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|330431886|gb|AEC16945.1| 30S ribosomal protein S12 [Gallibacterium anatis UMN179]
          Length = 124

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRVKKV-VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YG 
Sbjct: 60  GYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|320537019|ref|ZP_08036998.1| ribosomal protein S12 [Treponema phagedenis F0421]
 gi|320146094|gb|EFW37731.1| ribosomal protein S12 [Treponema phagedenis F0421]
          Length = 135

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQLI+K RK +  +  K  AL+  PQKRGVC RV T TPKKPNSALRKV + RL++
Sbjct: 12  MPTINQLIKKGRKAAV-SRTKSPALQACPQKRGVCTRVMTFTPKKPNSALRKVARVRLSN 70

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG  DA GV +RK+ RS+YGA
Sbjct: 71  GIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTKDALGVADRKRGRSKYGA 130

Query: 121 ERPK 124
           ++PK
Sbjct: 131 KKPK 134


>gi|291518236|emb|CBK73457.1| SSU ribosomal protein S12P [Butyrivibrio fibrisolvens 16/4]
          Length = 139

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 97/136 (71%), Gaps = 12/136 (8%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRG------------NPQKRGVCLRVYTVTPKKPNS 48
           MPT NQL+RK R+ S +        RG            +PQKRGVC  V T TPKKPNS
Sbjct: 1   MPTFNQLVRKGRQTSVKKSTAPALQRGYNSLQKKPTNTSSPQKRGVCTAVKTATPKKPNS 60

Query: 49  ALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGV 108
           ALRK+ + RL++G+EV +Y+PGEGHNLQEHSVV++ GGRVKDLPG +Y VIRG LD  GV
Sbjct: 61  ALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHVIRGTLDTAGV 120

Query: 109 KNRKQARSRYGAERPK 124
            NRKQ RS+YGA+RPK
Sbjct: 121 ANRKQGRSKYGAKRPK 136


>gi|15603219|ref|NP_246293.1| 30S ribosomal protein S12 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|260913292|ref|ZP_05919773.1| 30S ribosomal protein S12 [Pasteurella dagmatis ATCC 43325]
 gi|14423912|sp|Q9CL86|RS12_PASMU RecName: Full=30S ribosomal protein S12
 gi|71153724|sp|Q5F1R7|RS12_HAEPR RecName: Full=30S ribosomal protein S12
 gi|12721724|gb|AAK03438.1| RpS12 [Pasteurella multocida subsp. multocida str. Pm70]
 gi|37929046|gb|AAP70010.1| ribosomal protein S12 [Haemophilus parasuis]
 gi|260632523|gb|EEX50693.1| 30S ribosomal protein S12 [Pasteurella dagmatis ATCC 43325]
          Length = 124

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRVKKV-VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK+RKQ RS+YG 
Sbjct: 60  GYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|332178450|gb|AEE14139.1| ribosomal protein S12 [Thermodesulfobium narugense DSM 14796]
          Length = 124

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+R  R+   +  +K  AL+  PQ+RGVC RVYT TPKKPNSALRKV + +LT+
Sbjct: 1   MPTINQLVRYEREKLVKK-SKSPALQSCPQRRGVCTRVYTTTPKKPNSALRKVARVKLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GV+NR Q RS+YG+
Sbjct: 60  GYEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDAAGVQNRAQGRSKYGS 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|292492416|ref|YP_003527855.1| ribosomal protein S12 [Nitrosococcus halophilus Nc4]
 gi|291581011|gb|ADE15468.1| ribosomal protein S12 [Nitrosococcus halophilus Nc4]
          Length = 124

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR    R  + V AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRV-RQRKKSNVPALQACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV +R+Q RS+YGA
Sbjct: 60  SMEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDTAGVGDRRQGRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|255659498|ref|ZP_05404907.1| ribosomal protein S12 [Mitsuokella multacida DSM 20544]
 gi|260848050|gb|EEX68057.1| ribosomal protein S12 [Mitsuokella multacida DSM 20544]
          Length = 127

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 96/119 (80%), Gaps = 1/119 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK RK S +  +K  AL+  PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKSRK-SMQEKSKAPALKNCPQKRGVCTRVYTSTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYG 119
            +EV AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GV++R Q RS+YG
Sbjct: 60  SIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGSLDTAGVQDRGQGRSKYG 118


