>TIGR01242 26Sp45 26S proteasome subunit P45 family; InterPro: IPR005937 Intracellular proteins, including short-lived proteins such as cyclin, Mos, Myc, p53, NF-kappaB, and IkappaB, are degraded by the ubiquitin-proteasome system. The 26S proteasome (a 2 MDa complex) is made up of two subcomplexes: the 20S proteasome and the regulatory complex. The former is a 700 kDa cylindrical protease complex consisting of four stacks of heptameric rings with 28 subunits (i.e., 7777) with molecular masses of about 20-35 kDa, whereas the latter is a 700-1000 kDa complex consisting of at least 18 subunits with molecular masses of 28-110 kDa, including 6 putative ATPases (Rpt1-Rpt6) and 12 non-ATPase subunits (Rpn1-12). Members of the 26S proteasome subunit P45 family: ATPase p45/Sug1/Rpt6 may be phosphorylated within the proteasome. This phosphorylation event may play a key role in ATP-dependent proteolysis because a good correlation exists between the inhibition pattern of protein kinase inhibitors against the phosphorylation of p45 and that against the ATP-dependent proteolytic activity , . More information about these protein can be found at Protein of the Month: AAA ATPases .; GO: 0016787 hydrolase activity, 0030163 protein catabolic process, 0005634 nucleus, 0005737 cytoplasm.

Probab=99.17 E-value=2.9e-11 Score=99.45 Aligned_cols=98 Identities=29% Similarity=0.544 Sum_probs=77.9 Q ss_pred CCCCEEEEECCCCCHHHHHHHHHHHHCCCEEEHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 56835884073321769999999871853131012211111103556330357788765422776542233322333200 Q gi|254780271|r 112 AKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKIS 191 (424) Q Consensus 112 ~~~NILliGPTGvGKTelAr~LAk~l~~PF~~vdaT~~TE~GYvG~Dvesii~~L~~~a~~~v~~a~~~iv~iDEidKi~ 191 (424) T Consensus 155 PPKGvLLyGPPGtGKTLlAKAvA~et~ATFIrvVgSElV~-KyIGEG-ArLV~~~F~LA----kEKaPsIiFIDEiDAia 228 (364) T TIGR01242 155 PPKGVLLYGPPGTGKTLLAKAVAHETNATFIRVVGSELVR-KYIGEG-ARLVREVFELA----KEKAPSIIFIDEIDAIA 228 (364) T ss_pred CCCCEEEECCCCCCHHHHHHHHHCCCCCEEEEEEHHHHHH-HHHCCH-HHHHHHHHHHH----HCCCCCEEEEECHHHHH T ss_conf 8986570075797688999986314551268860444444-441331-68999999985----30698168610133354 Q ss_pred CCCCCCCCCCCCCHHHHHHHHHHHCCC Q ss_conf 233333344321025689887531058 Q gi|254780271|r 192 RKSDNPSITRDVSGEGVQQALLKIMEG 218 (424) Q Consensus 192 ~~~~~~~~~~dvs~~gvq~~LLkileg 218 (424) T Consensus 229 akR~~~~Ts---GdREV~RTlmQLLAE 252 (364) T TIGR01242 229 AKRVDSSTS---GDREVQRTLMQLLAE 252 (364) T ss_pred HHHCCCCCC---CCHHHHHHHHHHHHH T ss_conf 321146778---731578899999975

HHsearch alignment for GI: 254780271 and conserved domain: TIGR01242