>TIGR01818 ntrC nitrogen regulation protein NR(I); InterPro: IPR010114 This entry represents Nitrogen regulatory protein C (NtrC), which is a bacterial enhancer-binding protein that activates the transcription of genes encoding enzymes required for nitrogen metabolism. It is phosphorylated by NtrB and interacts with sigma-54. One of the best studied examples is its activation of the gene glnA, which encodes the enzyme glutamine synthetase.. NtrC is composed of three domains , . The 124 residue N-terminal domain is homologous to receiver domains of other response regulator proteins in two-component signal transduction systems , . The 240 residue central domain of NtrC is homologous to a domain found in all activators of the sigma-54 RNA polymerase holoenzyme , . The C-terminal domain has been indicated to contain the determinants necessary for both DNA-binding and dimerization of full-length NtrC.; GO: 0000156 two-component response regulator activity, 0003677 DNA binding, 0005524 ATP binding, 0000160 two-component signal transduction system (phosphorelay), 0009399 nitrogen fixation, 0050906 detection of stimulus during sensory perception.

Probab=95.03 E-value=0.025 Score=36.89 Aligned_cols=107 Identities=25% Similarity=0.439 Sum_probs=68.2 Q ss_pred CEEEEECCCCCHHHHHHHHHHH---HCCCEEEHHHHH----HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 3588407332176999999987---185313101221----111110355633035778876542277654223332233 Q gi|254780271|r 115 NILLVGPTGCGKTYLAQTLARI---IDVPFTMADATT----LTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEV 187 (424) Q Consensus 115 NILliGPTGvGKTelAr~LAk~---l~~PF~~vdaT~----~TE~GYvG~Dvesii~~L~~~a~~~v~~a~~~iv~iDEi 187 (424) T Consensus 160 ~VlI~GESGTGKELVA~ALH~~s~R~~~PFiAlNmAAIP~~L~ESELFGHEkGAF-TGA~~~~~GRFEQA~GGTLFLDEI 238 (471) T TIGR01818 160 SVLINGESGTGKELVARALHRHSPRARGPFIALNMAAIPKDLIESELFGHEKGAF-TGANTRRQGRFEQADGGTLFLDEI 238 (471) T ss_pred EEEEECCCCCCHHHHHHHHHCCCCCCCCCCEEECHHHCCHHHHHHHHCCCCCCCC-CCCCCCCCCCEEECCCCCEECCCC T ss_conf 5888557577589999984013755577732730232224665543214565300-010255677725348882101021 Q ss_pred HHHCCCCCCCCCCCCCCHHHHHHHHHHHCC-CCEEECCCCCCCCCCCCCEEEE Q ss_conf 320023333334432102568988753105-8701025655643222430243 Q gi|254780271|r 188 DKISRKSDNPSITRDVSGEGVQQALLKIME-GTIASVPPQGGRKHPQQEFLQV 239 (424) Q Consensus 188 dKi~~~~~~~~~~~dvs~~gvq~~LLkile-g~~~~v~~~~grk~~~~~~~~I 239 (424) T Consensus 239 GDMPl--------------~~QTRLLRVL~~G~f~rV---GG~~p~k~DVRi~ 274 (471) T TIGR01818 239 GDMPL--------------DLQTRLLRVLADGEFYRV---GGRTPIKVDVRIV 274 (471) T ss_pred CCCCH--------------HHHHHHHHHHCCCCEEEE---CCCEEEEEEEEEE T ss_conf 67877--------------687779886407865772---6820245504667

HHsearch alignment for GI: 254780271 and conserved domain: TIGR01818