PSIBLAST alignment of GI: 254780266 and protein with PDB id: 3iz6

gi|313103637|pdb|3IZ6|L Chain L, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 142
 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 61/116 (52%), Gaps = 12/116 (10%)

Query: 12  RKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL-TSGVEVIAYVPG 70
           +K       K     G+   +G+ L    +  K+PNSA+RK  + +L  +G ++ A+VP 
Sbjct: 28  KKSHLGNEWKKP-FAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPN 86

Query: 71  EG--HNLQEHSVVML-----CGGRVKDLPGVKYRVIR--GVLDAQGVKNRKQA-RS 116
           +G  + ++E+  V++      G  V D+PGV+++V++  GV      K +K+  RS
Sbjct: 87  DGCLNFIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142