RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780266|ref|YP_003064679.1| 30S ribosomal protein S12 [Candidatus Liberibacter asiaticus str. psy62] (124 letters) >gnl|CDD|176992 CHL00051, rps12, ribosomal protein S12. Length = 123 Score = 186 bits (475), Expect = 1e-48 Identities = 82/124 (66%), Positives = 99/124 (79%), Gaps = 1/124 (0%) Query: 1 MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60 MPT+ QLIR R+ R K ALRG PQ+RG C RVYT+TPKKPNSALRKV + RLTS Sbjct: 1 MPTIKQLIRNTRQ-PIRNKTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTS 59 Query: 61 GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120 G E+ AY+PG GHNLQEHSVV++ GGRVKDLPGV+Y ++RG LDA GVK+R+Q RS+YG Sbjct: 60 GFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGV 119 Query: 121 ERPK 124 ++PK Sbjct: 120 KKPK 123 >gnl|CDD|30397 COG0048, RpsL, Ribosomal protein S12 [Translation, ribosomal structure and biogenesis]. Length = 129 Score = 159 bits (404), Expect = 2e-40 Identities = 84/124 (67%), Positives = 100/124 (80%), Gaps = 1/124 (0%) Query: 1 MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60 MPT+NQL+RK R+ S +K AL G PQ RGVC RVYTVTPKKPNSALRKV + RL + Sbjct: 7 MPTINQLVRKKRR-SLGLKSKSPALEGAPQARGVCTRVYTVTPKKPNSALRKVARVRLIN 65 Query: 61 GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120 G EV AY+PGEGHNLQEHS V++ GGRVKDLPGV+Y+V+RG LD+ GV +R Q RS+YGA Sbjct: 66 GKEVTAYIPGEGHNLQEHSEVLIRGGRVKDLPGVRYKVVRGALDSLGVLDRGQKRSKYGA 125 Query: 121 ERPK 124 +RPK Sbjct: 126 KRPK 129 >gnl|CDD|143932 pfam00164, Ribosomal_S12, Ribosomal protein S12. Length = 112 Score = 159 bits (403), Expect = 3e-40 Identities = 74/104 (71%), Positives = 87/104 (83%) Query: 21 KVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSGVEVIAYVPGEGHNLQEHSV 80 K AL G PQKRGVCL VYT+TPKKPNSALRKV + RL +G EV AY+PG+GHNLQEHS Sbjct: 9 KSPALEGCPQKRGVCLEVYTITPKKPNSALRKVARVRLINGKEVTAYIPGDGHNLQEHSE 68 Query: 81 VMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGAERPK 124 V++ GGRVKDLPGV+Y+V+RG LD GV +RKQARS+YG E+PK Sbjct: 69 VLIRGGRVKDLPGVRYKVVRGALDVAGVSDRKQARSKYGKEKPK 112 >gnl|CDD|48341 cd03368, Ribosomal_S12, S12-like family, 30S ribosomal protein S12 subfamily; S12 is located at the interface of the large and small ribosomal subunits of prokaryotes, chloroplasts and mitochondria, where it plays an important role in both tRNA and ribosomal subunit interactions. S12 is essential for maintenance of a pretranslocation state and, together with S13, functions as a control element for the rRNA- and tRNA-driven movements of translocation. Antibiotics such as streptomycin bind S12 and cause the ribosome to misread the genetic code.. Length = 108 Score = 155 bits (393), Expect = 3e-39 Identities = 76/109 (69%), Positives = 90/109 (82%), Gaps = 1/109 (0%) Query: 3 TVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSGV 62 T+NQLIRK RK + +K AL G PQK+GVCL+VYT TPKKPNSALRKV + RL++G Sbjct: 1 TINQLIRKGRK-KKKKKSKSPALEGCPQKKGVCLKVYTTTPKKPNSALRKVARVRLSNGK 59 Query: 63 EVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNR 111 EV AY+PGEGHNLQEHSVV++ GGRVKDLPGV+Y ++RGVLD GVKNR Sbjct: 60 EVTAYIPGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGVLDLAGVKNR 108 >gnl|CDD|36961 KOG1750, KOG1750, KOG1750, Mitochondrial/chloroplast ribosomal protein S12 [Translation, ribosomal structure and biogenesis]. Length = 139 Score = 135 bits (341), Expect = 3e-33 Identities = 66/112 (58%), Positives = 80/112 (71%) Query: 1 MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60 M T+NQLIR + R K AL G PQ++GV LRV+T PKKPNSA RK + RL++ Sbjct: 28 MATLNQLIRNGGRPPKRRPRKSPALDGCPQRKGVVLRVFTRKPKKPNSANRKCARVRLST 87 Query: 61 GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRK 112 G EV AY+PG GHNLQEHS+V++ GGRV+DLPGVKY V+RGV D GV R Sbjct: 88 GREVTAYIPGIGHNLQEHSIVLVRGGRVQDLPGVKYHVVRGVYDLAGVVGRI 139 >gnl|CDD|48339 cd00319, Ribosomal_S12_like, Ribosomal protein S12-like family; composed of prokaryotic 30S ribosomal protein S12, eukaryotic 40S ribosomal protein S23 and similar proteins. S12 and S23 are located at the interface of the large and small ribosomal subunits, adjacent to the decoding center. They play an important role in translocation during the peptide elongation step of protein synthesis. They are also involved in important RNA and protein