>gi|147674738|ref|YP_001218629.1| 30S ribosomal protein S12 [Vibrio cholerae O395]
 gi|172047711|sp|A5F3L3|RS12_VIBC3 RecName: Full=30S ribosomal protein S12
 gi|146316621|gb|ABQ21160.1| ribosomal protein S12 [Vibrio cholerae O395]
          Length = 124

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 96/124 (77%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TP+KPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRAKQV-VKSNVPALAACPQKRGVCTRVYTTTPRKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RKQARS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVNDRKQARSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|295137049|ref|YP_003587521.1| ribosomal protein S12 [Pisum sativum]
 gi|293338621|gb|ADE43594.1| ribosomal protein S12 [Pisum sativum]
          Length = 123

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT  QLIR  R+   R   K  ALRG PQ+RG C RVYT+ PKKPNSALRKV + RLTS
Sbjct: 1   MPTRKQLIRNTRQ-PIRTVTKSPALRGCPQRRGTCTRVYTINPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y +++G LDA  VK+R+Q RS+YGA
Sbjct: 60  GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVQGTLDAIAVKDRQQGRSKYGA 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|78211875|ref|YP_380654.1| 30S ribosomal protein S12 [Synechococcus sp. CC9605]
 gi|260435296|ref|ZP_05789266.1| ribosomal protein S12 [Synechococcus sp. WH 8109]
 gi|118597402|sp|Q3AMT3|RS12_SYNSC RecName: Full=30S ribosomal protein S12
 gi|78196334|gb|ABB34099.1| ribosomal protein S12 [Synechococcus sp. CC9605]
 gi|260413170|gb|EEX06466.1| ribosomal protein S12 [Synechococcus sp. WH 8109]
          Length = 124

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R    +A  K  AL+  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIQQLIRTER-SRLKAKTKSPALKSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+ G GHNLQEHSVV++ GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIGGVGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KAPK 123


>gi|1173186|sp|P45809|RS12_ERWAM RecName: Full=30S ribosomal protein S12
 gi|548114|gb|AAA24867.1| ribosomal protein S12 [Erwinia amylovora]
          Length = 124

 Score =  163 bits (412), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 84/126 (66%), Positives = 97/126 (76%), Gaps = 5/126 (3%)

Query: 1   MPTVNQLIRKPRKGSFRACAK--VTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL 58
           M TVNQL+RKPR    R  AK  V AL   PQKRGVC RVYT TPKKPNSALRKV + RL
Sbjct: 1   MATVNQLVRKPR---VRKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRL 57

Query: 59  TSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRY 118
           T+G EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+Y
Sbjct: 58  TNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKY 117

