RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] (424 letters) >gnl|CDD|31412 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]. Length = 408 Score = 689 bits (1779), Expect = 0.0 Identities = 286/408 (70%), Positives = 342/408 (83%), Gaps = 2/408 (0%) Query: 18 SFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKSSIT-KSHEGIPNPQEILRVLD 76 SFCGKSQHEVRKLIAGP V+ICDEC+ELC DIIREE K ++ K +P P+EI LD Sbjct: 1 SFCGKSQHEVRKLIAGPGVYICDECIELCNDIIREELKEALDEKELSELPTPKEIKAHLD 60 Query: 77 EYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARI 136 EYVIGQ QAKKVL+VAV+NHYKRL + + +VEL+KSNILL+GPTG GKT LAQTLA+I Sbjct: 61 EYVIGQEQAKKVLSVAVYNHYKRLNNKEDNDDVELSKSNILLIGPTGSGKTLLAQTLAKI 120 Query: 137 IDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDN 196 ++VPF +ADATTLTEAGYVGEDVENI+LKLLQAADY+VERA+RGI+YIDE+DKI+RKS+N Sbjct: 121 LNVPFAIADATTLTEAGYVGEDVENILLKLLQAADYDVERAERGIIYIDEIDKIARKSEN 180 Query: 197 PSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLD 256 PSITRDVSGEGVQQALLKI+EGT+ASVPPQGGRKHPQQEF+QVDT+NILFICGGAFAGL+ Sbjct: 181 PSITRDVSGEGVQQALLKIIEGTVASVPPQGGRKHPQQEFIQVDTSNILFICGGAFAGLE 240 Query: 257 RIISARGEKASIGFSAVVKDSDN-RPVGEVLRNLESEDLVKFGLIPEFIGRLPVLATLED 315 +II R K IGF A VK + GE+L+ +E EDLVKFGLIPEFIGRLPV+ATLE+ Sbjct: 241 KIIKKRLGKKGIGFGAEVKSKSKKKEEGELLKQVEPEDLVKFGLIPEFIGRLPVIATLEE 300 Query: 316 LDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSIL 375 LDE++L++IL+EPKNAL+KQYQ LF+M+ VEL F E+AL+ IA+ AI KTGARGLRSI+ Sbjct: 301 LDEDALVQILTEPKNALVKQYQKLFEMDGVELEFTEEALKAIAKKAIERKTGARGLRSII 360 Query: 376 EKILLDTMFELPMLKGVSSVIISDDVVKGKACPLNVYTDRRDEKANVS 423 E++LLD MFELP L+ V V+I+++VV G A PL +Y EK Sbjct: 361 EELLLDVMFELPSLEDVEKVVITEEVVDGNAEPLLIYASPSKEKPKAK 408 >gnl|CDD|35964 KOG0745, KOG0745, KOG0745, Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]. Length = 564 Score = 442 bits (1137), Expect = e-124 Identities = 214/474 (45%), Positives = 289/474 (60%), Gaps = 69/474 (14%) Query: 2 SKASNNGSVSKNALYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKSSITKS 61 S A N S+S L C C SQ + FI +C + + + + S Sbjct: 62 SAAPGNKSLSGGGLQCPKCT-SQCTPLETFVSSQGFILCKCNKSFVVLYEADGAKPGKLS 120 Query: 62 HEG---------IPNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHS--------- 103 P P+EI LD++V+GQ +AKKVL+VAV+NHYKR+ H+ Sbjct: 121 PSNRDGGFQLKPPPTPKEICEYLDKFVVGQEKAKKVLSVAVYNHYKRIYHNEPSRQKELA 180 Query: 104 ------------------------------------SKSSNVELAKSNILLVGPTGCGKT 127 +VEL KSN+LL+GPTG GKT Sbjct: 181 EASKSAKDRDNPIELEISESNAQWPNNQRQIAKALDEDDEDVELEKSNVLLLGPTGSGKT 240 Query: 128 YLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEV 187 LAQTLAR++DVPF + D TTLT+AGYVGEDVE++I KLLQ A+YNVE+AQ+GIV++DEV Sbjct: 241 LLAQTLARVLDVPFAICDCTTLTQAGYVGEDVESVIQKLLQEAEYNVEKAQQGIVFLDEV 300 Query: 188 DKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTNILFI 247 DKI++K+++ +RDVSGEGVQQALLK++EGT+ +VP +G R+ P+ + +Q+DTTNILFI Sbjct: 301 DKITKKAESIHTSRDVSGEGVQQALLKLLEGTVVNVPEKGSRRKPRGDTVQIDTTNILFI 360 Query: 248 CGGAFAGLDRIISARGEKASIGFSAVVK-------------DSDNRPVGEVLRNLESEDL 294 GAF GLD+IIS R + S+GF A ++D E+L +ES DL Sbjct: 361 ASGAFVGLDKIISRRLDDKSLGFGAPSSKGVRANMATKSGVENDAEKRDELLEKVESGDL 420 Query: 295 VKFGLIPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDAL 354 + FG+IPEF+GR PVL L LDE+ L+R+L+EPKNAL KQY+ LF M++VEL F E AL Sbjct: 421 ISFGMIPEFVGRFPVLVPLHSLDEDQLVRVLTEPKNALGKQYKKLFGMDNVELHFTEKAL 480 Query: 355 REIARCAIAHKTGARGLRSILEKILLDTMFELPMLKGVSSVIISDDVVKGKACP 408 IA+ A+ KTGARGLRSILE +LL+ MFE+P + +V++ ++ VKG+ P Sbjct: 481 EAIAQLALKRKTGARGLRSILESLLLEAMFEVPG-SDIKAVLVDEEAVKGEKEP 533 >gnl|CDD|31413 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]. Length = 444 Score = 137 bits (346), Expect = 7e-33 Identities = 87/255 (34%), Positives = 118/255 (46%), Gaps = 60/255 (23%) Query: 165 KLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVP 224 ++ Q A E Q GIV+IDE+DKI+++ + DVS EGVQ+ LL ++EG+ S Sbjct: 239 EIKQEAIDAAE--QNGIVFIDEIDKIAKRGGSGG--PDVSREGVQRDLLPLVEGSTVST- 293 Query: 225 PQGGRKHPQQEFLQVDTTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDNRPVGE 284 ++ V T +ILFI GAF V K SD Sbjct: 294 ----------KYGPVKTDHILFIASGAF-------------------HVAKPSD------ 318 Query: 285 VLRNLESEDLVKFGLIPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMED 344 LIPE GR P+ L+ L + RIL+EPK +LIKQY+ L E Sbjct: 319 --------------LIPELQGRFPIRVELDALTKEDFERILTEPKASLIKQYKALLKTEG 364 Query: 345 VELVFHEDALREIARCAIA-----HKTGARGLRSILEKILLDTMFELPMLKGVSSVIISD 399 VEL F +DA++ IA A GAR L ++LE++L D FE P + G V I Sbjct: 365 VELEFTDDAIKRIAEIAYQVNEKTENIGARRLHTVLERLLEDISFEAPDMSG-QKVTIDA 423 Query: 400 DVVKGKACPLNVYTD 414 + V+ K L D Sbjct: 424 EYVEEKLGDLVANED 438 Score = 102 bits (255), Expect = 2e-22 Identities = 47/103 (45%), Positives = 70/103 (67%), Gaps = 1/103 (0%) Query: 68 PQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKT 127 P+EI+ LD Y+IGQ +AKK +A+A+ N ++R+ + + E+ NIL++GPTG GKT Sbjct: 6 PREIVSELDRYIIGQDEAKKAVAIALRNRWRRMQLEEELRD-EVTPKNILMIGPTGVGKT 64 Query: 128 YLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAA 170 +A+ LA++ PF +AT TE GYVG DVE+II L++ A Sbjct: 65 EIARRLAKLAGAPFIKVEATKFTEVGYVGRDVESIIRDLVEIA 107 >gnl|CDD|143797 pfam00004, AAA, ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes. Length = 131 Score = 71.5 bits (176), Expect = 4e-13 Identities = 30/103 (29%), Positives = 51/103 (49%), Gaps = 9/103 (8%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +LL GP G GKT LA+ +A+ + PF + L YVGE + + +L +AA + Sbjct: 1 LLLYGPPGTGKTTLAKAVAKELGAPFIEISGSELVS-KYVGESEKRLR-ELFEAA----K 54 Query: 176 RAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEG 218 + +++IDE+D ++ + D V LL ++G Sbjct: 55 KLAPCVIFIDEIDALAGSRGSGG---DSESRRVVNQLLTELDG 94 >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.. Length = 151 Score = 69.1 bits (169), Expect = 2e-12 Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 20/108 (18%) Query: 113 KSNILLVGPTGCGKTYLAQTLARII---DVPFTMADATTLTEAGYVGEDVENIILKLLQA 169 N+LL GP G GKT LA+ +A + PF +A+ L E V E + +++LL Sbjct: 19 PKNLLLYGPPGTGKTTLARAIANELFRPGAPFLYLNASDLLEGLVVAELFGHFLVRLLFE 78 Query: 170 ADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIME 217 E+A+ G+++IDE+D +SR G Q ALL+++E Sbjct: 79 L---AEKAKPGVLFIDEIDSLSR--------------GAQNALLRVLE 109 >gnl|CDD|30888 COG0542, ClpA, ATPases with chaperone activity, ATP-binding subunit [Posttranslational modification, protein turnover, chaperones]. Length = 786 Score = 63.4 bits (154), Expect = 1e-10 Identities = 72/354 (20%), Positives = 133/354 (37%), Gaps = 81/354 (22%) Query: 73 RVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSS-KSSNVELAKSNILLVGPTGCGKTYLAQ 131 R L + VIGQ +A + ++ A+ R A + N + + L +GPTG GKT LA+ Sbjct: 487 RRLKKRVIGQDEAVEAVSDAI-----RRARAGLGDPNRPIG--SFLFLGPTGVGKTELAK 539 Query: 132 TLARIIDVP------FTMA---DATTLTEA-----GYVGEDVENIILKLLQAADYNVERA 177 LA + M+ + +++ GYVG + + + V R Sbjct: 540 ALAEALFGDEQALIRIDMSEYMEKHSVSRLIGAPPGYVGYEEGGQLTEA-------VRRK 592 Query: 178 QRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIME-GTIASVPPQGGRKHPQQEF 236 ++ +DE++K V LL++++ G + GR Sbjct: 593 PYSVILLDEIEKAHPD--------------VFNLLLQVLDDGRLTD---GQGRT------ 629 Query: 237 LQVDTTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDN--RPVGEVLRNLESEDL 294 VD N + I ++ G +++D+D E L+ E+L Sbjct: 630 --VDFRNTIIIM----------------TSNAGSEEILRDADGDDFADKEALKEAVMEEL 671 Query: 295 VKFGLIPEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDAL 354 K PEF+ R+ + L + L RI+ + + + L ++A Sbjct: 672 KKH-FRPEFLNRIDEIIPFNPLSKEVLERIVD----LQLNRLAKRLAERGITLELSDEAK 726 Query: 355 REIARCAIAHKTGARGLRSILEKILLDTMFEL---PMLKGVSSVIISDDVVKGK 405 +A + GAR LR +++ + D + + ++ +V + D K K Sbjct: 727 DFLAEKGYDPEYGARPLRRAIQQEIEDPLADEILFGKIEDGGTVKVDVDDEKIK 780 Score = 43.0 bits (101), Expect = 2e-04 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 16/89 (17%) Query: 113 KSNILLVGPTGCGKTYLAQTLARII---DVPFTMADATTLT--------EAGYVGEDVEN 161 K+N +LVG G GKT + + LA+ I DVP ++ D + A Y GE E Sbjct: 191 KNNPVLVGEPGVGKTAIVEGLAQRIVNGDVPESLKDKRIYSLDLGSLVAGAKYRGE-FEE 249 Query: 162 IILKLLQAADYNVERAQRGIVYIDEVDKI 190 + +L+ VE+++ I++IDE+ I Sbjct: 250 RLKAVLKE----VEKSKNVILFIDEIHTI 274 >gnl|CDD|31058 COG0714, COG0714, MoxR-like ATPases [General function prediction only]. Length = 329 Score = 61.3 bits (148), Expect = 5e-10 Identities = 44/186 (23%), Positives = 74/186 (39%), Gaps = 36/186 (19%) Query: 68 PQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKT 127 +I L++ V+G + ++ +A+ LA ++LL GP G GKT Sbjct: 15 LGKIRSELEKVVVGDEEVIELALLAL-----------------LAGGHVLLEGPPGVGKT 57 Query: 128 YLAQTLARIIDVPFTMADAT-TLTEAGYVGEDVENIILKLLQAA---DYNVERAQRGIVY 183 LA+ LAR + +PF T L + +G +L + A R I+ Sbjct: 58 LLARALARALGLPFVRIQCTPDLLPSDLLGTYAYAALLLEPGEFRFVPGPLFAAVRVILL 117 Query: 184 IDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTN 243 +DE+++ + VQ ALL+ +E +VP + P F+ + T N Sbjct: 118 LDEINRAPPE--------------VQNALLEALEERQVTVPGLTTIRLPPP-FIVIATQN 162 Query: 244 ILFICG 249 G Sbjct: 163 PGEYEG 168 >gnl|CDD|30812 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]. Length = 494 Score = 57.5 bits (138), Expect = 7e-09 Identities = 31/103 (30%), Positives = 48/103 (46%), Gaps = 9/103 (8%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +LL GP G GKT LA+ +A F + L + +VGE +NI +A Sbjct: 279 VLLYGPPGTGKTLLAKAVALESRSRFISVKGSELL-SKWVGESEKNIRELFEKA-----R 332 Query: 176 RAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEG 218 + I++IDE+D ++ + D SG V LL ++G Sbjct: 333 KLAPSIIFIDEIDSLASGR---GPSEDGSGRRVVGQLLTELDG 372 >gnl|CDD|31416 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only]. Length = 368 Score = 56.1 bits (135), Expect = 2e-08 Identities = 52/180 (28%), Positives = 80/180 (44%), Gaps = 24/180 (13%) Query: 49 IIREENKSSITKSHEGI---PNPQEILR------VLDEYVIGQGQAKKVLAVAVHNHYKR 99 +IR + I P+E R LD+ VIGQ +AK+ + + + Sbjct: 85 VIRVVPSGGGIITSTTIFVLETPREEDREIISDITLDD-VIGQEEAKRKCRLIM----EY 139 Query: 100 LAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDV 159 L + + + A N+L GP G GKT +A+ LA VP + AT L +VG+ Sbjct: 140 LENPERFG--DWAPKNVLFYGPPGTGKTMMAKALANEAKVPLLLVKATELI-GEHVGDGA 196 Query: 160 ENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGT 219 I +L + A +A IV+IDE+D I+ + DVS + ALL ++G Sbjct: 197 RR-IHELYERA----RKAAPCIVFIDELDAIALDRRYQELRGDVS--EIVNALLTELDGI 249 >gnl|CDD|35952 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]. Length = 802 Score = 55.4 bits (133), Expect = 3e-08 Identities = 36/103 (34%), Positives = 49/103 (47%), Gaps = 9/103 (8%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +LL GP GCGKT LA +A + VPF A + +G GE + I QA Sbjct: 226 VLLHGPPGCGKTSLANAIAGELGVPFLSISAPEIV-SGVSGESEKKIRELFDQAK----- 279 Query: 176 RAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEG 218 IV+IDE+D I+ K + R++ V Q LL M+ Sbjct: 280 SNAPCIVFIDEIDAITPKREEAQ--REMERRIVAQ-LLTSMDE 319 Score = 37.3 bits (86), Expect = 0.009 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 11/108 (10%) Query: 112 AKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAAD 171 A S +LL GP GCGKT LA+ +A F L