>TIGR00390 hslU heat shock protein HslVU, ATPase subunit HslU; InterPro: IPR004491 This family of proteins represent HslU, a bacterial clpX homolog, which is an ATPase and chaperone belonging to the AAA Clp/Hsp100 family and a component of the eubacterial proteasome. ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins. They include the proteasome in Eukaryotes, Archaea, and Actinomycetales and the HslVU (ClpQY, ClpXP) complex in other eubacteria. Genes homologous to eubacterial HslV, IPR001353 from INTERPRO, (ClpQ,) and HslU (ClpY, ClpX) have also been demonstrated in to be present in the genome of trypanosomatid protozoa. They are expressed as precursors, with a propeptide that is removed to produce the active protease. The protease is probably located in the kinetoplast (mitochondrion). Phylogenetic analysis shows that HslV and HslU from trypanosomatids form a single clad with other eubacterial homologs . ; GO: 0005515 protein binding, 0005524 ATP binding, 0009377 HslUV protease activity, 0016887 ATPase activity, 0005737 cytoplasm, 0009376 HslUV protease complex.

Probab=97.52 E-value=0.0002 Score=52.29 Aligned_cols=88 Identities=26% Similarity=0.431 Sum_probs=60.3 Q ss_pred HHHHHHHHCHHHHHHHHHHHHHHHHH----------CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCC Q ss_conf 87766520116899999999999984----------24446735998605656502799999977088249986188888 Q gi|254780270|r 335 RILDQDHFGLEKVKERIIEYLAVQMR----------VIKNKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYD 404 (820) Q Consensus 335 ~iLd~~hyGl~~vK~rile~lav~~~----------~~~~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d 404 (820) T Consensus 8 ~~LD~yIiGQ~~AKk~VA--iALrNRyrR~~L~~~L~~EV~PKNILMiGpTGVGKTEIARRlAKL~~aPFiKVE------ 79 (463) T TIGR00390 8 AELDKYIIGQDEAKKAVA--IALRNRYRRSQLEEELKDEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVE------ 79 (463) T ss_pred HHHCCCCCCHHHHHHHHH--HHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCEEEE------ T ss_conf 751442206366788999--998866776128711135658743043278898544799999998448914666------ Q ss_pred HHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEE Q ss_conf 88835632001456712899999832788739 Q gi|254780270|r 405 EADIRGHRRTYIGSMPGRIIQSLKRAKRSNPL 436 (820) Q Consensus 405 ~~~i~gh~~ty~ga~pg~ii~~l~~~~~~npv 436 (820) T Consensus 80 -A----tKfTEVG-YVGrdVeSmvRDL~~~aV 105 (463) T TIGR00390 80 -A----TKFTEVG-YVGRDVESMVRDLVDTAV 105 (463) T ss_pred -E----EEEEECC-EECCCHHHHHHHHHHHHH T ss_conf -4----1001102-142410036787899999

HHsearch alignment for GI: 254780270 and conserved domain: TIGR00390