Query: 119 GAERPK 124
           G +  K
Sbjct: 118 GVKNAK 123


>gi|28899547|ref|NP_799152.1| 30S ribosomal protein S12 [Vibrio parahaemolyticus RIMD 2210633]
 gi|89075242|ref|ZP_01161673.1| 30S ribosomal protein S12 [Photobacterium sp. SKA34]
 gi|90580823|ref|ZP_01236625.1| 30S ribosomal protein S12 [Vibrio angustum S14]
 gi|156972437|ref|YP_001443344.1| 30S ribosomal protein S12 [Vibrio harveyi ATCC BAA-1116]
 gi|163802784|ref|ZP_02196674.1| 30S ribosomal protein S12 [Vibrio sp. AND4]
 gi|260774648|ref|ZP_05883555.1| SSU ribosomal protein S12p (S23e) [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260876707|ref|ZP_05889062.1| ribosomal protein S12 [Vibrio parahaemolyticus AN-5034]
 gi|261254045|ref|ZP_05946618.1| SSU ribosomal protein S12p (S23e) [Vibrio orientalis CIP 102891]
 gi|262393070|ref|YP_003284924.1| 30S ribosomal protein S12p (S23e) [Vibrio sp. Ex25]
 gi|269104007|ref|ZP_06156704.1| SSU ribosomal protein S12p (S23e) [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|269961439|ref|ZP_06175803.1| 30S ribosomal protein S12 [Vibrio harveyi 1DA3]
 gi|269964474|ref|ZP_06178715.1| 30S ribosomal protein S12 [Vibrio alginolyticus 40B]
 gi|312882804|ref|ZP_07742537.1| 30S ribosomal protein S12 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323491094|ref|ZP_08096285.1| 30S ribosomal protein S12 [Vibrio brasiliensis LMG 20546]
 gi|323496884|ref|ZP_08101916.1| 30S ribosomal protein S12 [Vibrio sinaloensis DSM 21326]
 gi|330447042|ref|ZP_08310692.1| ribosomal protein S12 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|31340395|sp|Q87L43|RS12_VIBPA RecName: Full=30S ribosomal protein S12
 gi|166231895|sp|A7MZ64|RS12_VIBHB RecName: Full=30S ribosomal protein S12
 gi|28807783|dbj|BAC61036.1| ribosomal protein S12 [Vibrio parahaemolyticus RIMD 2210633]
 gi|89049064|gb|EAR54631.1| 30S ribosomal protein S12 [Photobacterium sp. SKA34]
 gi|90437894|gb|EAS63083.1| 30S ribosomal protein S12 [Vibrio angustum S14]
 gi|156524031|gb|ABU69117.1| hypothetical protein VIBHAR_00057 [Vibrio harveyi ATCC BAA-1116]
 gi|159173491|gb|EDP58313.1| 30S ribosomal protein S12 [Vibrio sp. AND4]
 gi|260609438|gb|EEX35583.1| SSU ribosomal protein S12p (S23e) [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260937436|gb|EEX93425.1| SSU ribosomal protein S12p (S23e) [Vibrio orientalis CIP 102891]
 gi|262336664|gb|ACY50459.1| SSU ribosomal protein S12p (S23e) [Vibrio sp. Ex25]
 gi|268163905|gb|EEZ42401.1| SSU ribosomal protein S12p (S23e) [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|269830812|gb|EEZ85030.1| 30S ribosomal protein S12 [Vibrio alginolyticus 40B]
 gi|269833816|gb|EEZ87911.1| 30S ribosomal protein S12 [Vibrio harveyi 1DA3]
 gi|308093984|gb|EFO43679.1| ribosomal protein S12 [Vibrio parahaemolyticus AN-5034]
 gi|309369496|gb|EFP97015.1| 30S ribosomal protein S12 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323314674|gb|EGA67747.1| 30S ribosomal protein S12 [Vibrio brasiliensis LMG 20546]
 gi|323318070|gb|EGA71049.1| 30S ribosomal protein S12 [Vibrio sinaloensis DSM 21326]
 gi|328472321|gb|EGF43191.1| 30S ribosomal protein S12 [Vibrio parahaemolyticus 10329]
 gi|328491233|dbj|GAA05189.1| ribosomal protein S12 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 124

 Score =  163 bits (412), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 95/124 (76%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR       + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRAKQV-VKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RKQ RS+YG 
Sbjct: 60  GFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVNDRKQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|14278541|pdb|1I94|L Chain L, Crystal Structures Of The Small Ribosomal Subunit With
           Tetracycline, Edeine And If3
 gi|14278562|pdb|1I95|L Chain L, Crystal Structure Of The 30s Ribosomal Subunit From
           Thermus Thermophilus In Complex With Edeine
 gi|14278583|pdb|1I96|L Chain L, Crystal Structure Of The 30s Ribosomal Subunit From
           Thermus Thermophilus In Complex With The Translation
           Initiation Factor If3 (C-Terminal Domain)
 gi|14278605|pdb|1I97|L Chain L, Crystal Structure Of The 30s Ribosomal Subunit From
           Thermus Thermophilus In Complex With Tetracycline
 gi|38492961|pdb|1QZC|L Chain L, Coordinates Of S12, Sh44, Lh69 And Srl Separately Fitted
           Into The Cryo-Em Map Of Ef-Tu Ternary Complex
           (Gdp.Kirromycin) Bound 70s Ribosome
 gi|149241286|pdb|2E5L|L Chain L, A Snapshot Of The 30s Ribosomal Subunit Capturing Mrna Via
           The Shine- Dalgarno Interaction
 gi|226887640|pdb|2ZM6|L Chain L, Crystal Structure Of The Thermus Thermophilus 30s
           Ribosomal Subunit
 gi|325533590|pdb|2Y10|L Chain L, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 gi|325533708|pdb|2Y14|L Chain L, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Cognate Codon On The 70s Ribosome.
 gi|325533767|pdb|2Y16|L Chain L, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Cognate Codon On The 70s Ribosome.
 gi|325533826|pdb|2Y18|L Chain L, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome
          Length = 131

