HHsearch alignment for GI: 254780271 and conserved domain: cd03300

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D. PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.78  E-value=0.017  Score=37.99  Aligned_cols=30  Identities=33%  Similarity=0.718  Sum_probs=22.8

Q ss_pred             CCCCCCCE-EEEECCCCCHHHHHHHHHHHHC
Q ss_conf             52256835-8840733217699999998718
Q gi|254780271|r  109 VELAKSNI-LLVGPTGCGKTYLAQTLARIID  138 (424)
Q Consensus       109 ~ei~~~NI-LliGPTGvGKTelAr~LAk~l~  138 (424)
T Consensus        21 l~v~~Ge~~~iiGpSGsGKSTllr~i~Gl~~   51 (232)
T cd03300          21 LDIKEGEFFTLLGPSGCGKTTLLRLIAGFET   51 (232)
T ss_pred             EEECCCCEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             4887998999999999839999999977999