YVGE E + ++ Q A Sbjct: 544 APSGVLLCGPPGCGKTLLAKAVANEAGANFISVKGPELLNK-YVGES-ERAVRQVFQRAR 601 Query: 172 YNVERAQRGIVYIDEVDKI-SRKSDNPSITRDVSGEGVQQALLKIMEG 218 + +++ DE+D + R+SD S V LL ++G Sbjct: 602 ASAP----CVIFFDEIDALVPRRSDEGS----SVSSRVVNQLLTELDG 641 >gnl|CDD|35950 KOG0731, KOG0731, KOG0731, AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]. Length = 774 Score = 46.6 bits (110), Expect = 1e-05 Identities = 28/78 (35%), Positives = 38/78 (48%), Gaps = 6/78 (7%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +LLVGP G GKT LA+ +A VPF + E +VG + L A N Sbjct: 347 VLLVGPPGTGKTLLAKAIAGEAGVPFFSVSGSEFVE-MFVGVGASR-VRDLFPLARKNAP 404 Query: 176 RAQRGIVYIDEVDKISRK 193 I++IDE+D + RK Sbjct: 405 S----IIFIDEIDAVGRK 418 >gnl|CDD|35953 KOG0734, KOG0734, KOG0734, AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]. Length = 752 Score = 46.6 bits (110), Expect = 1e-05 Identities = 44/183 (24%), Positives = 72/183 (39%), Gaps = 19/183 (10%) Query: 22 KSQHEVRKLIAGPTVFICDECVELCMDIIREENKSSITKSHEGIPNPQEILRVLDEYVIG 81 K+ V+ + ++ + ++ T + +P+++ V E V G Sbjct: 249 KAGRLVKTIRTTIVGYLLLLGIYALLENTGLSGIFRSTTGLDSEVDPEQMKNVTFEDVKG 308 Query: 82 QGQAKKVLAVAVH-----NHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARI 136 +AK+ L V + RL +L K +LLVGP G GKT LA+ +A Sbjct: 309 VDEAKQELEEIVEFLKDPTKFTRLGG-------KLPKG-VLLVGPPGTGKTLLARAVAGE 360 Query: 137 IDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDN 196 VPF A + E +VG + L AA I++IDE+D + K + Sbjct: 361 AGVPFFYASGSEFDEM-FVGVGARR-VRDLFAAAKARAP----CIIFIDEIDAVGGKRNP 414 Query: 197 PSI 199 Sbjct: 415 SDQ 417 >gnl|CDD|32437 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]. Length = 436 Score = 46.4 bits (110), Expect = 1e-05 Identities = 30/108 (27%), Positives = 48/108 (44%), Gaps = 24/108 (22%) Query: 114 SNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYN 173 +++L GP G GKT LA+ +A + F A T +D+ II + A N Sbjct: 49 HSMILWGPPGTGKTTLARLIAGTTNAAFEALSAVTSGV-----KDLREII----EEARKN 99 Query: 174 VERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIME-GTI 220 +R I+++DE+ + ++ Q ALL +E GTI Sbjct: 100 RLLGRRTILFLDEIHRFNKAQ--------------QDALLPHVENGTI 133 >gnl|CDD|147593 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus. The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family contains the N-terminal region of the protein. Length = 234 Score = 44.4 bits (106), Expect = 7e-05 Identities = 36/124 (29%), Positives = 53/124 (42%), Gaps = 33/124 (26%) Query: 73 RVLDEYVIGQGQAKKVLAVAVHNHYKR---LAHSSKSSNVELAKSNILLVGPTGCGKTYL 129 R LDEY IGQ + K+ L + + KR L H +LL GP G GKT L Sbjct: 21 RRLDEY-IGQEKVKENLKIFIEAAKKRGEALDH-------------VLLYGPPGLGKTTL 66 Query: 130 AQTLARIIDVPFTMADATTLTEAG-YVGEDVENIILKLLQAADYNVERAQRGIVYIDEVD 188 A +A + V + L + G IL L+ D +++IDE+ Sbjct: 67 ANIIANEMGVNIRITSGPALEKPGDLAA------ILTNLEPGD---------VLFIDEIH 111 Query: 189 KISR 192 +++R Sbjct: 112 RLNR 115 >gnl|CDD|32436 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]. Length = 332 Score = 44.0 bits (104), Expect = 8e-05 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 25/120 (20%) Query: 73 RVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQT 132 + LDE+ IGQ + K+ L + + ++K L ++LL GP G GKT LA Sbjct: 23 KTLDEF-IGQEKVKEQLQIFIK--------AAKKRGEAL--DHVLLFGPPGLGKTTLAHI 71 Query: 133 LARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISR 192 +A + V + L + G D+ IL L+ D +++IDE+ ++S Sbjct: 72 IANELGVNLKITSGPALEKPG----DLAA-ILTNLEEGD---------VLFIDEIHRLSP 117 >gnl|CDD|35954 KOG0735, KOG0735, KOG0735, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]. Length = 952 Score = 43.9 bits (103), Expect = 9e-05 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 13/108 (12%) Query: 113 KSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADY 172 ++ ILL GP GCGKT LA +A ++ F L + Y+G +N+ +A Sbjct: 701 RTGILLYGPPGCGKTLLASAIASNSNLRFISVKGPELL-SKYIGASEQNVRDLFERAQS- 758 Query: 173 NVERAQRGIVYIDEVDKIS--RKSDNPSITRDVSGEGVQQALLKIMEG 218 A+ I++ DE D I+ R D+ +T V V Q LL ++G Sbjct: 759 ----AKPCILFFDEFDSIAPKRGHDSTGVTDRV----VNQ-LLTELDG 797 Score = 37.3 bits (86), Expect = 0.009 Identities = 34/142 (23%), Positives = 48/142 (33%), Gaps = 19/142 (13%) Query: 68 PQEILRVLD---EYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVE------LAKSNILL 118 P EI D + G + L ++ H S K N NILL Sbjct: 377 PLEIKITSDVNLPVLAGIKENSPDLVMSPFEHDFIQVPSYKKENANQELSPVFRHGNILL 436 Query: 119 VGPTGCGKTYLAQTLARIIDVP----FTMADATTLTEAGYVGEDVENIILKLLQAADYNV 174 GP G GKT L + L + +TL G +E I K L Sbjct: 437 NGPKGSGKTNLVKALFDYYSKDLIAHVEIVSCSTLD-----GSSLEK-IQKFLNNVFSEA 490 Query: 175 ERAQRGIVYIDEVDKISRKSDN 196 I+ +D++D ++ S N Sbjct: 491 LWYAPSIIVLDDLDCLASASSN 512 >gnl|CDD|35956 KOG0737, KOG0737, KOG0737, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]. Length = 386 Score = 43.7 bits (103), Expect = 1e-04 Identities = 30/90 (33%), Positives = 42/90 (46%), Gaps = 8/90 (8%) Query: 114 SNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYN 173 ILL GP G GKT LA+ +A+ F + LT + GE KL++A Sbjct: 128 KGILLYGPPGTGKTMLAKAIAKEAGANFINVSVSNLTSKWF-GEA-----QKLVKAVFSL 181 Query: 174 VERAQRGIVYIDEVDK--ISRKSDNPSITR 201 + Q I++IDEVD R+S + T Sbjct: 182 ASKLQPSIIFIDEVDSFLGQRRSTDHEATA 211 >gnl|CDD|35958 KOG0739, KOG0739, KOG0739, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]. Length = 439 Score = 41.9 bits (98), Expect = 4e-04 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 7/86 (8%) Query: 114 SNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYN 173 ILL GP G GK+YLA+ +A + F ++ L + ++GE E ++ L + A N Sbjct: 167 RGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLV-SKWMGES-EKLVKNLFEMAREN 224 Query: 174 VERAQRGIVYIDEVDKI-SRKSDNPS 198 + I++IDE+D + +S+N S Sbjct: 225 ----KPSIIFIDEIDSLCGSRSENES 246 >gnl|CDD|35960 KOG0741, KOG0741, KOG0741, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]. Length = 744 Score = 41.1 bits (96), Expect = 6e-04 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 9/106 (8%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDV--PFTMADATTLTEAGYVGEDVENIILKLLQAA--D 171 ILL GP G GKT +A+ + ++++ P + L + YVGE EN + KL A + Sbjct: 259 ILLYGPPGTGKTLIARQIGKMLNAREPKIVNGPEILNK--YVGESEEN-VRKLFADAEEE 315 Query: 172 YNVERAQRG--IVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKI 215 A G I+ DE+D I ++ + + + V V Q L K+ Sbjct: 316 QRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKM 361 Score = 31.1 bits (70), Expect = 0.56 Identities = 14/28 (50%), Positives = 17/28 (60%) Query: 114 SNILLVGPTGCGKTYLAQTLARIIDVPF 141 ++LL GP G GKT LA +A D PF Sbjct: 539 VSVLLEGPPGSGKTALAAKIALSSDFPF 566 >gnl|CDD|35957 KOG0738, KOG0738, KOG0738, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]. Length = 491 Score = 40.7 bits (95), Expect = 8e-04 Identities = 30/103 (29%), Positives = 50/103 (48%), Gaps = 8/103 (7%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +L+VGP G GKT LA+ +A F ++TLT + + GE E ++ L + A + Sbjct: 248 VLMVGPPGTGKTLLAKAVATECGTTFFNVSSSTLT-SKWRGES-EKLVRLLFEMARFYAP 305 Query: 176 RAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEG 218 ++IDE+D + + S + V+ LL M+G Sbjct: 306 ----STIFIDEIDSLCSQRGGSS--EHEASRRVKSELLVQMDG 342 >gnl|CDD|35959 KOG0740, KOG0740, KOG0740, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]. Length = 428 Score = 40.4 bits (94), Expect = 0.001 Identities = 31/82 (37%), Positives = 46/82 (56%), Gaps = 7/82 (8%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +LL GP G GKT LA+ +A F A++LT + YVGE KL++A Sbjct: 189 LLLFGPPGTGKTMLAKAIATESGATFFNISASSLT-SKYVGE-----SEKLVRALFKVAR 242 Query: 176 RAQRGIVYIDEVDKI-SRKSDN 196 Q +++IDE+D + S++SDN Sbjct: 243 SLQPSVIFIDEIDSLLSKRSDN 264 >gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI. Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa. Length = 207 Score = 40.6 bits (96), Expect = 0.001 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 23/61 (37%) Query: 79 VIGQGQAKKVLAVAV---HNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLAR 135 V GQ QAK+ L +A HN +L++GP G GKT LA+ L Sbjct: 5 VKGQEQAKRALEIAAAGGHN--------------------LLMIGPPGSGKTMLAKRLPG 44 Query: 136 I 136 I Sbjct: 45 I 45 >gnl|CDD|35946 KOG0727, KOG0727, KOG0727, 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]. Length = 408 Score = 40.0 bits (93), Expect = 0.001 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 6/103 (5%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +LL GP G GKT LA+ +A F + + Y+GE ++ + + A N Sbjct: 192 VLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK-YLGEG-PRMVRDVFRLAKENAP 249 Query: 176 RAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEG 218 I++IDE+D I+ K + D + + LL M+G Sbjct: 250 ----SIIFIDEIDAIATKRFDAQTGADREVQRILIELLNQMDG 288 >gnl|CDD|36269 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]. Length = 898 Score = 39.6 bits (92), Expect = 0.002 Identities = 64/329 (19%), Positives = 125/329 (37%), Gaps = 66/329 (20%) Query: 71 ILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLA 130 + L E VIGQ +A +A A+ +R K N + L +GP G GKT LA Sbjct: 556 LEERLHERVIGQDEAVAAIAAAI----RRSRAGLKDPNPDAW---FLFLGPDGVGKTELA 608 Query: 131 QTLARI----------IDVPFTMADATTL-TEAGYVGEDVENIILKLLQAADYNVERAQR 179 + LA +D+ + + + GYVG++ + + ++ Y+V Sbjct: 609 KALAEYVFGSEENFIRLDMSEFQEVSKLIGSPPGYVGKEEGGQLTEAVKRRPYSV----- 663 Query: 180 GIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIME-GTIASVPPQGGRKHPQQEFLQ 238 V +E++K + V LL++++ G + GR + Sbjct: 664 --VLFEEIEK--------------AHPDVLNILLQLLDRGRLTD---SHGR--------E 696 Query: 239 VDTTNILFICGGAFAGLDRIISARGEKASIGFSAVVKDSDNRPVGEVLRNLESEDLVKFG 298 VD N +FI + + + + D D + L+ ++ D V+ Sbjct: 697 VDFKNAIFI-------MTSNVGSSAIANDASLEEKLLDMDEKRGSYRLKKVQVSDAVRIY 749 Query: 299 LI----PEFIGRLPVLATLEDLDENSLIRILSEPKNALIKQYQCLFDMEDVELVFHEDAL 354 EF+ R+ L LD + LI I+++ + K+ + ++ L+ + Sbjct: 750 NKQFFRKEFLNRIDELDLNLPLDRDELIEIVNKQLTEIEKRLEE----RELLLLVTDRVD 805 Query: 355 REIARCAIAHKTGARGLRSILEKILLDTM 383 ++ GAR ++ +E+ + + Sbjct: 806 DKVLFKGYDFDYGARPIKRSIEERFENRL 834 >gnl|CDD|35870 KOG0651, KOG0651, KOG0651, 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]. Length = 388 Score = 39.2 bits (91), Expect = 0.002 Identities = 30/111 (27%), Positives = 50/111 (45%), Gaps = 8/111 (7%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +LL GP G GKT LA+ +A + V F ++ L Y+GE +L++ Sbjct: 169 LLLYGPPGTGKTLLARAVAATMGVNFLKVVSSAL-VDKYIGESA-----RLIRDMFRYAR 222 Query: 176 RAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEG--TIASVP 224 I+++DE+D I + + + D + LL M+G T+ V Sbjct: 223 EVIPCIIFMDEIDAIGGRRFSEGTSSDREIQRTLMELLNQMDGFDTLHRVK 273 >gnl|CDD|31415 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]. Length = 406 Score = 38.7 bits (90), Expect = 0.003 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 8/90 (8%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +LL GP G GKT LA+ +A D F + L + Y+GE ++ +L + A E Sbjct: 188 VLLYGPPGTGKTLLAKAVANQTDATFIRVVGSELVQK-YIGEGAR-LVRELFELAR---E 242 Query: 176 RAQRGIVYIDEVDKI--SRKSDNPSITRDV 203 +A I++IDE+D I R S R+V Sbjct: 243 KAP-SIIFIDEIDAIGAKRFDSGTSGDREV 271 >gnl|CDD|36209 