interactions. Ribosomal protein S12 is essential for maintenance of a pretranslocation state and, together with S13, functions as a control element for the rRNA- and tRNA-driven movements of translocation. S23 interacts with domain III of the eukaryotic elongation factor 2 (eEF2), which catalyzes translocation. Mutations in S12 and S23 have been found to affect translational accuracy. Antibiotics such as streptomycin may also bind S12/S23 and cause the ribosome to misread the genetic code.. Length = 95 Score = 70.5 bits (172), Expect = 1e-13 Identities = 62/82 (75%), Positives = 70/82 (85%) Query: 21 KVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTSGVEVIAYVPGEGHNLQEHSV 80 KV AL+G P +RGVC V TVTPKKPNSALRKV K RLTSG EV AY+PGEGHNLQEHSV Sbjct: 5 KVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSV 64 Query: 81 VMLCGGRVKDLPGVKYRVIRGV 102 V++ GGRVKDLPGV+Y ++RGV Sbjct: 65 VLIRGGRVKDLPGVRYHIVRGV 86 >gnl|CDD|48340 cd03367, Ribosomal_S23, S12-like family, 40S ribosomal protein S23 subfamily; S23 is located at the interface of the large and small ribosomal subunits of eukaryotes, adjacent to the decoding center. It interacts with domain III of the eukaryotic elongation factor 2 (eEF2), which catalyzes the translocation of the growing peptidyl-tRNA to the P site to make room for the next aminoacyl-tRNA at the A (acceptor) site. Through its interaction with eEF2, S23 may play an important role in translocation. Also members of this subfamily are the archaeal 30S ribosomal S12 proteins. Prokaryotic S12 is essential for maintenance of a pretranslocation state and, together with S13, functions as control element for the rRNA- and tRNA-driven movements of translocation. S12 and S23 are also implicated in translation accuracy. Antibiotics such as streptomycin bind S12/S23 and cause the ribosome to misread the genetic code.. Length = 115 Score = 54.8 bits (132), Expect = 6e-09 Identities = 33/97 (34%), Positives = 57/97 (58%), Gaps = 8/97 (8%) Query: 12 RKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLT-SGVEVIAYVPG 70 +K K L G P +G+ L V K+PNSA+RK ++ +L +G ++ A+VPG Sbjct: 3 KKRHLGTKYKADPLGGAPHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPG 62 Query: 71 EG--HNLQEHSVVMLCG----GR-VKDLPGVKYRVIR 100 +G + + E+ V++ G GR V D+PGV+++V++ Sbjct: 63 DGCLNFIDENDEVLVAGFGRKGRAVGDIPGVRFKVVK 99 >gnl|CDD|36960 KOG1749, KOG1749, KOG1749, 40S ribosomal protein S23 [Translation, ribosomal structure and biogenesis]. Length = 143 Score = 42.6 bits (100), Expect = 3e-05 Identities = 29/88 (32%), Positives = 54/88 (61%), Gaps = 8/88 (9%) Query: 21 KVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARL-TSGVEVIAYVPGEG--HNLQE 77 K + G +G+ L V K+PNSA+RK ++ +L +G ++ A+VP +G + ++E Sbjct: 37 KSSPFGGASHAKGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEE 96 Query: 78 HSVVMLCG-GR----VKDLPGVKYRVIR 100 + V++ G GR V D+PGV+++V++ Sbjct: 97 NDEVLVAGFGRKGHAVGDIPGVRFKVVK 124 >gnl|CDD|111238 pfam02324, Glyco_hydro_70, Glycosyl hydrolase family 70. Members of this family belong to glycosyl hydrolase family 70 Glucosyltransferases or sucrose 6-glycosyl transferases (GTF-S) catalyse the transfer of D-glucopyramnosyl units from sucrose onto acceptor molecules, EC:2.4.1.5. This family roughly corresponds to the N-terminal catalytic domain of the enzyme. Members of this family also contain the Putative cell wall binding domain pfam01473, which corresponds with the C-terminal glucan-binding domain. Length = 808 Score = 29.3 bits (66), Expect = 0.31 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Query: 42 TPKKPNSA--LRKVIKARLTSGVEVIA-YVPGEGHNLQEHSVV 81 K SA LR +KA G++ IA +VP + +NL VV Sbjct: 638 KNNKYGSADDLRDALKALHAQGIQAIADWVPDQIYNLPGKEVV 680 >gnl|CDD|39046 KOG3842, KOG3842, KOG3842, Adaptor protein Pellino [Signal transduction mechanisms]. Length = 429 Score = 25.3 bits (55), Expect = 4.6 Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 6/58 (10%) Query: 67 YVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGAERPK 124 V E + LQ+ S++ LCG + +R G+ + +K+ + R A RP+ Sbjct: 241 LVEEETNVLQDGSLIDLCGAT------LLWRTADGLEHSPTMKHLEALRQEINAARPQ 292 >gnl|CDD|132931 cd07020, Clp_protease_NfeD_1, Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease. Nodulation formation efficiency