 Score =  163 bits (412), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 82/119 (68%), Positives = 98/119 (82%), Gaps = 1/119 (0%)

Query: 2   PTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSG 61
           PT+NQL+RK R+   R  +KV AL+G P +RGVC  V TVTPKKPNSALRKV K RLTSG
Sbjct: 1   PTINQLVRKGRE-KVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSG 59

Query: 62  VEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGV DA GVK+RK++RS+YG 
Sbjct: 60  YEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGT 118


>gi|123969246|ref|YP_001010104.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. AS9601]
 gi|157414112|ref|YP_001484978.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9215]
 gi|254525776|ref|ZP_05137828.1| ribosomal protein S12 [Prochlorococcus marinus str. MIT 9202]
 gi|156637364|sp|A2BT86|RS12_PROMS RecName: Full=30S ribosomal protein S12
 gi|166991592|sp|A8G711|RS12_PROM2 RecName: Full=30S ribosomal protein S12
 gi|123199356|gb|ABM70997.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. AS9601]
 gi|157388687|gb|ABV51392.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9215]
 gi|221537200|gb|EEE39653.1| ribosomal protein S12 [Prochlorococcus marinus str. MIT 9202]
          Length = 124

 Score =  163 bits (412), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT++QL+   RK       K  AL+  P++RGVC RVYT TPKKPNSALRKV + RLTS
Sbjct: 1   MPTISQLVGSERK-RLTKKTKSPALKACPERRGVCTRVYTSTPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV AY+PG GHNLQEHSVV+L GGRVKDLPGV+Y +IRG LD  GVK+R+Q+RS+YGA
Sbjct: 60  GFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGA 119

Query: 121 ERPK 124
           + PK
Sbjct: 120 KAPK 123


>gi|134093225|ref|YP_001109526.1| ribosomal protein S12 [Populus trichocarpa]
 gi|157649037|ref|YP_001109479.2| ribosomal protein S12 [Populus trichocarpa]
 gi|158513818|sp|A4GYT5|RR12A_POPTR RecName: Full=30S ribosomal protein S12-A, chloroplastic
 gi|158563898|sp|Q49KX4|RR12_EUCGG RecName: Full=30S ribosomal protein S12, chloroplastic
 gi|133712087|gb|ABO36730.1| 30S ribosomal protein S12 [Populus trichocarpa]
 gi|296936695|gb|ADH94367.1| ribosomal protein S12 [Syzygium cumini]
 gi|296936696|gb|ADH94368.1| ribosomal protein S12 [Syzygium cumini]
          Length = 123

 Score =  163 bits (412), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR  R+   R   K  AL G PQ+RG C RVYT+TPKKPNSALRKV + RLTS
Sbjct: 1   MPTIKQLIRNTRQ-PIRNVTKSPALGGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G E+ AY+PG GHN QEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG 
Sbjct: 60  GFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSQYGV 119

Query: 121 ERPK 124
           ++PK
Sbjct: 120 KKPK 123


>gi|189501216|ref|YP_001960686.1| 30S ribosomal protein S12 [Chlorobium phaeobacteroides BS1]
 gi|226708477|sp|B3EP66|RS12_CHLPB RecName: Full=30S ribosomal protein S12
 gi|189496657|gb|ACE05205.1| ribosomal protein S12 [Chlorobium phaeobacteroides BS1]
          Length = 128

 Score =  163 bits (412), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+ QLIR+ RK      A   AL   PQKRGVC RVYT TPKKPNSALRKV + RL++
Sbjct: 1   MPTIQQLIRRGRKTKASKTAS-PALERCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            +EV AY+PGEGHNLQEHS+V++ GGRVKDLPGV+Y ++RG LD  GV +R+ +RS+YGA
Sbjct: 60  KIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRRNSRSKYGA 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|167031495|ref|YP_001666726.1| 30S ribosomal protein S12 [Pseudomonas putida GB-1]
 gi|189040473|sp|B0KK62|RS12_PSEPG RecName: Full=30S ribosomal protein S12
 gi|166857983|gb|ABY96390.1| ribosomal protein S12 [Pseudomonas putida GB-1]
          Length = 123

