>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=96.26 E-value=0.0038 Score=42.67 Aligned_cols=78 Identities=33% Similarity=0.442 Sum_probs=47.6 Q ss_pred CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCH----HHHCCCCCCCCCCCCHHHHH--HHHHCCCC-CEE Q ss_conf 467359986056565027999999770882499861888888----88356320014567128999--99832788-739 Q gi|254780270|r 364 NKGLILCFVGPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDE----ADIRGHRRTYIGSMPGRIIQ--SLKRAKRS-NPL 436 (820) Q Consensus 364 ~~g~il~l~gppgvGKts~~~sia~al~r~f~~islgg~~d~----~~i~gh~~ty~ga~pg~ii~--~l~~~~~~-npv 436 (820) T Consensus 23 ~~Ge~~~i~G~nGaGKSTLl~~l~gl~~~~~G~i~~~g~~~~~~~~~~~~~-~i~~v~QLSgGqkqrv~iA~al~~~p~i 101 (157) T cd00267 23 KAGEIVALVGPNGSGKSTLLRAIAGLLKPTSGEILIDGKDIAKLPLEELRR-RIGYVPQLSGGQRQRVALARALLLNPDL 101 (157) T ss_pred CCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHH-CCCCCCCCCHHHHHHHHHHHHHHCCCCE T ss_conf 799799998788999899999995884799628999999999799999994-0608766886999999999999709999 Q ss_pred EEEECH Q ss_conf 999331 Q gi|254780270|r 437 LLLDEI 442 (820) Q Consensus 437 ~~ldei 442 (820) T Consensus 102 lilDEP 107 (157) T cd00267 102 LLLDEP 107 (157) T ss_pred EEEECC T ss_conf 999698

HHsearch alignment for GI: 254780270 and conserved domain: cd00267