HHsearch alignment for GI: 254780271 and conserved domain: cd03231

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter. The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=94.33  E-value=0.027  Score=36.63  Aligned_cols=29  Identities=38%  Similarity=0.591  Sum_probs=22.3

Q ss_pred             CCCCCC-EEEEECCCCCHHHHHHHHHHHHC
Q ss_conf             225683-58840733217699999998718
Q gi|254780271|r  110 ELAKSN-ILLVGPTGCGKTYLAQTLARIID  138 (424)
Q Consensus       110 ei~~~N-ILliGPTGvGKTelAr~LAk~l~  138 (424)
T Consensus        22 ~i~~Ge~~~l~G~NGsGKSTLlk~i~Gl~~   51 (201)
T cd03231          22 TLAAGEALQVTGPNGSGKTTLLRILAGLSP   51 (201)
T ss_pred             EECCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             887995999999999999999999966778