KOG0991, KOG0991, KOG0991, Replication factor C, subunit RFC2 [Replication, recombination and repair]. Length = 333 Score = 38.0 bits (88), Expect = 0.005 Identities = 26/103 (25%), Positives = 40/103 (38%), Gaps = 14/103 (13%) Query: 115 NILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNV 174 N+++ GP G GKT LAR + L + G DV +K+ + Sbjct: 50 NLIISGPPGTGKTTSILCLARELLGDSYKEAVLELNASDERGIDVVRNKIKMFAQKKVTL 109 Query: 175 ERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIME 217 + I+ +DE D ++ G QQAL + ME Sbjct: 110 PPGRHKIIILDEADSMT--------------AGAQQALRRTME 138 >gnl|CDD|35955 KOG0736, KOG0736, KOG0736, Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]. Length = 953 Score = 37.7 bits (87), Expect = 0.006 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 6/103 (5%) Query: 113 KSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADY 172 +S ILL GP G GKT LA+ +A + F L YVG+ EN + ++ + A Sbjct: 705 RSGILLYGPPGTGKTLLAKAVATECSLNFLSVKGPELLNM-YVGQSEEN-VREVFERA-- 760 Query: 173 NVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKI 215 A +++ DE+D ++ + V V Q L ++ Sbjct: 761 --RSAAPCVIFFDELDSLAPNRGRSGDSGGVMDRVVSQLLAEL 801 Score = 30.3 bits (68), Expect = 1.1 Identities = 18/86 (20%), Positives = 31/86 (36%), Gaps = 6/86 (6%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +LL GP G GKT + + +A + + D L + LQA Sbjct: 434 VLLHGPPGSGKTTVVRAVASELGLHLLEVDCYELVAE------SASHTETKLQAIFSRAR 487 Query: 176 RAQRGIVYIDEVDKISRKSDNPSITR 201 R ++++ +D + D R Sbjct: 488 RCSPAVLFLRNLDVLGIDQDGGEDAR 513 >gnl|CDD|37239 KOG2028, KOG2028, KOG2028, ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]. Length = 554 Score = 37.7 bits (87), Expect = 0.006 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 5/78 (6%) Query: 115 NILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNV 174 +++L GP G GKT LA+ +A + T A DV +I QA + Sbjct: 164 SMILWGPPGTGKTTLARLIASTSKKHSYRFVELSATNAKT--NDVRDIF---EQAQNEKS 218 Query: 175 ERAQRGIVYIDEVDKISR 192 ++ I++IDE+ + ++ Sbjct: 219 LTKRKTILFIDEIHRFNK 236 >gnl|CDD|35699 KOG0478, KOG0478, KOG0478, DNA replication licensing factor, MCM4 component [Replication, recombination and repair]. Length = 804 Score = 37.3 bits (86), Expect = 0.009 Identities = 36/119 (30%), Positives = 52/119 (43%), Gaps = 14/119 (11%) Query: 112 AKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAG---YVGEDVENIILKLLQ 168 NILLVG G K+ L Q R++ + G YV +D + +L+ Sbjct: 461 GDINILLVGDPGTSKSQLLQYCHRLLP-RGVYTSGKGSSAVGLTAYVTKDPDT--RQLVL 517 Query: 169 AADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIME-GTIASVPPQ 226 + V + GI IDE DK+S TR V E ++Q L I + G IAS+ + Sbjct: 518 ESGALV-LSDNGICCIDEFDKMSDS------TRSVLHEVMEQQTLSIAKAGIIASLNAR 569 >gnl|CDD|177080 CHL00176, ftsH, cell division protein; Validated. Length = 638 Score = 37.0 bits (86), Expect = 0.009 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 10/80 (12%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTE--AGYVGEDVENIILKLLQAADYN 173 +LLVGP G GKT LA+ +A +VPF + E G V ++ K + + Sbjct: 219 VLLVGPPGTGKTLLAKAIAGEAEVPFFSISGSEFVEMFVGVGAARVRDLFKKAKENSPC- 277 Query: 174 VERAQRGIVYIDEVDKISRK 193 IV+IDE+D + R+ Sbjct: 278 -------IVFIDEIDAVGRQ 290 >gnl|CDD|35949 KOG0730, KOG0730, KOG0730, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]. Length = 693 Score = 37.2 bits (86), Expect = 0.010 Identities = 32/103 (31%), Positives = 46/103 (44%), Gaps = 9/103 (8%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +LL GP GCGKT LA+ LA + F L YVGE E I ++ + A Sbjct: 471 VLLYGPPGCGKTLLAKALANEAGMNFLSVKGPELFSK-YVGES-ERAIREVFRKA----R 524 Query: 176 RAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEG 218 + I++ DE+D ++ S + V LL M+G Sbjct: 525 QVAPCIIFFDEIDALAGSRGGSSSG---VTDRVLSQLLTEMDG 564 Score = 36.5 bits (84), Expect = 0.013 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 9/105 (8%) Query: 114 SNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYN 173 +LL GP G GKT+L + +A + + L + + GE N + K A Sbjct: 219 RGLLLYGPPGTGKTFLVRAVANEYGAFLFLINGPELI-SKFPGETESN-LRKAFAEAL-- 274 Query: 174 VERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEG 218 + I++IDE+D + K + DV V Q LL +++G Sbjct: 275 -KFQVPSIIFIDELDALCPKREG---ADDVESRVVSQ-LLTLLDG 314 >gnl|CDD|30813 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]. Length = 596 Score = 36.8 bits (85), Expect = 0.011 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 6/78 (7%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +LLVGP G GKT LA+ +A VPF + E +VG + QA + Sbjct: 186 VLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEM-FVGVGASRVRDLFEQA-----K 239 Query: 176 RAQRGIVYIDEVDKISRK 193 + I++IDE+D + R+ Sbjct: 240 KNAPCIIFIDEIDAVGRQ 257 >gnl|CDD|30672 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]. Length = 308 Score = 36.4 bits (84), Expect = 0.015 Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADA 146 I++ GPT GKT LA LA+ + D+ Sbjct: 6 IVIAGPTASGKTALAIALAKRLGGEIISLDS 36 >gnl|CDD|35698 KOG0477, KOG0477, KOG0477, DNA replication licensing factor, MCM2 component [Replication, recombination and repair]. Length = 854 Score = 36.1 bits (83), Expect = 0.019 Identities = 45/208 (21%), Positives = 85/208 (40%), Gaps = 25/208 (12%) Query: 44 ELCMDIIREENKSSITKSHEGIPNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHS 103 + +D + +E+ I + + P + I+ + + G K+ +A+A+ + + + Sbjct: 416 KFDVDELTDEDFKEIWELSKDPPIKERIIASIAPSIYGHEDVKRAVALAL---FGGVPKN 472 Query: 104 SKSSNVELAKSNILLVGPTGCGKT----YLAQTLARIIDVPFTMADATTLTEAGYVGEDV 159 + N+LL+G G K+ Y +T R + FT + G Sbjct: 473 PGGKHKVRGDINVLLLGDPGTAKSQFLKYAEKTSPRAV---FTTGQGAS--AVGLTAYVR 527 Query: 160 ENIILK--LLQAADYNVERAQRGIVYIDEVDKISRKSDNPSI-------TRDVSGEGVQQ 210 ++ + + L+A + A +G+ IDE DK+ D SI + +S G+ Sbjct: 528 KDPVTREWTLEAGALVL--ADKGVCLIDEFDKM-NDQDRTSIHEAMEQQSISISKAGI-V 583 Query: 211 ALLKIMEGTIASVPPQGGRKHPQQEFLQ 238 L+ IA+ P GGR +P F Q Sbjct: 584 TSLQARCTVIAAANPIGGRYNPSLTFAQ 611 >gnl|CDD|177027 CHL00095, clpC, Clp protease ATP binding subunit. Length = 821 Score = 35.8 bits (83), Expect = 0.021 Identities = 29/97 (29%), Positives = 44/97 (45%), Gaps = 16/97 (16%) Query: 48 DIIREENKSSITKSHEGIPNPQ----------EILRVLDEYVIGQGQAKKVLAVAVHNHY 97 ++ EE+ + I + GIP + + L + +IGQ +A VAV Sbjct: 470 PVVTEEDIAEIVSAWTGIPVNKLTKSESEKLLHMEETLHKRIIGQDEA----VVAVSKAI 525 Query: 98 KRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLA 134 +R K+ N +A + L GPTG GKT L + LA Sbjct: 526 RRARVGLKNPNRPIA--SFLFSGPTGVGKTELTKALA 560 Score = 35.8 bits (83), Expect = 0.023 Identities = 29/88 (32%), Positives = 41/88 (46%), Gaps = 20/88 (22%) Query: 113 KSNILLVGPTGCGKTYLAQTLARII---DVPFTMAD--------ATTLTEAGYVGEDVEN 161 K+N +L+G G GKT +A+ LA+ I DVP + D L Y GE E Sbjct: 200 KNNPILIGEPGVGKTAIAEGLAQRIVNRDVPDILEDKLVITLDIGLLLAGTKYRGEFEER 259 Query: 162 I--ILKLLQAADYNVERAQRGIVYIDEV 187 + I +Q + N+ I+ IDEV Sbjct: 260 LKRIFDEIQENN-NI------ILVIDEV 280 >gnl|CDD|32641 COG2812, DnaX, DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]. Length = 515 Score = 35.8 bits (82), Expect = 0.025 Identities = 36/155 (23%), Positives = 61/155 (39%), Gaps = 44/155 (28%) Query: 79 VIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLAR--- 135 V+GQ K L+ A+ N R+AH+ L GP G GKT +A+ LA+ Sbjct: 18 VVGQEHVVKTLSNALEN--GRIAHA------------YLFSGPRGVGKTTIARILAKALN 63 Query: 136 ----IIDVPFTMADATTLTEAGYVGEDVE---------NIILKLLQAADYNVERAQRGIV 182 P + G + + +E + I ++++ +Y + + Sbjct: 64 CENGPTAEPCGKCISCKEINEGSLIDVIEIDAASNTGVDDIREIIEKVNYAPSEGRYKVY 123 Query: 183 YIDEVDKISRKSDNPSITRDVSGEGVQQALLKIME 217 IDEV +S+++ N ALLK +E Sbjct: 124 IIDEVHMLSKQAFN--------------ALLKTLE 144 >gnl|CDD|30188 cd00464, SK, Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.. Length = 154 Score = 35.6 bits (82), Expect = 0.026 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Query: 115 NILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNV 174 NI+L+G G GKT + + LA+ + +PF D L E G + I + + + Sbjct: 1 NIVLIGMMGAGKTTVGRLLAKALGLPFV--DLDELIEQ-RAGMSIPEIFAEEGEEGFREL 57 Query: 175 ER 176 ER Sbjct: 58 ER 59 >gnl|CDD|35948 KOG0729, KOG0729, KOG0729, 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]. Length = 435 Score = 35.7 bits (82), Expect = 0.027 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 8/76 (10%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +LL GP G GKT A+ +A D F + L + YVGE ++ +L + A Sbjct: 214 VLLYGPPGTGKTLCARAVANRTDACFIRVIGSELVQK-YVGEGAR-MVRELFEMA----- 266 Query: 176 RAQRG-IVYIDEVDKI 190 R ++ I++ DE+D I Sbjct: 267 RTKKACIIFFDEIDAI 282 >gnl|CDD|31417 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription]. Length = 450 Score = 35.6 bits (82), Expect = 0.029 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 12/66 (18%) Query: 79 VIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARII- 137 ++GQ +A++ V V ++ K +A IL+VGP G GKT LA +AR + Sbjct: 41 LVGQEEAREAAGVIV-----KMIKQGK-----MAGRGILIVGPPGTGKTALAMGIARELG 90 Query: 138 -DVPFT 142 DVPF Sbjct: 91 EDVPFV 96 >gnl|CDD|144489 pfam00910, RNA_helicase, RNA helicase. This family includes RNA helicases thought to be involved in duplex unwinding during viral RNA replication. Members of this family are found in a variety of single stranded RNA viruses. Length = 105 Score = 35.3 bits (82), Expect = 0.032 Identities = 13/22 (59%), Positives = 16/22 (72%) Query: 116 ILLVGPTGCGKTYLAQTLARII 137 I L GP GCGK+ LA+ LAR + Sbjct: 1 IWLYGPPGCGKSTLAKYLARAL 22 >gnl|CDD|30814 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]. Length = 782 Score = 35.1 bits (81), Expect = 0.037 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 14/91 (15%) Query: 110 ELAKSNILLVGPTGCGKTYLAQTLARIIDVPFT-MADATTLTEA-------GYVGEDVEN 161 +L + LVGP G GKT L +++A+ + F ++ EA Y+G Sbjct: 347 KLKGPILCLVGPPGVGKTSLGKSIAKALGRKFVRISLGGVRDEAEIRGHRRTYIGAMPGK 406 Query: 162 IILKLLQAADYNVERAQRGIVYIDEVDKISR 192 II + +A N + +DE+DK+ Sbjct: 407 IIQGMKKAGVKN------PVFLLDEIDKMGS 431 Score = 28.6 bits (64), Expect = 3.7 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 1/75 (1%) Query: 329 KNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEKILLDTMFELPM 388 K LI + ++ EL ++A+++I R + G R L + KI ++ + Sbjct: 505 KRHLIPKQLKEHGLKKGELTITDEAIKDIIR-YYTREAGVRNLEREIAKICRKAAKKILL 563 Query: 389 LKGVSSVIISDDVVK 403 K S V I + +K Sbjct: 564 KKEKSIVKIDEKNLK 578 >gnl|CDD|30951 COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]. Length = 490 Score = 35.2 bits (81), Expect = 0.040 Identities = 31/109 (28%), Positives = 43/109 (39%), Gaps = 22/109 (20%) Query: 30 LIAGPTVFICDECVELCMDIIREENKSSITKSHEGIPNPQEILRVLDEYVIGQGQAKKVL 89 LI G V+ E+ + + + + I E I + D V GQ QAK+ L Sbjct: 135 LIGGLPVYGARYLEEVV-NFLEGKLRLPIPIPSEVIESFSLAPDFKD--VKGQEQAKRAL 191 Query: 90 AVAVH-NHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARII 137 +A H N+LLVGP G GKT LA L ++ Sbjct: 192 EIAAAGGH------------------NLLLVGPPGTGKTMLASRLPGLL 222 >gnl|CDD|35945 KOG0726, KOG0726, KOG0726, 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]. Length = 440 Score = 34.9 bits (80), Expect = 0.041 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 