RPSBLAST alignment for GI: 254780266 and conserved domain: PRK04211

>gnl|CDD|179789 PRK04211, rps12P, 30S ribosomal protein S12P; Reviewed. Length = 145
 Score = 54.6 bits (132), Expect = 7e-09
 Identities = 41/108 (37%), Positives = 62/108 (57%), Gaps = 11/108 (10%)

Query: 21  KVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT-SGVEVIAYVPGEG--HNLQE 77
           K   L G P  RG+ L    V  K+PNSA+RK ++ +L  +G +V A+ PG+G  + + E
Sbjct: 38  KADPLEGAPMARGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKQVTAFCPGDGAINFIDE 97

Query: 78  HSVVMLCG-----GRVK-DLPGVKYRVIR--GVLDAQGVKNRKQARSR 117
           H  V++ G     GR   D+PGV+Y+VI+  GV   + VK +K+   R
Sbjct: 98  HDEVVIEGIGGPKGRSMGDIPGVRYKVIKVNGVSLKELVKGKKEKPVR 145