HHsearch alignment for GI: 254780271 and conserved domain: cd03294

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.10  E-value=0.013  Score=38.79  Aligned_cols=29  Identities=24%  Similarity=0.644  Sum_probs=22.4

Q ss_pred             CCCCCC-EEEEECCCCCHHHHHHHHHHHHC
Q ss_conf             225683-58840733217699999998718
Q gi|254780271|r  110 ELAKSN-ILLVGPTGCGKTYLAQTLARIID  138 (424)
Q Consensus       110 ei~~~N-ILliGPTGvGKTelAr~LAk~l~  138 (424)
T Consensus        46 ~i~~GE~~~ivG~SGsGKSTLLr~i~GL~~   75 (269)
T cd03294          46 DVREGEIFVIMGLSGSGKSTLLRCINRLIE   75 (269)
T ss_pred             EECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             888999999998998489999999975999