6/78 (7%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 ++L G G GKT LA+ +A F + L + Y+G D ++ +L + A+ + Sbjct: 222 VILYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQK-YLG-DGPKLVRELFRVAEEHAP 279 Query: 176 RAQRGIVYIDEVDKISRK 193 IV+IDE+D I K Sbjct: 280 ----SIVFIDEIDAIGTK 293 >gnl|CDD|31414 COG1221, PspF, Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]. Length = 403 Score = 34.6 bits (79), Expect = 0.052 Identities = 18/81 (22%), Positives = 33/81 (40%), Gaps = 9/81 (11%) Query: 115 NILLVGPTGCGKTYLAQTL----ARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAA 170 +L++G TG GK A+ + AR + PF + +E ++ A Sbjct: 103 PVLIIGETGTGKELFARLIHALSARRAEAPFIAFNCAAYSENL-QEAELFGHEKGAFTGA 161 Query: 171 DYN----VERAQRGIVYIDEV 187 E+A G +++DE+ Sbjct: 162 QGGKAGLFEQANGGTLFLDEI 182 >gnl|CDD|35871 KOG0652, KOG0652, KOG0652, 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]. Length = 424 Score = 34.6 bits (79), Expect = 0.055 Identities = 29/118 (24%), Positives = 53/118 (44%), Gaps = 10/118 (8%) Query: 100 LAHSSKSSNVEL-AKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGED 158 + H K N+ + +L+ GP G GKT +A+ A + F L + ++G+ Sbjct: 191 MTHKEKFENLGIRPPKGVLMYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQM-FIGDG 249 Query: 159 VENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIM 216 KL++ A + I++IDE+D I K + D VQ+ +L+++ Sbjct: 250 A-----KLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKAGD---REVQRTMLELL 299 >gnl|CDD|31047 COG0703, AroK, Shikimate kinase [Amino acid transport and metabolism]. Length = 172 Score = 34.4 bits (79), Expect = 0.060 Identities = 12/34 (35%), Positives = 21/34 (61%) Query: 113 KSNILLVGPTGCGKTYLAQTLARIIDVPFTMADA 146 NI+L+G G GK+ + + LA+ +++PF D Sbjct: 2 NMNIVLIGFMGAGKSTIGRALAKALNLPFIDTDQ 35 >gnl|CDD|35961 KOG0742, KOG0742, KOG0742, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]. Length = 630 Score = 33.9 bits (77), Expect = 0.091 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 13/119 (10%) Query: 88 VLAVAVHNHYKRLAHSSKSSNVELAKS---NILLVGPTGCGKTYLAQTLARIIDVPFTMA 144 +L ++ + LA ++ +N + ++ NIL GP G GKT A+ LAR + + + Sbjct: 358 ILHPSLEKRIEDLAIAT--ANTKKHQAPFRNILFYGPPGTGKTMFARELARHSGLDYAI- 414 Query: 145 DATTLTEAGYVGEDVENIILKLLQAADYNVERAQRG-IVYIDEVDKISRKSDNPSITRD 202 T + +G I KL A ++++RG +++IDE D + + ++ Sbjct: 415 --MTGGDVAPLGAQAVTKIHKLFDWA----KKSRRGLLLFIDEADAFLCERNKTYMSEA 467 >gnl|CDD|35947 KOG0728, KOG0728, KOG0728, 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]. Length = 404 Score = 33.4 bits (76), Expect = 0.12 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 17/105 (16%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 +LL GP G GKT LA+ +A D F + L + Y+GE + + A ++ Sbjct: 184 VLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQK-YIGEGSRMVRELFVMAREH--- 239 Query: 176 RAQRGIVYIDEVDKISRKSDNPSITRDVSGEG----VQQALLKIM 216 I+++DE+D I +R SG G VQ+ +L+++ Sbjct: 240 --APSIIFMDEIDSIGS-------SRVESGSGGDSEVQRTMLELL 275 >gnl|CDD|110677 pfam01695, IstB, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function. Length = 178 Score = 33.4 bits (77), Expect = 0.13 Identities = 12/24 (50%), Positives = 15/24 (62%) Query: 112 AKSNILLVGPTGCGKTYLAQTLAR 135 N+LL+GP G GKT+LA L Sbjct: 46 QAENLLLLGPPGVGKTHLACALGH 69 >gnl|CDD|33644 COG3854, SpoIIIAA, ncharacterized protein conserved in bacteria [Function unknown]. Length = 308 Score = 33.4 bits (76), Expect = 0.13 Identities = 10/29 (34%), Positives = 17/29 (58%) Query: 109 VELAKSNILLVGPTGCGKTYLAQTLARII 137 + N L++GP GKT L + +AR++ Sbjct: 133 YQNGWLNTLIIGPPQVGKTTLLRDIARLL 161 >gnl|CDD|147726 pfam05729, NACHT, NACHT domain. This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931. Length = 165 Score = 33.4 bits (77), Expect = 0.13 Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 116 ILLVGPTGCGKTYLAQTLARII 137 ++L G G GKT L Q LA + Sbjct: 3 VILQGEAGSGKTTLLQKLALLW 24 >gnl|CDD|36646 KOG1433, KOG1433, KOG1433, DNA repair protein RAD51/RHP55 [Replication, recombination and repair]. Length = 326 Score = 33.1 bits (75), Expect = 0.13 Identities = 23/76 (30%), Positives = 29/76 (38%), Gaps = 10/76 (13%) Query: 117 LLVGPTGCGKTYLAQTLAR----------IIDVPFTMADATTLTEAGYVGEDVENIILKL 166 LVGP G GKT L TLA ID T AG G + + L Sbjct: 115 ELVGPPGSGKTQLCHTLAVTCGGGEGKVLYIDTESTFRLERLTEIAGRSGLRGRDTLSNL 174 Query: 167 LQAADYNVERAQRGIV 182 + A YN++ + I Sbjct: 175 MLARAYNLDHQLQLIQ 190 >gnl|CDD|37381 KOG2170, KOG2170, KOG2170, ATPase of the AAA+ superfamily [General function prediction only]. Length = 344 Score = 32.6 bits (74), Expect = 0.20 Identities = 29/134 (21%), Positives = 52/134 (38%), Gaps = 19/134 (14%) Query: 66 PNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCG 125 + + + L + GQ AK+++ A+ +H+ + K L S G TG G Sbjct: 71 NDLDGLEKDLARALFGQHLAKQLVVNALKSHW-ANPNPRKP----LVLS---FHGWTGTG 122 Query: 126 KTYLAQTLARIIDVPFTMADATTLTEAGYVG-------EDVENIILKLLQAADYNVERAQ 178 K Y+A+ +A + + +V +E+ +L V+ Q Sbjct: 123 KNYVAEIIAENLYRGGLRSPFVHH----FVATLHFPHASKIEDYKEELKNRVRGTVQACQ 178 Query: 179 RGIVYIDEVDKISR 192 R + DEVDK+ Sbjct: 179 RSLFIFDEVDKLPP 192 >gnl|CDD|31564 COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only]. Length = 398 Score = 32.7 bits (74), Expect = 0.21 Identities = 19/84 (22%), Positives = 34/84 (40%), Gaps = 12/84 (14%) Query: 109 VELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQ 168 ++L IL++GP GKT L + L + + +D+ ++LL Sbjct: 33 LDLRPFIILILGPRQVGKTTLLKLLIKGLLEEI----------IYINFDDLRLDRIELLD 82 Query: 169 AADYNVERAQRGIVYI--DEVDKI 190 +E +R YI DE+ + Sbjct: 83 LLRAYIELKEREKSYIFLDEIQNV 106 >gnl|CDD|38557 KOG3347, KOG3347, KOG3347, Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]. Length = 176 Score = 32.5 bits (74), Expect = 0.22 Identities = 12/35 (34%), Positives = 19/35 (54%) Query: 107 SNVELAKSNILLVGPTGCGKTYLAQTLARIIDVPF 141 + E + NIL+ G G GK+ LA+ LA + + Sbjct: 1 AEPERERPNILVTGTPGTGKSTLAERLAEKTGLEY 35 >gnl|CDD|37215 KOG2004, KOG2004, KOG2004, Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]. Length = 906 Score = 32.6 bits (74), Expect = 0.23 Identities = 37/143 (25%), Positives = 60/143 (41%), Gaps = 34/143 (23%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAG--------YVGEDVENII--LK 165 + VGP G GKT +A+++AR ++ F +T+ YVG II LK Sbjct: 441 LCFVGPPGVGKTSIAKSIARALNRKFFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLK 500 Query: 166 LLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPP 225 ++ + ++ IDEVDK+ D + ALL++++ P Sbjct: 501 KVKTEN--------PLILIDEVDKLGS-----GHQGDPAS-----ALLELLD------PE 536 Query: 226 QGGRKHPQQEFLQVDTTNILFIC 248 Q + VD + +LFIC Sbjct: 537 QNANFLDHYLDVPVDLSKVLFIC 559 >gnl|CDD|145608 pfam02562, PhoH, PhoH-like protein. PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation. Length = 205 Score = 32.4 bits (75), Expect = 0.23 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Query: 109 VELAKSN--ILLVGPTGCGKTYLAQTLA 134 VE + N + +GP G GKTYLA A Sbjct: 13 VEAIRKNDIVFGIGPAGTGKTYLAVAAA 40 >gnl|CDD|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]. Length = 268 Score = 32.5 bits (74), Expect = 0.25 Identities = 16/70 (22%), Positives = 30/70 (42%), Gaps = 12/70 (17%) Query: 70 EILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNIL-LVGPTGCGKTY 128 E+ + + +G+G KK AV + + + L LVG +GCGK+ Sbjct: 6 EVKNLKKYFPVGKGFGKKRYVKAVDG-----------VSFSIKEGETLGLVGESGCGKST 54 Query: 129 LAQTLARIID 138 L + + + + Sbjct: 55 LGRLILGLEE 64 >gnl|CDD|30909 COG0563, Adk, Adenylate kinase and related kinases [Nucleotide transport and metabolism]. Length = 178 Score = 32.2 bits (73), Expect = 0.26 Identities = 12/26 (46%), Positives = 19/26 (73%) Query: 115 NILLVGPTGCGKTYLAQTLARIIDVP 140 IL++GP G GK+ LA+ LA+ + +P Sbjct: 2 RILILGPPGAGKSTLAKKLAKKLGLP 27 >gnl|CDD|34592 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]. Length = 573 Score = 32.1 bits (73), Expect = 0.29 Identities = 9/24 (37%), Positives = 14/24 (58%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDV 139 + ++G +G GK+ L Q LA D Sbjct: 367 VAILGRSGSGKSTLLQLLAGAWDP 390 >gnl|CDD|73019 cd03260, ABC_PstB_phosphate_transporter, Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).. Length = 227 Score = 32.1 bits (73), Expect = 0.31 Identities = 11/22 (50%), Positives = 17/22 (77%) Query: 118 LVGPTGCGKTYLAQTLARIIDV 139 L+GP+GCGK+ L + L R+ D+ Sbjct: 31 LIGPSGCGKSTLLRLLNRLNDL 52 >gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]. Length = 539 Score = 32.1 bits (73), Expect = 0.33 Identities = 15/81 (18%), Positives = 32/81 (39%), Gaps = 9/81 (11%) Query: 66 PNPQEILRVLDEYVIGQGQAKKVLAVAVH--------NHYKRLAHSSKSSNVELAKSNIL 117 ++I+R+ + V ++ + + + +L + L Sbjct: 261 LGDEKIIRLPRRGPLRAEPLLSVRNLSKRYGSRKGLFVRERGEVKAVDDVSFDLREGETL 320 Query: 118 -LVGPTGCGKTYLAQTLARII 137 LVG +G GK+ LA+ LA ++ Sbjct: 321 GLVGESGSGKSTLARILAGLL 341 Score = 29.4 bits (66), Expect = 1.9 Identities = 13/51 (25%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Query: 89 LAVAVHNHYKRLAHSSKSSNVELAKSNIL-LVGPTGCGKTYLAQTLARIID 138 L V + + + E+ IL +VG +G GK+ LA L ++ Sbjct: 11 LTVEFA-TDGGRVPAVRDVSFEVEPGEILGIVGESGSGKSTLALALMGLLP 60 >gnl|CDD|33396 COG3596, COG3596, Predicted GTPase [General function prediction only]. Length = 296 Score = 31.9 bits (72), Expect = 0.33 Identities = 13/52 (25%), Positives = 19/52 (36%) Query: 97 YKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATT 148 + L E N+LL+G TG GK+ L L + + T Sbjct: 23 ERILEQLRMLQLTEKEPVNVLLMGATGAGKSSLINALFQGEVKEVSKVGVGT 74 >gnl|CDD|143926 pfam00158, Sigma54_activat, Sigma-54 interaction domain. Length = 168 Score = 32.0 bits (74), Expect = 0.34 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 15/56 (26%) Query: 79 VIGQGQA-KKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTL 133 +IG+ A ++VL +A KR+A + + +L+ G +G GK A+ + Sbjct: 1 LIGESPAMQEVLELA-----KRVAPTD---------ATVLITGESGTGKELFARAI 42 >gnl|CDD|133370 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group contains only bacterial members. Length = 268 Score = 31.8 bits (73), Expect = 0.34 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Query: 115 NILLVGPTGCGKTYLAQTL---ARIIDVPFTMADATTLT 150 NI LVG +G GKT LA+ L ID ++ D TT++ Sbjct: 1 NIALVGHSGSGKTTLAEALLYATGAIDRLGSVEDGTTVS 39 >gnl|CDD|30793 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]. Length = 316 Score = 31.7 bits (72), Expect = 0.36 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 108 NVELAKSNIL-LVGPTGCGKTYLAQTLARIIDVP 140 + EL K IL +VG +G GK+ LA+ + ++ P Sbjct: 25 SFELKKGEILGIVGESGSGKSVLAKAIMGLLPKP 58 >gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 171 Score = 31.9 bits (73), Expect = 0.37 Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDV 139 + +VGP+G GK+ L + L R+ D Sbjct: 31 VAIVGPSGSGKSTLLKLLLRLYDP 54 >gnl|CDD|34241 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]. Length = 580 Score = 31.7 bits (72), Expect = 0.39 Identities = 21/74 (28%), Positives = 29/74 (39%), Gaps = 16/74 (21%) Query: 65 IPNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNIL-LVGPTG 123 +P PQ L V GQ K +L K + L L ++GP+G Sbjct: 