HHsearch alignment for GI: 254780271 and conserved domain: cd03250

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=93.67  E-value=0.038  Score=35.62  Aligned_cols=29  Identities=34%  Similarity=0.608  Sum_probs=22.3

Q ss_pred             CCCCC-CEEEEECCCCCHHHHHHHHHHHHC
Q ss_conf             22568-358840733217699999998718
Q gi|254780271|r  110 ELAKS-NILLVGPTGCGKTYLAQTLARIID  138 (424)
Q Consensus       110 ei~~~-NILliGPTGvGKTelAr~LAk~l~  138 (424)
T Consensus        27 ~i~~Ge~~~IvG~sGsGKSTLl~~i~G~~~   56 (204)
T cd03250          27 EVPKGELVAIVGPVGSGKSSLLSALLGELE   56 (204)
T ss_pred             EECCCCEEEEECCCCCCHHHHHHHHCCCCC
T ss_conf             976998999999999858999999818952