 Score =  163 bits (412), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 97/124 (78%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+R+PRK S    + V AL+  PQ+RGVC RVYT TP+KPNSALRKV + RLT+
Sbjct: 1   MATINQLVRQPRKRSVEK-SDVPALQNCPQRRGVCTRVYTTTPRKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GVK R Q RS+YG 
Sbjct: 60  GFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKGRNQGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|260774587|ref|ZP_05883499.1| SSU ribosomal protein S12p (S23e) [Vibrio metschnikovii CIP 69.14]
 gi|260610381|gb|EEX35588.1| SSU ribosomal protein S12p (S23e) [Vibrio metschnikovii CIP 69.14]
          Length = 124

 Score =  163 bits (412), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 95/124 (76%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+RKPR     A   V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+
Sbjct: 1   MATINQLVRKPRVKQV-AKNNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y  +RG LD  GV +RKQ RS+YG 
Sbjct: 60  GYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCSGVNDRKQGRSKYGV 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|48475430|gb|AAT44347.1| mutant ribosomal protein S12 [Francisella tularensis subsp.
           holarctica]
          Length = 124

 Score =  163 bits (412), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 95/124 (76%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           M T+NQL+  PRK S    +KV AL+  PQ+RGVC RVYT TP KPNSALRKV + RLTS
Sbjct: 1   MATINQLVNNPRKRSV-VKSKVPALKACPQRRGVCTRVYTTTPNKPNSALRKVARVRLTS 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
             EV +Y+ GEGHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV NRK  RS+YG 
Sbjct: 60  RFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTSGVNNRKHGRSKYGT 119

Query: 121 ERPK 124
           +RPK
Sbjct: 120 KRPK 123


>gi|282857669|ref|ZP_06266882.1| ribosomal protein S12 [Pyramidobacter piscolens W5455]
 gi|282584493|gb|EFB89848.1| ribosomal protein S12 [Pyramidobacter piscolens W5455]
          Length = 123

 Score =  163 bits (412), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 100/124 (80%), Gaps = 1/124 (0%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60
           MPT+NQL+RK R  +    A   AL+ +P +RGVC RVYTVTPKKPNSALRKV + RLT+
Sbjct: 1   MPTINQLVRKGRVAATYKSAS-PALQNSPVRRGVCTRVYTVTPKKPNSALRKVARVRLTN 59

Query: 61  GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
           G+EV +Y+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LD  GV +RK++RS+YGA
Sbjct: 60  GIEVTSYIPGVGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDCGGVADRKRSRSKYGA 119

Query: 121 ERPK 124
            RPK
Sbjct: 120 RRPK 123


>gi|269837061|ref|YP_003319289.1| 30S ribosomal protein S12 [Sphaerobacter thermophilus DSM 20745]
 gi|269786324|gb|ACZ38467.1| ribosomal protein S12 [Sphaerobacter thermophilus DSM 20745]
          Length = 141

 Score =  163 bits (412), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 84/141 (59%), Positives = 104/141 (73%), Gaps = 18/141 (12%)

Query: 1   MPTVNQLIRKPRKGSFRACAKVTALR-----------------GNPQKRGVCLRVYTVTP 43
           MPT+NQL+RK RK   +   K  ALR                 G+PQKRGVC +V T+TP
Sbjct: 1   MPTINQLVRKGRKRVIKKT-KAPALRYTNNALGRYAGRLRRGKGSPQKRGVCTQVRTMTP 59

Query: 44  KKPNSALRKVIKARLTSGVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVL 103
           KKPNSALRK+ + RL++G+EV AY+PGEGHNLQEHS V++ GGRVKDLPGV+Y +IRG L
Sbjct: 60  KKPNSALRKIARVRLSNGMEVTAYIPGEGHNLQEHSTVLIRGGRVKDLPGVRYHIIRGAL 119

Query: 104 DAQGVKNRKQARSRYGAERPK 124
           DA+