328 LPAPQGALSVERLTAAPPGQKKPIL---------------KGISFALQAGEALGIIGPSG 372 Query: 124 CGKTYLAQTLARII 137 GK+ LA+ L I Sbjct: 373 SGKSTLARLLVGIW 386 >gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1228 Score = 31.7 bits (72), Expect = 0.39 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 14/60 (23%) Query: 112 AKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYV---GEDVENIILKLLQ 168 + + LVGP+G GK+ L Q LAR D +G V GED+ N+ LK L+ Sbjct: 378 SGQTVALVGPSGSGKSTLIQLLARFYDP-----------TSGEVLIDGEDIRNLNLKWLR 426 Score = 28.3 bits (63), Expect = 4.6 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 22/68 (32%) Query: 118 LVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYV---GEDVENIILKLLQAADYNV 174 LVGP+G GK+ + L R D AG V G D++++ LK L Sbjct: 1021 LVGPSGSGKSTVISLLERFYDPD-----------AGKVKIDGVDIKDLNLKWL------- 1062 Query: 175 ERAQRGIV 182 R Q G+V Sbjct: 1063 -RKQIGLV 1069 >gnl|CDD|146043 pfam03215, Rad17, Rad17 cell cycle checkpoint protein. Length = 490 Score = 31.5 bits (71), Expect = 0.43 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Query: 91 VAVHNH-YKRLAHSSKSSNVELAKSNILLV-GPTGCGKTYLAQTLARI 136 +A+H + H K+ +E K ILL+ GP+GCGK+ + L++ Sbjct: 21 LAIHKKKIAEVDHWLKAVFLESNKQLILLLTGPSGCGKSTTVKVLSKE 68 >gnl|CDD|73174 COG0470, HolB, ATPase involved in DNA replication [DNA replication, recombination, and repair]. Length = 325 Score = 31.5 bits (70), Expect = 0.43 Identities = 37/162 (22%), Positives = 55/162 (33%), Gaps = 48/162 (29%) Query: 76 DEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLAR 135 DE V Q K++L A+ RL H +L GP G GKT A LA+ Sbjct: 1 DELVPWQEAVKRLLVQALE--SGRLPH------------ALLFYGPPGVGKTTAALALAK 46 Query: 136 II-------DVPFTMADATTLTEAG-------------YVGEDVENIILKLLQAADYNVE 175 + +P + L AG + + + +L + + Sbjct: 47 ELLCENPTGLLPCGHCRSCKLIPAGNHPDFLELNPSDLRKIDIIVEQVRELAEFLSESPL 106 Query: 176 RAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIME 217 +V IDE DK++ E ALLK +E Sbjct: 107 EGGYKVVIIDEADKLT--------------EDAANALLKTLE 134 >gnl|CDD|147155 pfam04851, ResIII, Type III restriction enzyme, res subunit. Length = 103 Score = 31.4 bits (72), Expect = 0.44 Identities = 11/27 (40%), Positives = 13/27 (48%) Query: 111 LAKSNILLVGPTGCGKTYLAQTLARII 137 L K L+V TG GKT A L + Sbjct: 16 LEKKRGLIVMATGSGKTLTAAKLIARL 42 >gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]. Length = 252 Score = 31.4 bits (71), Expect = 0.44 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Query: 93 VHNHYKRLAHSSKSSNVELAKSNIL-LVGPTGCGKTYLAQTLA 134 V+ K H+ + ++E+ + L +VG +G GK+ LA+ LA Sbjct: 12 VYGGGKFAFHALNNVSLEIERGETLGIVGESGSGKSTLARLLA 54 >gnl|CDD|32595 COG2603, COG2603, Predicted ATPase [General function prediction only]. Length = 334 Score = 31.5 bits (71), Expect = 0.44 Identities = 14/31 (45%), Positives = 20/31 (64%) Query: 110 ELAKSNILLVGPTGCGKTYLAQTLARIIDVP 140 E+A+ + +L G TGCGKT L + L ID+ Sbjct: 137 EIAQKDFILCGCTGCGKTELVEQLPNAIDLE 167 >gnl|CDD|33631 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]. Length = 338 Score = 31.4 bits (71), Expect = 0.46 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 5/34 (14%) Query: 105 KSSNVELAKSNIL-LVGPTGCGKTYLAQTLARII 137 K N+++ + L+GP+GCGK+ TL R+I Sbjct: 20 KDVNLDIEDGEFVVLLGPSGCGKS----TLLRMI 49 >gnl|CDD|30194 cd02021, GntK, Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.. Length = 150 Score = 31.4 bits (71), Expect = 0.50 Identities = 10/31 (32%), Positives = 18/31 (58%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADA 146 I+++G +G GK+ + + LA + PF D Sbjct: 2 IVVMGVSGSGKSTVGKALAERLGAPFIDGDD 32 >gnl|CDD|31314 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 253 Score = 31.3 bits (71), Expect = 0.58 Identities = 15/39 (38%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Query: 102 HSSKSSNVELAKSNIL-LVGPTGCGKTYLAQTLARIIDV 139 H+ K N+++ K+ + L+GP+GCGK+ L + L R+ D+ Sbjct: 21 HALKDINLDIPKNKVTALIGPSGCGKSTLLRCLNRMNDL 59 >gnl|CDD|34177 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 259 Score = 31.0 bits (70), Expect = 0.60 Identities = 10/32 (31%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 108 NVELAKSNIL-LVGPTGCGKTYLAQTLARIID 138 ++ +A ++ ++GP+GCGKT L +A + Sbjct: 25 SLTIASGELVVVLGPSGCGKTTLLNLIAGFVT 56 >gnl|CDD|34868 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]. Length = 4600 Score = 31.2 bits (70), Expect = 0.61 Identities = 25/102 (24%), Positives = 40/102 (39%), Gaps = 6/102 (5%) Query: 111 LAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENII------L 164 + K +LLVG TGCGKT Q LA + +A TE G + + Sbjct: 1171 VTKEPVLLVGETGCGKTTGCQVLADTFRRELNLMNAHQETENGDIIGAQRPVRNRSETGY 1230 Query: 165 KLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGE 206 L +A D + + + E+ + SDN +++ Sbjct: 1231 GLTKALDIASNVFKTRDIDLIEMHRGISSSDNDNLSFIGESF 1272 Score = 28.9 bits (64), Expect = 2.6 Identities = 22/94 (23%), Positives = 37/94 (39%), Gaps = 13/94 (13%) Query: 49 IIREENKSSITKSHEGIPNPQEILRVLDEYVIGQG------QAKKVLAVAVHNHYKRLAH 102 + E++++I K +P+ I Y G Q ++ V +Y Sbjct: 825 LGLLESQNAIEKQKPKVPDHSYI--AFCHYWKHGGSFPVEEQEHYIITPFVQKNYLNTMR 882 Query: 103 SSKSSNVELAKSNILLVGPTGCGKTYLAQTLARI 136 ++ SN +L+ GPT GKT + LAR Sbjct: 883 AASLSNFP-----LLIQGPTSSGKTSMILYLARE 911 Score = 28.5 bits (63), Expect = 3.5 Identities = 15/38 (39%), Positives = 20/38 (52%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAG 153 LLVG TG GKT + Q LA + T+ + + TE Sbjct: 467 TLLVGETGTGKTTMIQYLALKLHFKLTVINKSQQTEMS 504 >gnl|CDD|35283 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism, General function prediction only]. Length = 659 Score = 31.0 bits (70), Expect = 0.66 Identities = 11/22 (50%), Positives = 15/22 (68%) Query: 113 KSNILLVGPTGCGKTYLAQTLA 134 N+L+ GP+GCGKT L + L Sbjct: 461 GQNLLITGPSGCGKTSLLRVLG 482 >gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 157 Score = 31.0 bits (70), Expect = 0.71 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 108 NVELAKSNIL-LVGPTGCGKTYLAQTLARIIDVP 140 ++ L I+ LVGP G GK+ L + +A ++ Sbjct: 19 SLTLKAGEIVALVGPNGSGKSTLLRAIAGLLKPT 52 >gnl|CDD|34269 COG4650, RtcR, Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]. Length = 531 Score = 30.8 bits (69), Expect = 0.79 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 6/44 (13%) Query: 112 AKSNILLVGPTGCGKTYLAQTLARI------IDVPFTMADATTL 149 +++ ILL GPTG GK++LA+ + + F + TL Sbjct: 207 SRAPILLNGPTGAGKSFLARRIYELKQARHQFSGAFVEVNCATL 250 >gnl|CDD|30938 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]. Length = 408 Score = 30.6 bits (69), Expect = 0.80 Identities = 31/175 (17%), Positives = 60/175 (34%), Gaps = 27/175 (15%) Query: 30 LIAGPTVFICDECVELCMDIIRE---ENKSSITKSHEGIPNPQEILRV-------LDEYV 79 ++ P F+ + + +D+I+E E I Q L D +V Sbjct: 32 VLYAPNEFVRNW-LNSKLDLIKELLQELDGIIKVEVRASAPAQLPLPSGLNPKYTFDNFV 90 Query: 80 IGQGQAKKVLAVAVHNHYKRLAHS-SKSSNVELAKSNILLVGPTGCGKTYLAQTLARIID 138 +G A K +A + + N + + G G GKT+L Q + Sbjct: 91 VGPSNRLAYAAA------KAVAENPGGAYNP------LFIYGGVGLGKTHLLQAIGNEAL 138 Query: 139 VPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRK 193 A LT + + V+ + + E+ ++ ID++ ++ K Sbjct: 139 ANGPNARVVYLTSEDFTNDFVKAL---RDNEMEKFKEKYSLDLLLIDDIQFLAGK 190 >gnl|CDD|31317 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]. Length = 258 Score = 30.5 bits (69), Expect = 0.81 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 108 NVELAKSNIL-LVGPTGCGKTYLAQTLARII 137 + + K I ++GP G GK+ L + LA ++ Sbjct: 22 SFSIPKGEITGILGPNGSGKSTLLKCLAGLL 52 >gnl|CDD|73010 cd03251, ABCC_MsbA, MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 234 Score = 30.5 bits (69), Expect = 0.93 Identities = 11/24 (45%), Positives = 15/24 (62%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDV 139 + LVGP+G GK+ L + R DV Sbjct: 31 VALVGPSGSGKSTLVNLIPRFYDV 54 >gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 211 Score = 30.5 bits (69), Expect = 0.96 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 116 ILLVGPTGCGKTYLAQTLARII 137 +L+VGP G GK+ L + L ++ Sbjct: 30 VLIVGPNGSGKSTLLRLLNGLL 51 >gnl|CDD|31609 COG1419, FlhF, Flagellar GTP-binding protein [Cell motility and secretion]. Length = 407 Score = 30.3 bits (68), Expect = 0.97 Identities = 24/69 (34%), Positives = 30/69 (43%), Gaps = 11/69 (15%) Query: 68 PQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKT 127 EIL + DE + L K L ++ VE K I LVGPTG GKT Sbjct: 166 ELEILDMKDESYEDLRYFSEKLR-------KLLLSLIENLIVE-QKRVIALVGPTGVGKT 217 Query: 128 YLAQTLARI 136 TLA++ Sbjct: 218 ---TTLAKL 223 >gnl|CDD|73055 cd03296, ABC_CysA_sulfate_importer, Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 239 Score = 30.2 bits (68), Expect = 1.0 Identities = 26/98 (26%), Positives = 38/98 (38%), Gaps = 21/98 (21%) Query: 89 LAVAVHNHYKRLAHSSKSSNVELAKSN---ILLVGPTGCGKTYLAQTLARIIDVPFTMAD 145 +++ V N KR +V L + + L+GP+G GKT TL R+I Sbjct: 1 MSIEVRNVSKRFGDFVALDDVSLDIPSGELVALLGPSGSGKT----TLLRLI-------- 48 Query: 146 ATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVY 183 AG D I+ A D V+ G V+ Sbjct: 49 ------AGLERPDSGTILFGGEDATDVPVQERNVGFVF 80 >gnl|CDD|144592 pfam01057, Parvo_NS1, Parvovirus non-structural protein NS1. This family also contains the NS2 protein. Parvoviruses encode two non-structural proteins, NS1 and NS2. The mRNA for NS2 contains the coding sequence for the first 87 amino acids of NS1, then by an alternative splicing mechanism mRNA from a different reading frame, encoding the last 78 amino acids, makes up the full length of the NS2 mRNA. NS1, is the major non-structural protein. It is essential for DNA replication. It is an 83-kDa nuclear phosphoprotein. It has DNA helicase and ATPase activity. Length = 271 Score = 30.4 bits (69), Expect = 1.0 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATT 148 + GP GKT LAQ +A + + + + T Sbjct: 116 VWFYGPASTGKTNLAQAIAHAVPL-YGCVNWTN 147 >gnl|CDD|31673 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair]. Length = 254 Score = 30.4 bits (68), Expect = 1.1 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 6/63 (9%) Query: 115 NILLVGPTGCGKTYLAQTLA-----RIIDVPF-TMADATTLTEAGYVGEDVENIILKLLQ 168 N++L+GP G GKT+LA + I V F T D + +A + +E +L+ L+ Sbjct: 107 NLVLLGPPGVGKTHLAIAIGNELLKAGISVLFITAPDLLSKLKAAFDEGRLEEKLLRELK 166 Query: 169 AAD 171 D Sbjct: 167 KVD 169 >gnl|CDD|29996 cd01130, VirB11-like_ATPase, Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB. This alignment contains the C-terminal domain, which is the ATPase.. Length = 186 Score = 30.2 bits (68), Expect = 1.1 Identities = 13/27 (48%), Positives = 15/27 (55%) Query: 112 AKSNILLVGPTGCGKTYLAQTLARIID 138 A+ NIL+ G TG GKT L L I Sbjct: 24 ARKNILISGGTGSGKTTLLNALLAFIP 50 >gnl|CDD|31663 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]. Length = 366 Score = 30.3 bits (68), Expect = 1.1 Identities = 23/124 (18%), Positives = 45/124 (36%), Gaps = 22/124 (17%) Query: 112 AKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAA- 170 SNI++ GPTG GKT + + ++ + + ++ K+L Sbjct: 41 RPSNIIIYGPTGTGKTATVKFVMEELEESSANVEVVYINCLELRTPY--QVLSKILNKLG 98 Query: 171 -----------------DYNVERAQRGIVYIDEVDKISRKSDNP--SITRDVSGEGVQQA 