HHsearch alignment for GI: 254780271 and conserved domain: cd03261

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.11  E-value=0.033  Score=36.01  Aligned_cols=29  Identities=21%  Similarity=0.660  Sum_probs=22.3

Q ss_pred             CCCCCC-EEEEECCCCCHHHHHHHHHHHHC
Q ss_conf             225683-58840733217699999998718
Q gi|254780271|r  110 ELAKSN-ILLVGPTGCGKTYLAQTLARIID  138 (424)
Q Consensus       110 ei~~~N-ILliGPTGvGKTelAr~LAk~l~  138 (424)
T Consensus        22 ~i~~Ge~~~iiG~SGsGKSTll~~i~gL~~   51 (235)
T cd03261          22 DVRRGEILAIIGPSGSGKSTLLRLIVGLLR   51 (235)
T ss_pred             EECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             887998999999999729999999975999