PSIBLAST alignment of GI: 254780266 and protein with PDB id: 3izb

gi|313103675|pdb|3IZB|L Chain L, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 145
>gi|315113463|pdb|3O2Z|P Chain P, Yeast 80s Ribosome. This Entry Consists Of The 40s Subunit Of The First 80s In The Asymmetric Unit. Length = 145
 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/118 (30%), Positives = 64/118 (54%), Gaps = 11/118 (9%)

Query: 10  KPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL-TSGVEVIAYV 68
             +K       K +   G+   +G+ L    +  K+PNSA+RK ++ +L  +G +V A+V
Sbjct: 28  NYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFV 87

Query: 69  PGEG--HNLQEHSVVMLCG----GRVK-DLPGVKYRVIR--GVLDAQGVKNRKQA-RS 116
           P +G  + + E+  V+L G    G+ K D+PGV+++V++  GV      K +K+  RS
Sbjct: 88  PNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS 145