211 D ++ + IV +DEVD + K S+ R V+ + Sbjct: 99 KVPLTGDSSLEILKRLYDNLSKKGKTVIVILDEVDALVDKDGEVLYSLLRAPGENKVKVS 158 Query: 212 LLKI 215 ++ + Sbjct: 159 IIAV 162 >gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]. Length = 559 Score = 30.2 bits (68), Expect = 1.1 Identities = 18/85 (21%), Positives = 29/85 (34%), Gaps = 19/85 (22%) Query: 112 AKSNILLVGPTGCGKTYLAQTLA----------RIIDVPFTMADATTL-TEAGYVGED-- 158 A LVG +G GK+ L L R+ + + +V ++ Sbjct: 346 AGQLTALVGASGAGKSTLLNLLLGFLAPTQGEIRVNGIDLRDLSPEAWRKQISWVSQNPY 405 Query: 159 ------VENIILKLLQAADYNVERA 177 ENI+L A+D + A Sbjct: 406 LFAGTIRENILLARPDASDEEIIAA 430 >gnl|CDD|31432 COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme metabolism]. Length = 423 Score = 29.9 bits (67), Expect = 1.2 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 16/69 (23%) Query: 176 RAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQG-GRKHPQQ 234 RA RGI+Y+DEV+ + + + ALL + + V +G +HP + Sbjct: 142 RANRGILYVDEVNLLD--------------DHLVDALLDVAAEGVNDVEREGISIRHPAR 187 Query: 235 EFLQVDTTN 243 FL + T N Sbjct: 188 -FLLIGTMN 195 >gnl|CDD|144183 pfam00493, MCM, MCM2/3/5 family. Length = 327 Score = 30.2 bits (69), Expect = 1.2 Identities = 28/118 (23%), Positives = 46/118 (38%), Gaps = 34/118 (28%) Query: 113 KSNILLVGPTGCGKTYLAQTLARIIDVPFTM-ADATTLTEAG---YVGEDVENIILKLLQ 168 N+LLVG G K+ L + +A++ P + + AG V D + Sbjct: 57 DINVLLVGDPGTAKSQLLKYVAKLA--PRAVYTSGKGSSAAGLTAAVVRDPDTG------ 108 Query: 169 AADYNVE-----RAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIME-GTI 220 ++ +E A G+ IDE DK++ E + A+ + ME TI Sbjct: 109 --EWTLEAGALVLADGGVCCIDEFDKMN--------------EEDRVAIHEAMEQQTI 150 >gnl|CDD|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 220 Score = 30.0 bits (68), Expect = 1.2 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 4/20 (20%) Query: 118 LVGPTGCGKTYLAQTLARII 137 LVGP+GCGK+ TL RII Sbjct: 35 LVGPSGCGKS----TLLRII 50 >gnl|CDD|73060 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK. ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles. ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP. In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.. Length = 213 Score = 30.1 bits (68), Expect = 1.3 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Query: 91 VAVHNHYKRLAHSSKSSNVEL---AKSNILLVGPTGCGKTYLAQTLARIIDV 139 V + N KR + + ++ L ++L+GP+GCGKT + +A + + Sbjct: 1 VELENVTKRFGNVTALDDLNLDIADGEFVVLLGPSGCGKTTTLRMIAGLEEP 52 >gnl|CDD|31888 COG1702, PhoH, Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms]. Length = 348 Score = 29.9 bits (67), Expect = 1.3 Identities = 18/109 (16%), Positives = 37/109 (33%), Gaps = 9/109 (8%) Query: 35 TVFICDECVELCMDIIREENKSSITKSHEGIPNPQEILRVLDEYVIGQGQAKKVLAVAVH 94 + V++ ++ + + +++L Q + V + H Sbjct: 56 RIIGARPLVDVATRVLLTLELLAEVRRGIASIYLEDVLSAFRGAESLQQLEESVEELDTH 115 Query: 95 NHYKRLAHSS-------KSSNVELAKSNILL--VGPTGCGKTYLAQTLA 134 R S ++ E + + ++ +GP G GKTYLA A Sbjct: 116 FLRGRTRDKSIIPKTPGQNMYPEAIEEHDIVFGIGPAGTGKTYLAVAKA 164 >gnl|CDD|32629 COG2766, PrkA, Putative Ser protein kinase [Signal transduction mechanisms]. Length = 649 Score = 29.9 bits (67), Expect = 1.3 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Query: 104 SKSSNVELAKSNILLVGPTGCGKTYLAQTLARIID-VPFTMADATTLT 150 + +E K + L+GP G GK+ LA+ L R+++ VP DA Sbjct: 94 HAAQGLEERKQILYLLGPVGGGKSSLAERLKRLMERVPIYDLDANGKG 141 >gnl|CDD|32636 COG2805, PilT, Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 353 Score = 29.8 bits (67), Expect = 1.4 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 3/23 (13%) Query: 116 ILLVGPTGCGKTYLAQTLARIID 138 IL+ GPTG GK+ TLA +ID Sbjct: 128 ILVTGPTGSGKS---TTLAAMID 147 >gnl|CDD|72982 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome. The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asymptomatic).. Length = 166 Score = 29.7 bits (67), Expect = 1.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 112 AKSNILLVGPTGCGKTYLAQTLARI 136 +L+ GP+G GK+ L + LA + Sbjct: 26 PGDRLLITGPSGTGKSSLFRALAGL 50 >gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional. Length = 489 Score = 29.6 bits (67), Expect = 1.6 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 7/97 (7%) Query: 101 AHSSKSSNVEL-AKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDV 159 + S ++SN L +LLVG G GK+ A+ +A +P D L G VGE Sbjct: 246 SFSKQASNYGLPTPRGLLLVGIQGTGKSLTAKAIANDWQLPLLRLDVGKLF-GGIVGES- 303 Query: 160 ENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDN 196 E+ + ++++ A E I++IDE+DK S++ Sbjct: 304 ESRMRQMIRIA----EALSPCILWIDEIDKAFSNSES 336 >gnl|CDD|73016 cd03257, ABC_NikE_OppD_transporters, The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE). The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.. Length = 228 Score = 29.3 bits (66), Expect = 1.9 Identities = 10/33 (30%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 108 NVELAKSNIL-LVGPTGCGKTYLAQTLARIIDV 139 + + K L LVG +G GK+ LA+ + ++ Sbjct: 25 SFSIKKGETLGLVGESGSGKSTLARAILGLLKP 57 >gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea. Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.. Length = 180 Score = 29.2 bits (66), Expect = 2.0 Identities = 10/31 (32%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 108 NVELAKSNIL-LVGPTGCGKTYLAQTLARII 137 ++ + I+ ++GP G GK+ L +TLA ++ Sbjct: 19 SLSIEAGEIVGILGPNGAGKSTLLKTLAGLL 49 >gnl|CDD|37180 KOG1969, KOG1969, KOG1969, DNA replication checkpoint protein CHL12/CTF18 [Energy production and conversion, Replication, recombination and repair]. Length = 877 Score = 29.2 bits (65), Expect = 2.1 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 14/78 (17%) Query: 116 ILLVGPTGCGKTYLAQTLAR-----IIDVPFTMADATTLTEAGYVGEDVENIILKLLQAA 170 +LL GP G GKT LA +A+ ++++ +D T V+ I +Q Sbjct: 329 LLLCGPPGLGKTTLAHVIAKQAGYSVVEI--NASDERT-------APMVKEKIENAVQNH 379 Query: 171 DYNVERAQRGIVYIDEVD 188 ++ + IDE+D Sbjct: 380 SVLDADSRPVCLVIDEID 397 >gnl|CDD|38564 KOG3354, KOG3354, KOG3354, Gluconate kinase [Carbohydrate transport and metabolism]. Length = 191 Score = 29.2 bits (65), Expect = 2.1 Identities = 9/34 (26%), Positives = 19/34 (55%) Query: 112 AKSNILLVGPTGCGKTYLAQTLARIIDVPFTMAD 145 K I+++G +G GK+ + + L+ + + F D Sbjct: 11 FKYVIVVMGVSGSGKSTIGKALSEELGLKFIDGD 44 >gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 178 Score = 29.4 bits (66), Expect = 2.1 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Query: 93 VHNHYKRLAHSSKSSNVELAKSN---ILLVGPTGCGKTYLAQTLARII 137 + N KR + ++V L + L+GP+G GK+ L + +A + Sbjct: 3 LKNVSKRYGQKTVLNDVSLNIEAGEIVALLGPSGSGKSTLLRCIAGLE 50 >gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 235 Score = 29.1 bits (65), Expect = 2.1 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query: 93 VHNHYKRLAHSSKSSNVELAKSN-ILLVGPTGCGKTYLAQTLARII 137 + Y + K ++E+ K +LL+GP G GK+ L + L ++ Sbjct: 9 LSFRYPGRKAALKDVSLEIEKGERVLLIGPNGSGKSTLLKLLNGLL 54 >gnl|CDD|35281 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]. Length = 716 Score = 29.1 bits (65), Expect = 2.2 Identities = 25/79 (31%), Positives = 34/79 (43%), Gaps = 19/79 (24%) Query: 118 LVGPTGCGKTYLAQTLARIID----------VPFTMADATTL-TEAGYVGED-------- 158 LVGP+G GK+ +A L R D VP + + L + G VG++ Sbjct: 499 LVGPSGSGKSTIASLLLRFYDPTSGRILLDGVPISDINHKYLRRKIGLVGQEPVLFSGSI 558 Query: 159 VENIILKLLQAADYNVERA 177 ENI L A D +E A Sbjct: 559 RENIAYGLDNATDEEIEAA 577 >gnl|CDD|133305 cd04105, SR_beta, Signal recognition particle receptor, beta subunit (SR-beta). SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane. Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP. SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane. The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane. SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon. High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this type of cancer. Length = 203 Score = 29.2 bits (66), Expect = 2.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 114 SNILLVGPTGCGKTYL 129 +LL+GP+ GKT L Sbjct: 1 PTVLLLGPSDSGKTAL 16 >gnl|CDD|32985 COG3172, NadR, Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism]. Length = 187 Score = 29.2 bits (65), Expect = 2.2 Identities = 16/76 (21%), Positives = 25/76 (32%), Gaps = 7/76 (9%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGE------DVENIILKLLQA 169 + ++G GK+ L LA I + G+ D I L Sbjct: 11 VAILGGESSGKSTLVNKLANIFNTTSAWEYGREYVFEHLGGDEALQYSDYAKIALGQAAY 70 Query: 170 ADYNVERAQRGIVYID 185 D V A + + +ID Sbjct: 71 EDAAVRYANK-VAFID 85 >gnl|CDD|31261 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]. Length = 442 Score = 29.3 bits (65), Expect = 2.2 Identities = 8/26 (30%), Positives = 13/26 (50%) Query: 112 AKSNILLVGPTGCGKTYLAQTLARII 137 + ++V PTG GKT +A + Sbjct: 54 TERRGVIVLPTGAGKTVVAAEAIAEL 79 >gnl|CDD|37181 KOG1970, KOG1970, KOG1970, Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Energy production and conversion, Replication, recombination and repair]. Length = 634 Score = 29.3 bits (65), Expect = 2.2 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Query: 112 AKSNILLV-GPTGCGKTYLAQTLARI 136 S ILL+ GP+GCGK+ + L++ Sbjct: 108 LGSRILLLTGPSGCGKSTTVKVLSKE 133 >gnl|CDD|31434 COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]. Length = 682 Score = 29.2 bits (65), Expect = 2.4 Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 13/89 (14%) Query: 114 SNILLVGPTGCGKT----YLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILK--LL 167 +ILLVG G K+ Y+A+ R + + A LT A + +L+ L Sbjct: 320 IHILLVGDPGTAKSQLLKYVAKLAPRGVYTSGKGSSAAGLTAAVVRDKVTGEWVLEAGAL 379 Query: 168 QAADYNVERAQRGIVYIDEVDKISRKSDN 196 AD G+ IDE DK++ + Sbjct: 380 VLAD-------GGVCCIDEFDKMNEEDRV 401 >gnl|CDD|73018 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and Solute Transporters-like subgroup. This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 213 Score = 28.9 bits (65), Expect = 2.6 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 4/20 (20%) Query: 118 LVGPTGCGKTYLAQTLARII 137 L+GP+GCGKT TL R+I Sbjct: 31 LLGPSGCGKT----TLLRLI 46 >gnl|CDD|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]. Length = 352 Score = 29.1 bits (65), Expect = 2.6 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 4/20 (20%) Query: 118 LVGPTGCGKTYLAQTLARII 137 L+GP+GCGKT TL R+I Sbjct: 36 LLGPSGCGKT----TLLRMI 51 >gnl|CDD|31991 COG1806, COG1806, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 273 Score = 29.1 bits (65), Expect = 2.7 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 100 LAHSSKSSNVELAKSNILLVGPTGCGKT----YLAQTLARIIDVPFTMAD 145 LAH S L +++++LVG + KT YLA + + P D Sbjct: 131 LAHDDGQSPRNLDEADVILVGVSRTSKTPTSLYLALQGIKAANYPLVPED 180 >gnl|CDD|73054 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment. ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 242 Score = 29.0 bits (65), Expect = 2.7 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Query: 97 YKRLAHSSKSSNVELAKSNIL-LVGPTGCGKTYLAQTLARIID 138 Y + + N+E+AK L L+GP+G GKT + + R+I+ Sbjct: 10 YGGGKKAVNNLNLEIAKGEFLVLIGPSGSGKTTTMKMINRLIE 52 >gnl|CDD|31297 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only]. Length = 219 Score = 28.8 bits (63), Expect = 2.8 Identities = 21/92 (22%), Positives = 30/92 (32%), Gaps = 6/92 (6%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175 I+++G G GKT L L L A + NI L+L A Sbjct: 8 IVVLGDGGVGKTTLLNRLVGDEFPEGYPPTIGNLDPAKTIEPYRRNIKLQLWDTAGQEEY 67 Query: 176 RAQRGIVY------IDEVDKISRKSDNPSITR 201 R+ R Y + D R+S + Sbjct: 68 RSLRPEYYRGANGILIVYDSTLRESSDELTEE 99 >gnl|CDD|31313 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 248 Score = 29.0 bits (65), Expect = 2.9 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 4/20 (20%) Query: 118 LVGPTGCGKTYLAQTLARII 137 ++GP+GCGK+ TL R+I Sbjct: 34 ILGPSGCGKS----TLLRLI 49 >gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.. Length = 165 Score = 28.9 bits (64), Expect = 3.1 Identities = 23/99 (23%), Positives = 35/99 (35%), Gaps = 21/99 (21%) Query: 115 NILLVGPTGCGKTYLAQTLARIIDVP-----FTMADATTLTEAGYVGEDVENIILK---- 165 IL+ GPTG GKT LA LA I + + + + L Sbjct: 1 LILVFGPTGSGKTTLALQLALNIATKGGKVVYVDIEEEIEELTERLIGESLKGALDNLII 60 Query: 166 ------------LLQAADYNVERAQRGIVYIDEVDKISR 192 LL A+ ER ++ +DE+ ++ R Sbjct: 61 VFATADDPAAARLLSKAERLRERGGDDLIILDELTRLVR 99 >gnl|CDD|177097 CHL00206, ycf2, Ycf2; Provisional. Length = 2281 Score = 28.7 bits (64), Expect = 3.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPF 141 IL++G G G++YL + LA VPF Sbjct: 1633 ILVIGSIGTGRSYLVKYLATNSYVPF 1658 >gnl|CDD|73008 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.. Length = 238 Score = 28.6 bits (64), Expect = 3.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 118 LVGPTGCGKTYLAQTLARIID 138 LVG +GCGK+ + L R D Sbjct: 34 LVGSSGCGKSTVVSLLERFYD 54 >gnl|CDD|143799 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain. This family includes the ATP synthase alpha and beta subunits, the ATP synthase associated with flagella and the termination factor Rho. Length = 213 Score = 28.6 bits (65), Expect = 3.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 116 ILLVGPTGCGKTYLAQTLAR 135 I + G +G GKT L +AR Sbjct: 18 IGIFGGSGTGKTVLLGMIAR 37 >gnl|CDD|33918 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]. Length = 604 Score = 28.3 bits (63), Expect = 3.7 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 105 KSSNVEL-AKSNILLVGPTGCGKTYLAQTLA 134 N E+ +L+ G +G GKT L + LA Sbjct: 410 SELNFEVRPGERLLITGESGAGKTSLLRALA 440 >gnl|CDD|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.. Length = 218 Score = 28.5 bits (64), Expect = 3.7 Identities = 30/119 (25%), Positives = 46/119 (38%), Gaps = 28/119 (23%) Query: 116 ILLVGPTGCGKTYLAQTLA----------RIIDVPFTMADATTLTE-----AGYVGED-- 158 + +VGP+G GK+ L L R+ + L G+V + Sbjct: 33 VAIVGPSGSGKSTLLNILGGLDRPTSGEVRVDGTDISKLSEKELAAFRRRHIGFVFQSFN 92 Query: 159 -------VENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQ 210 +EN+ L LL A ER +R ++ V R + PS ++SG G QQ Sbjct: 93 LLPDLTALENVELPLLLAGVPKKERRERAEELLERVGLGDRLNHYPS---ELSG-GQQQ 147 >gnl|CDD|133259 cd01850, CDC_Septin, CDC/Septin. Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells. They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis. In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments. Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities. Length = 276 Score = 28.6 bits (65), Expect = 3.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 115 NILLVGPTGCGKTYLAQTL 133 NI++VG +G GK+ TL Sbjct: 6 NIMVVGESGLGKSTFINTL 24 >gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1381 Score = 28.3 bits (63), Expect = 3.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 118 LVGPTGCGKTYLAQTLARIIDV 139 +VG TG GK+ L L R+++ Sbjct: 1171 IVGRTGAGKSSLILALFRLVEP 1192 >gnl|CDD|73061 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length MRP-type transporter 1). NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.. Length = 207 Score = 28.3 bits (63), Expect = 4.1 Identities = 11/28 (39%), Positives = 15/28 (53%) Query: 112 AKSNILLVGPTGCGKTYLAQTLARIIDV 139 A I +VG TG GK+ L L R ++ Sbjct: 33 AGEKIGIVGRTGAGKSTLILALFRFLEA 60 >gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 229 Score = 28.2 bits (63), Expect = 4.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Query: 116 ILLVGPTGCGKTYLAQTLARIID 138 + +VGPTG GKT L L R D Sbjct: 32 VAIVGPTGAGKTTLINLLMRFYD 54 >gnl|CDD|34242 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 223 Score = 28.4 bits (63), Expect = 4.1 Identities = 10/22 (45%), Positives = 16/22 (72%) Query: 116 ILLVGPTGCGKTYLAQTLARII 137 I + GP+GCGK+ L + +A +I Sbjct: 32 IAITGPSGCGKSTLLKIVASLI 53 >gnl|CDD|109493 pfam00437, GSPII_E, Type II/IV secretion system protein. This family contains both type II and type IV pathway secretion proteins from bacteria. VirB11 ATPase is a subunit of the Agrobacterium tumefaciens transfer DNA (T-DNA) transfer system, a type IV secretion pathway required for delivery of T-DNA and effector proteins to plant cells during infection. Length = 283 Score = 28.4 bits (64), Expect = 4.3 Identities = 13/27 (48%), Positives = 16/27 (59%) Query: 112 AKSNILLVGPTGCGKTYLAQTLARIID 138 A+ NIL+ G TG GKT L L I+ Sbjct: 138 ARGNILVSGGTGSGKTTLLYALLNEIN 164 >gnl|CDD|72985 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 205 Score = 28.3 bits (63), Expect = 4.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Query: 116 ILLVGPTGCGKTYLAQTLARIID 138 I L G G GKT LA+ LA +I Sbjct: 29 IALTGKNGAGKTTLAKILAGLIK 51 >gnl|CDD|33076 COG3265, GntK, Gluconate kinase [Carbohydrate transport and metabolism]. Length = 161 Score = 28.3 bits (63), Expect = 4.4 Identities = 8/26 (30%), Positives = 12/26 (46%) Query: 120 GPTGCGKTYLAQTLARIIDVPFTMAD 145 G +G GK+ + LA + F D Sbjct: 2 GVSGSGKSTVGSALAERLGAKFIDGD 27 >gnl|CDD|33892 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 213 Score = 28.0 bits (62), Expect = 4.5 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Query: 108 NVELAKSNIL-LVGPTGCGKTYLAQTLARIIDVPFTMADATTLTE 151 N +AK I+ L+GP+GCGK+ L + + F+ L E Sbjct: 22 NFTIAKGEIVTLMGPSGCGKSTLLSWMIGALAGQFSCTGELWLNE 66 >gnl|CDD|73012 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 236 Score = 28.2 bits (63), Expect = 4.9 Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDV 139 + +VGP+G GK+ + + L R DV Sbjct: 30 VAIVGPSGSGKSTILRLLFRFYDV 53 >gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]. Length = 534 Score = 27.9 bits (62), Expect = 5.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 118 LVGPTGCGKTYLAQTLARIID 138 LVG +G GK+ L L R+I Sbjct: 318 LVGESGSGKSTLGLALLRLIP 338 >gnl|CDD|73006 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicated in cytochrome bd biogenesis. The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes. CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space. In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.. Length = 178 Score = 27.9 bits (62), Expect = 5.3 Identities = 9/27 (33%), Positives = 13/27 (48%) Query: 112 AKSNILLVGPTGCGKTYLAQTLARIID 138 I L+G +G GK+ L Q L + Sbjct: 27 QGEKIALLGRSGSGKSTLLQLLTGDLK 53 >gnl|CDD|35575 KOG0354, KOG0354, KOG0354, DEAD-box like helicase [General function prediction only]. Length = 746 Score = 28.0 bits (62), Expect = 5.5 Identities = 8/23 (34%), Positives = 14/23 (60%) Query: 114 SNILLVGPTGCGKTYLAQTLARI 136 N ++ PTG GKT++A + + Sbjct: 77 KNTIIALPTGSGKTFIAAVIMKN 99 >gnl|CDD|73005 cd03246, ABCC_Protease_Secretion, This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain. They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substrates ranges from inorganic ions, nutrients such as amino acids, sugars, or peptides, hydrophobic drugs, to large polypeptides, such as HlyA.. Length = 173 Score = 27.8 bits (62), Expect = 5.6 Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 11/54 (20%) Query: 118 LVGPTGCGKTYLAQTLA----------RIIDVPFTMADATTLTE-AGYVGEDVE 160 ++GP+G GK+ LA+ + R+ + D L + GY+ +D E Sbjct: 33 IIGPSGSGKSTLARLILGLLRPTSGRVRLDGADISQWDPNELGDHVGYLPQDDE 86 >gnl|CDD|32390 COG2208, RsbU, Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]. Length = 367 Score = 27.7 bits (61), Expect = 5.7 Identities = 18/73 (24%), Positives = 25/73 (34%), Gaps = 1/73 (1%) Query: 185 DEVDKISRKSDNPSIT-RDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTN 243 D D I I DVSG+GV ALL +M + + G P ++ Sbjct: 164 DYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESGPLDPADVLETLNRVL 223 Query: 244 ILFICGGAFAGLD 256 + F L Sbjct: 224 KQNLEEDMFVTLF 236 >gnl|CDD|34350 COG4735, COG4735, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 211 Score = 27.6 bits (61), Expect = 5.9 Identities = 16/62 (25%), Positives = 23/62 (37%), Gaps = 4/62 (6%) Query: 325 LSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEKILLDTMF 384 + E LI Y L L I + A+A +T +GL L+ T+F Sbjct: 110 IEEQLQVLIADYLVAKKA----LGKGSYQLAVILQNAVALQTLGQGLLRGAAYGLVRTLF 165 Query: 385 EL 386 L Sbjct: 166 SL 167 >gnl|CDD|176511 cd08568, GDPD_TmGDE_like, Glycerophosphodiester phosphodiesterase domain of Thermotoga maritime and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Thermotoga maritime glycerophosphodiester phosphodiesterase (TmGDE, EC 3.1.4.46) and its uncharacterized homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. TmGDE exists as a monomer that might be the biologically relevant form. Length = 226 Score = 27.6 bits (62), Expect = 6.0 Identities = 38/183 (20%), Positives = 68/183 (37%), Gaps = 54/183 (29%) Query: 273 VVKDSDNRPVGEV---LRNLESEDLVKFGLIPEFIGRLPVLATLEDLDENSLIRILSEPK 329 V+ D + + VG V ++ L ++L K E I L + L +++I + + Sbjct: 45 VLHDENLKRVGGVDLKVKELTYKELKKLHPGGELIPTLEEV--FRALPNDAIINVEIKDI 102 Query: 330 NALIKQYQCL--FDMED--VELVFHEDALREIAR----CAIA------------------ 363 +A+ + + F+ D + F+ DALRE+ + + Sbjct: 103 DAVEPVLEIVEKFNALDRVIFSSFNHDALRELRKLDPDAKVGLLIGEEEEGFSIPELHEK 162 Query: 364 HKT-------------GARGLRSILE-------KILLDTM---FELPMLKGVSSVIISDD 400 K G +L KI+L T+ +P LKG+ +I+DD Sbjct: 163 LKLYSLHVPIDAIGYIGFEKFVELLRLLRKLGLKIVLWTVNDPELVPKLKGLVDGVITDD 222 Query: 401 VVK 403 V K Sbjct: 223 VEK 225 >gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure. Renin, also known as angiotensinogenase, is a circulating enzyme that participates in the renin-angiotensin system that mediates extracellular volume, arterial vasoconstriction, and consequently mean arterial blood pressure. The enzyme is secreted by the kidneys from specialized juxtaglomerular cells in response to decreases in glomerular filtration rate (a consequence of low blood volume), diminished filtered sodium chloride and sympathetic nervous system innervation. The enzyme circulates in the blood stream and hydrolyzes angiotensinogen secreted from the liver into the peptide angiotensin I. Angiotensin I is further cleaved in the lungs by endothelial bound angiotensin converting enzyme (ACE) into angiotensin II, the final active peptide. Renin is a member of the aspartic protease family. Structurally, aspartic proteases are bilobal enzymes, each lobe contributing a catalytic Aspartate residue, with an extended active site cleft localized between the two lobes of the molecule. The N- and C-terminal domains, although structurally related by a 2-fold axis, have only limited sequence homology except the vicinity of the active site. This suggests that the enzymes evolved by an ancient duplication event. The active site is located at the groove formed by the two lobes, with an extended loop projecting over the cleft to form an 11-residue flap, which encloses substrates and inhibitors in the active site. Specificity is determined by nearest-neighbor hydrophobic residues surrounding the catalytic aspartates, and by three residues in the flap. The enzymes are mostly secreted from cells as inactive proenzymes that activate autocatalytically at acidic pH. