PSIBLAST alignment of GI: 254780266 and protein with PDB id: 1p6g

>gi|33357889|pdb|1P6G|L Chain L, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 123
>gi|33357966|pdb|1P87|L Chain L, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome Length = 123
 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 83/123 (67%), Positives = 97/123 (78%), Gaps = 1/123 (0%)

Query: 2   PTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSG 61
            TVNQL+RKPR     A + V AL   PQKRGVC RVYT TPKKPNSALRKV + RLT+G
Sbjct: 1   ATVNQLVRKPRARKV-AKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNG 59

Query: 62  VEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGAE 121
            EV +Y+ GEGHNLQEHSV+++ GGRVKDLPGV+Y  +RG LD  GVK+RKQARS+YG +
Sbjct: 60  FEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVK 119

Query: 122 RPK 124
           RPK
Sbjct: 120 RPK 122