PSIBLAST alignment of GI: 254780266 and protein with PDB id: 1fjg

gi|10835596|pdb|1FJG|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 135
>gi|13096405|pdb|1HR0|L Chain L, Crystal Structure Of Initiation Factor If1 Bound To The 30s Ribosomal Subunit Length = 135
 Score =  183 bits (466), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 82/119 (68%), Positives = 98/119 (82%), Gaps = 1/119 (0%)

Query: 2   PTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSG 61
           PT+NQL+RK R+   R  +KV AL+G P +RGVC  V TVTPKKPNSALRKV K RLTSG
Sbjct: 5   PTINQLVRKGRE-KVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSG 63

Query: 62  VEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120
            EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGV DA GVK+RK++RS+YG 
Sbjct: 64  YEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGT 122