>pfam03796 DnaB_C DnaB-like helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.

Probab=94.51 E-value=0.061 Score=33.52 Aligned_cols=40 Identities=28% Similarity=0.371 Sum_probs=32.1 Q ss_pred CCCCCCCEEEEECCCCCCHHHHHHHHHHH----HCCCEEEEECC Q ss_conf 24446735998605656502799999977----08824998618 Q gi|254780270|r 361 VIKNKGLILCFVGPPGVGKTSLAQSIAKA----TGRQYVRMSLG 400 (820) Q Consensus 361 ~~~~~g~il~l~gppgvGKts~~~sia~a----l~r~f~~islg 400 (820) T Consensus 14 gGl~~G~l~vi~g~pg~GKS~~~~~~a~~~a~~~g~~Vl~~slE 57 (186) T pfam03796 14 GGLQKGDLIIIAARPSMGKTAFALNIARNAALKQDKPVLFFSLE 57 (186) T ss_pred CCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCC T ss_conf 69888817999967999879999999999999709966875475

HHsearch alignment for GI: 254780270 and conserved domain: pfam03796