>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit; InterPro: IPR005809 There are four different enzymes that share a similar catalytic mechanism which involves the phosphorylation by ATP (or GTP) of a specific histidine residue in the active site. These enzymes are: ATP citrate-lyase (4.1.3.8 from EC) , the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues, catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with the concomitant hydrolysis of ATP to ADP and phosphate. ATP-citrate lyase is a tetramer of identical subunits; Succinyl-CoA ligase (GDP-forming) (6.2.1.4 from EC) is a mitochondrial enzyme that catalyzes the substrate level phosphorylation step of the tricarboxylic acid cycle: the formation of succinyl-CoA from succinate with a concomitant hydrolysis of GTP to GDP and phosphate. This enzyme is a dimer composed of an alpha and a beta subunits; Succinyl-CoA ligase (ADP-forming) (6.2.1.5 from EC) is a bacterial enzyme that during aerobic metabolism functions in the citric acid cycle, coupling the hydrolysis of succinyl-CoA to the synthesis of ATP. It can also function in the other direction for anabolic purposes. This enzyme is a tetramer composed of two alpha and two beta subunits; and Malate-CoA ligase (6.2.1.9 from EC) (malyl-CoA synthetase) , is a bacterial enzyme that forms malyl-CoA from malate and CoA with the concomitant hydrolysis of ATP to ADP and phosphate. Malate-CoA ligase is composed of two different subunits. This entry corresponds to a conserved region located in the first half of ATP citrate lyase and in the beta subunits of succinyl-CoA ligases and malate-CoA ligase. ; GO: 0003824 catalytic activity, 0008152 metabolic process.

Probab=98.63 E-value=2e-07 Score=73.06 Aligned_cols=178 Identities=23% Similarity=0.286 Sum_probs=118.6 Q ss_pred HHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCC-CHHHHHCCCCCCCC----EEEEEEECHHHHHHHHHHHHHHHCCCC Q ss_conf 9887766422443324333455799987320033-01220002345782----168887506689999987543212589 Q gi|254780268|r 117 ITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIG-FPVLVKASAGGGGR----GMRIAYSENDLSEAIDQARSEALAAFG 191 (443) Q Consensus 117 ~~~k~~a~~~GVP~~p~~~~~~~~ea~~~a~~iG-yPviiKp~~gGGG~----Gi~vv~~~~el~~a~~~a~~ea~~~fg 191 (443) T Consensus 6 YqAK~if~~YGiPvp~g~v~~s~~e~~~~~~~~g~~~~VvKaQVhaGGRGKAGGv~~a~s~ee~~~~a~~llg~~l~t~Q 85 (389) T TIGR01016 6 YQAKEIFAKYGIPVPEGEVATSVEEVEEIAEELGEGKVVVKAQVHAGGRGKAGGVKVAKSKEEALKAAEKLLGKELKTFQ 85 (389) T ss_pred HHHHHHHHHCCCCCCCCCEEECHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCEEEEECHHHHHHHHHHHHCCEEEEEE T ss_conf 55899998478967886004167899999997079978999877326711215768970879999999987089157864 Q ss_pred C-------CCEEEEEEEEEEEECCEEEEEECCCCCCCC-----CCCCC-CCCCCCC-EEEEEC--CCC------------ Q ss_conf 9-------816884434201103315777347870236-----56654-2113562-255403--445------------ Q gi|254780268|r 192 N-------DAVYIEKYLENPRHIEVQIFGDGMGNAIHF-----GERDC-SVQRRNQ-KIWEEA--HSP------------ 243 (443) Q Consensus 192 d-------~~vlvEk~i~~~rhiEvqVl~D~~g~~v~l-----~erdC-SiQrr~q-kiiEea--Pap------------ 243 (443) T Consensus 86 t~~~g~~VnkiliE~~~~I~kEyY~s~v~DR~~~~pv~maS~eGGvdIEEvA~~~Pe~I~k~~idp~~~~~pYq~R~~a~ 165 (389) T TIGR01016 86 TDPLGQPVNKILIEEKIDIDKEYYLSIVIDRSAKKPVIMASTEGGVDIEEVAEKSPEKIIKVAIDPLTGLLPYQARELAK 165 (389) T ss_pred CCCCCCEEEEEEECCCCCCCCEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHH T ss_conf 07888634478732677412001477999804787179970677841789952195716888717777778789999999 Q ss_pred --CCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCEEEEECCCCCCCCCHHHHHHHCC-CCHHHHHHHHHC Q ss_conf --588999999999999988651543410245897288349982276543320167886325-620112322210 Q gi|254780268|r 244 --VISAQDRTEIGETCVKAMKKIDYRGAGTIEFLYENGQFYFIEMNTRLQVEHPVTEAITGI-DLVHEQIYVASE 315 (443) Q Consensus 244 --~l~~~~~~~i~~~A~~~~~~~g~~g~~tvEFl~~~~~~yflEvN~Rlqveh~vte~~tgv-dlv~~~~~~a~g 315 (443) T Consensus 166 ~~~l~~~~~~~~~~i~~~Ly~~F------------~e~Da~L~EINPLV---------iT~~G~L~alDAKl~~D 219 (389) T TIGR01016 166 KLGLEGELIKQVASIIKKLYQIF------------LEKDASLVEINPLV---------ITKDGNLVALDAKLTID 219 (389) T ss_pred HCCCCHHHHHHHHHHHHHHHHHH------------HHCCCCEEEECCEE---------ECCCCCEEEEEEECCCC T ss_conf 70897057788999999999988------------75371025452636---------87898889983322446

HHsearch alignment for GI: 254780268 and conserved domain: TIGR01016