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA). Length = 326 Score = 27.8 bits (62), Expect = 6.3 Identities = 15/63 (23%), Positives = 26/63 (41%), Gaps = 6/63 (9%) Query: 89 LAVAVHNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARIIDVPFT--MADA 146 A HN Y +S SS + + + +G K +L+Q + + +P T + Sbjct: 45 TACVTHNLYD----ASDSSTYKENGTEFTIHYASGTVKGFLSQDIVTVGGIPVTQMFGEV 100 Query: 147 TTL 149 T L Sbjct: 101 TAL 103 >gnl|CDD|33735 COG3954, PrkB, Phosphoribulokinase [Energy production and conversion]. Length = 289 Score = 27.7 bits (61), Expect = 6.4 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 5/64 (7%) Query: 181 IVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQ-QEFLQV 239 IV ++ + K+ R + R S E V ++++ M+ I + PQ R H Q V Sbjct: 156 IVNLEWIQKLIRDTS----ERGHSREAVMDSVVRSMDDYINYITPQFSRTHINFQRVPTV 211 Query: 240 DTTN 243 DT+N Sbjct: 212 DTSN 215 >gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]. Length = 709 Score = 27.5 bits (61), Expect = 6.5 Identities = 22/81 (27%), Positives = 33/81 (40%), Gaps = 19/81 (23%) Query: 116 ILLVGPTGCGKTYLAQTLARI---------ID-VPFTMADATTLTEA-GYVGEDV----- 159 + +VG +G GK+ L + L + +D V D +L GYV +D Sbjct: 502 VAIVGRSGSGKSTLLKLLLGLYKPQQGRILLDGVDLNDIDLASLRRQVGYVLQDPFLFSG 561 Query: 160 ---ENIILKLLQAADYNVERA 177 ENI L +A D + A Sbjct: 562 SIRENIALGNPEATDEEIIEA 582 >gnl|CDD|144015 pfam00270, DEAD, DEAD/DEAH box helicase. Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression. Length = 167 Score = 27.6 bits (62), Expect = 6.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 111 LAKSNILLVGPTGCGKTYLAQ 131 L ++L+ PTG GKT Sbjct: 12 LEGKDVLVQAPTGSGKTLAFL 32 >gnl|CDD|30202 cd02029, PRK_like, Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes. PRK catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.. Length = 277 Score = 27.6 bits (61), Expect = 6.7 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 6/69 (8%) Query: 181 IVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPQ-QEFLQV 239 I+ ++ + KI R + R S E V +L+ M I + PQ R Q V Sbjct: 150 IINLEWIQKIHRDTAE----RGYSAEAVMDTILRRMPDYINYICPQFSRTDINFQRVPTV 205 Query: 240 DTTNILFIC 248 DT+N FI Sbjct: 206 DTSNP-FIA 213 >gnl|CDD|37019 KOG1808, KOG1808, KOG1808, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]. Length = 1856 Score = 27.7 bits (61), Expect = 6.7 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 7/38 (18%) Query: 99 RLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARI 136 A SS K ILL GPT GKT + + LAR Sbjct: 433 ARAISSG-------KFPILLQGPTSSGKTSIIKELARA 463 >gnl|CDD|31299 COG1102, Cmk, Cytidylate kinase [Nucleotide transport and metabolism]. Length = 179 Score = 27.5 bits (61), Expect = 6.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 116 ILLVGPTGCGKTYLAQTLARIIDVPF 141 I + G G GKT +A+ LA + + Sbjct: 3 ITISGLPGSGKTTVARELAEHLGLKL 28 >gnl|CDD|36563 KOG1349, KOG1349, KOG1349, Gpi-anchor transamidase [Posttranslational modification, protein turnover, chaperones]. Length = 309 Score = 27.6 bits (61), Expect = 6.8 Identities = 21/87 (24%), Positives = 35/87 (40%), Gaps = 9/87 (10%) Query: 160 ENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQ-QALLKIMEG 218 IIL L N + G VY +E ++ D+ + D G V + L+++ G Sbjct: 64 SQIILMLADDMACNSRNPRPGTVYNNENHALNLYGDDVEV--DYRGYEVTVENFLRVLTG 121 Query: 219 TIASVPPQGGRKHPQQEFLQVDTTNIL 245 + P+ R L + +NIL Sbjct: 122 RHPNNTPRSKRL------LTDEGSNIL 142 >gnl|CDD|30975 COG0630, VirB11, Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 312 Score = 27.7 bits (61), Expect = 7.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Query: 112 AKSNILLVGPTGCGKTYLAQTLARIID 138 A+ +I++ G T GKT L L I Sbjct: 142 ARKSIIICGGTASGKTTLLNALLDFIP 168 >gnl|CDD|133261 cd01852, AIG1, AIG1 (avrRpt2-induced gene 1). This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family. The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections. The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins). Length = 196 Score = 27.5 bits (62), Expect = 7.3 Identities = 7/13 (53%), Positives = 10/13 (76%) Query: 115 NILLVGPTGCGKT 127 ++LVG TG GK+ Sbjct: 2 RLVLVGKTGAGKS 14 >gnl|CDD|146036 pfam03205, MobB, Molybdopterin guanine dinucleotide synthesis protein B. This protein contains a P-loop. Length = 122 Score = 27.3 bits (61), Expect = 7.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 116 ILLVGPTGCGKTYLAQTLARII 137 +L+VGP GKT L + L + Sbjct: 3 VLVVGPKDSGKTTLIRKLLNYL 24 >gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids. The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.. Length = 232 Score = 27.4 bits (61), Expect = 7.5 Identities = 26/117 (22%), Positives = 46/117 (39%), Gaps = 32/117 (27%) Query: 105 KSSNVELAKSNIL-LVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENII 163 ++ + + I+ L+GP G GKT T +I G V D I+ Sbjct: 17 NGVSLSVKQGEIVGLLGPNGAGKT----TTFYMI--------------VGLVKPDSGKIL 58 Query: 164 LKLLQAADYNV-ERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGT 219 L + +RA+ GI Y+ + SI R ++ V++ +L ++E Sbjct: 59 LDGQDITKLPMHKRARLGIGYLPQ---------EASIFRKLT---VEENILAVLEIR 103 >gnl|CDD|36169 KOG0951, KOG0951, KOG0951, RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]. Length = 1674 Score = 27.6 bits (61), Expect = 7.5 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Query: 99 RLAHSSKSSNVELAKSNILLVGPTGCGKTYLA 130 ++ ++ N+LL PTG GKT +A Sbjct: 316 KVYDAALRG-----DENMLLCAPTGAGKTNVA 342 >gnl|CDD|146942 pfam04548, AIG1, AIG1 family. Arabidopsis protein AIG1 appears to be involved in plant resistance to bacteria. Length = 200 Score = 27.6 bits (62), Expect = 7.5 Identities = 8/12 (66%), Positives = 9/12 (75%) Query: 115 NILLVGPTGCGK 126 I+LVG TG GK Sbjct: 2 RIVLVGKTGNGK 13 >gnl|CDD|73059 cd03300, ABC_PotA_N, PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D. PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 232 Score = 27.4 bits (61), Expect = 7.8 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 4/20 (20%) Query: 118 LVGPTGCGKTYLAQTLARII 137 L+GP+GCGKT TL R+I Sbjct: 31 LLGPSGCGKT----TLLRLI 46 >gnl|CDD|38055 KOG2844, KOG2844, KOG2844, Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism]. Length = 856 Score = 27.2 bits (60), Expect = 8.1 Identities = 11/40 (27%), Positives = 18/40 (45%) Query: 98 KRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARII 137 + +AH+S+ EL + L G G +LA R+ Sbjct: 97 QLIAHTSRVLYRELEEETGLHTGWIQNGGIFLASNRQRLD 136 >gnl|CDD|37485 KOG2274, KOG2274, KOG2274, Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport, Nuclear structure]. Length = 1005 Score = 27.3 bits (60), Expect = 8.4 Identities = 8/32 (25%), Positives = 14/32 (43%) Query: 140 PFTMADATTLTEAGYVGEDVENIILKLLQAAD 171 P T+ +E V +++ +LLQ A Sbjct: 574 PLTINLFLKYSEDPQVASLAQDLFEELLQIAA 605 >gnl|CDD|31322 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]. Length = 309 Score = 27.2 bits (60), Expect = 8.4 Identities = 9/23 (39%), Positives = 17/23 (73%) Query: 116 ILLVGPTGCGKTYLAQTLARIID 138 ++L+GP+G GKT + + R+I+ Sbjct: 30 LVLIGPSGSGKTTTLKMINRLIE 52 >gnl|CDD|30759 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]. Length = 237 Score = 27.4 bits (61), Expect = 8.9 Identities = 24/102 (23%), Positives = 45/102 (44%), Gaps = 25/102 (24%) Query: 93 VHNHYKRLAHSSKSSNVELAKSNIL-LVGPTGCGKTYLAQTLARIIDVPFTMADATTLTE 151 + Y ++ + + ++E+ + I+ L+G G GKT L +T+ ++ Sbjct: 9 LSAGYGKI-QALRGVSLEVERGEIVALLGRNGAGKTTLLKTIMGLVRP-----------R 56 Query: 152 AGYV---GEDVENIILKLLQAADYNVERAQRGIVYIDEVDKI 190 +G + GED+ L ERA+ GI Y+ E +I Sbjct: 57 SGRIIFDGEDITG-----LPPH----ERARLGIAYVPEGRRI 89 >gnl|CDD|33404 COG3604, FhlA, Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]. Length = 550 Score = 27.2 bits (60), Expect = 9.4 Identities = 15/84 (17%), Positives = 32/84 (38%), Gaps = 14/84 (16%) Query: 50 IREENKSSITKSHEGIPNPQEILRVLDEYVIGQGQAKKVLAVAVHNHYKRLAHSSKSSNV 109 + + ++ E++ + +IG+ A + L + +A S Sbjct: 197 LSSLKERLEEENLALEEQLSEVVLEVGG-IIGRSPAMRQLLKEIE----VVAKSD----- 246 Query: 110 ELAKSNILLVGPTGCGKTYLAQTL 133 S +L+ G TG GK +A+ + Sbjct: 247 ----STVLIRGETGTGKELVARAI 266 >gnl|CDD|30000 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A. These ATPases couple ATP hydrolysis to the build up of a H+ gradient, but V-type ATPases do not catalyze the reverse reaction. The Vacuolar (V-type) ATPase is found in the membranes of vacuoles, the golgi apparatus and in other coated vesicles in eukaryotes. Archaea have a protein which is similar in sequence to V-ATPases, but functions like an F-ATPase (called A-ATPase). A similar protein is also found in a few bacteria.. Length = 369 Score = 27.1 bits (60), Expect = 9.8 Identities = 9/16 (56%), Positives = 13/16 (81%) Query: 120 GPTGCGKTYLAQTLAR 135 GP GCGKT + Q+L++ Sbjct: 164 GPFGCGKTVIQQSLSK 179 >gnl|CDD|29997 cd01131, PilT, Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.. Length = 198 Score = 27.1 bits (60), Expect = 9.8 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 3/23 (13%) Query: 116 ILLVGPTGCGKTYLAQTLARIID 138 +L+ GPTG GK+ TLA +ID Sbjct: 4 VLVTGPTGSGKS---TTLAAMID 23 >gnl|CDD|36207 KOG0989, KOG0989, KOG0989, Replication factor C, subunit RFC4 [Replication, recombination and repair]. Length = 346 Score = 27.2 bits (60), Expect = 9.9 Identities = 26/112 (23%), Positives = 41/112 (36%), Gaps = 23/112 (20%) Query: 114 SNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGY------VGEDVENI--ILK 165 + L GP G GKT A AR ++ A V E ++N + Sbjct: 58 PHYLFYGPPGTGKTSTALAFARALNCEQLFPCRVLELNASDERGISVVREKIKNFAKLTV 117 Query: 166 LLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIME 217 LL+ +D + I+ +DE D ++ + Q AL + ME Sbjct: 118 LLKRSDGYPCPPFK-IIILDECDSMTSDA--------------QAALRRTME 154 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.135 0.380 Gapped Lambda K H 0.267 0.0724 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,838,676 Number of extensions: 256306 Number of successful extensions: 1183 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1144 Number of HSP's successfully gapped: 221 Length of query: 424 Length of database: 6,263,737 Length adjustment: 96 Effective length of query: 328 Effective length of database: 4,189,273 Effective search space: 1374081544 Effective search space used: 1374081544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 59 (26.5 bits)