D (NfeD; stomatin operon partner protein, STOPP; DUF107) is a member of membrane-anchored ClpP-class proteases. Currently, more than 300 NfeD homologs have been identified - all of which are bacterial or archaeal in origin. Majority of these genomes have been shown to possess operons containing a homologous NfeD/stomatin gene pair, causing NfeD to be previously named STOPP (stomatin operon partner protein). NfeD homologs can be divided into two groups: long and short forms. Long-form homologs have a putative ClpP-class serine protease domain while the short form homologs do not. Downstream from the ClpP-class domain is the so-called NfeD or DUF107 domain. N-terminal region of the NfeD homolog PH1510 (1510-N or PH1510-N) from Pyrococcus horikoshii has been shown to possess serine protease activity and has a Ser-Lys catalytic dyad, preferentially cleaving hydrophobic substrates. Difference in oligomeric form and catalytic residues between 1510-N (forming a dimer) and ClpP (forming a tetradecamer) shows a possible functional difference: 1510-N is likely to have a regulatory function while ClpP is involved in protein quality control. Length = 187 Score = 25.2 bits (56), Expect = 4.7 Identities = 9/27 (33%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Query: 48 SALRKVIKARLTSGVEVIAYV-PGEGH 73 + R++++A L S V V+ YV P Sbjct: 45 DSTREIVQAILASPVPVVVYVYPSGAR 71 >gnl|CDD|31208 COG1004, Ugd, Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]. Length = 414 Score = 25.2 bits (55), Expect = 5.3 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 6/31 (19%) Query: 45 KPN------SALRKVIKARLTSGVEVIAYVP 69 KPN S +IK G EVIAY P Sbjct: 321 KPNTDDMRESPALDIIKRLQEKGAEVIAYDP 351 >gnl|CDD|29309 cd00231, ZipA, ZipA C-terminal domain. ZipA, a membrane-anchored protein, is one of at least nine essential gene products necessary for assembly of the septal ring which mediates cell division in E.coli. ZipA and FtsA directly bind FtsZ, a homolog of eukaryotic tubulins, at the prospective division site, followed by the sequential addition of FtsK, FtsQ, FtsL, FtsW, FtsI, and FtsN. ZipA contains three domains: a short N-terminal membrane-anchored domain, a central P/Q domain that is rich in proline and glutamine and a C-terminal domain, which comprises almost half the protein.. Length = 130 Score = 24.9 bits (54), Expect = 5.6 Identities = 13/56 (23%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 59 TSGVEVIAYVPGEGHNLQEHSVVMLCGGRV-KDLPGVKYRVIRGVLDAQGVKNRKQ 113 T G+ +P G LQ +++ R+ DL GV R ++ Q ++ + Sbjct: 73 TPGISFFMQLPSPGDALQNFKLMLQAAQRIADDLGGVVLDDQRRMMTPQKLRAYRD 128 >gnl|CDD|163668 cd07425, MPP_Shelphs, Shewanella-like phosphatases, metallophosphatase domain. This family includes bacterial, eukaryotic, and archeal proteins orthologous to the Shewanella cold-active protein-tyrosine phosphatase, CAPTPase. CAPTPase is an uncharacterized protein that belongs to the Shelph (Shewanella-like phosphatase) family of PPP (phosphoprotein phosphatases). The PPP family is one of two known protein phosphatase families specific for serine and threonine. In addition to Shelps, the PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 208 Score = 24.9 bits (55), Expect = 6.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 72 GHNLQEHSVVMLCGGRV 88 GH QE +V CGG+V Sbjct: 174 GHTPQEGGIVTFCGGKV 190 >gnl|CDD|36452 KOG1238, KOG1238, KOG1238, Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only]. Length = 623 Score = 24.5 bits (53), Expect = 6.9 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 7/33 (21%) Query: 46 PNSALRKVIKARLTSGVEVIAYVPGEGHNLQEH 78 P L+K+ G+ V+ +PG G NLQ+H Sbjct: 330 PADHLKKL-------GIPVVLDLPGVGQNLQDH 355 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0677 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,420,485 Number of extensions: 66127 Number of successful extensions: 151 Number of sequences better than 10.0: 1 Number of HSP's gapped: 146 Number of HSP's successfully gapped: 26 Length of query: 124 Length of database: 6,263,737 Length adjustment: 82 Effective length of query: 42 Effective length of database: 4,491,799 Effective search space: 188655558 Effective search space used: 188655558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.5 bits)