RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780275|ref|YP_003064688.1| SsrA-binding protein [Candidatus Liberibacter asiaticus str. psy62] (159 letters) >gnl|CDD|180069 PRK05422, smpB, SsrA-binding protein; Validated. Length = 148 Score = 236 bits (604), Expect = 3e-63 Identities = 84/148 (56%), Positives = 107/148 (72%), Gaps = 1/148 (0%) Query: 9 PPKKVVSDNRKARYNYHIVRSFEAGIVLTGTEVKSLRVSKVNISDSYATFENDEIWLTNS 68 P KV++ N+KAR++Y I +FEAGIVLTGTEVKSLR K N+ DSY +N E WL N+ Sbjct: 1 PGSKVIAQNKKARHDYFIEETFEAGIVLTGTEVKSLRAGKANLKDSYVLIKNGEAWLFNA 60 Query: 69 YIPEYLQANRFNHYPRRNRKLLLSKREIHRLYAAVRRDGMTLVPMKIYFNAKGLAKIDLA 128 +I Y Q N FNH PRR RKLLL K+EI +L V R G TLVP+K+YF G AK+++ Sbjct: 61 HISPYEQGNHFNHDPRRTRKLLLHKKEIDKLIGKVERKGYTLVPLKLYFK-NGRAKVEIG 119 Query: 129 LAQGKKNYDKRETEKKRDWDRQKHRILR 156 LA+GKK +DKRET K+RDW R+K R ++ Sbjct: 120 LAKGKKLHDKRETIKERDWKREKARAMK 147 >gnl|CDD|129194 TIGR00086, smpB, SsrA-binding protein. This model describes the SsrA-binding protein, also called tmRNA binding protein, small protein B, and SmpB. The small, stable RNA SsrA (also called tmRNA or 10Sa RNA) recognizes stalled ribosomes such as occur during translation from message that lacks a stop codon. It becomes charged with Ala like a tRNA, then acts as mRNA to resume translation started with the defective mRNA. The short C-terminal peptide tag added by the SsrA system marks the abortively translated protein for degradation. SmpB binds SsrA after its aminoacylation but before the coupling of the Ala to the nascent polypeptide chain and is an essential part of the SsrA peptide tagging system. SmpB has been associated with the survival of bacterial pathogens in conditions of stress. It is universal in the first 100 sequenced bacterial genomes. Length = 144 Score = 190 bits (485), Expect = 1e-49 Identities = 73/144 (50%), Positives = 103/144 (71%) Query: 13 VVSDNRKARYNYHIVRSFEAGIVLTGTEVKSLRVSKVNISDSYATFENDEIWLTNSYIPE 72 +++ N+KA ++Y I+ ++EAGIVL G+EVKS+R KV++ DSY + E+WL N +I Sbjct: 1 LIASNKKAFFDYEILDTYEAGIVLKGSEVKSIRAGKVSLKDSYVIIKKGELWLKNMHIAP 60 Query: 73 YLQANRFNHYPRRNRKLLLSKREIHRLYAAVRRDGMTLVPMKIYFNAKGLAKIDLALAQG 132 Y N FNH PRR RKLLL K+EI +L V+ G+TLVP+K+YF KG K+++ALA+G Sbjct: 61 YKFGNYFNHDPRRPRKLLLHKKEIDKLQGKVKEKGLTLVPLKLYFKNKGKVKVEIALAKG 120 Query: 133 KKNYDKRETEKKRDWDRQKHRILR 156 KK +DKRE+ KKRD R+ R L+ Sbjct: 121 KKLHDKRESIKKRDAKRELKRALK 144 >gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional. Length = 373 Score = 33.1 bits (76), Expect = 0.033 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 5/52 (9%) Query: 67 NSYIPEYLQANRFNHYPRRNRKLLLSKREIHRLYAAVRRDGMTLVPMKIYFN 118 +S+ +LQ FNHYP R++L + E L+ D L P+K + Sbjct: 223 SSFGKPHLQ-AYFNHYPNEVREILDKQSETGILH----HDIYDLKPLKSFVY 269 >gnl|CDD|184922 PRK14958, PRK14958, DNA polymerase III subunits gamma and tau; Provisional. Length = 509 Score = 29.3 bits (65), Expect = 0.44 Identities = 27/92 (29%), Positives = 38/92 (41%), Gaps = 19/92 (20%) Query: 74 LQANRFNHYPRRNRKLLLSKREIHRLYAAVRRDGMTLVPMKIYFNAKGLAKIDL------ 127 L NR +K LL ++ I R+ A+ +FN KID+ Sbjct: 410 LTDNRLYLMLNPKQKPLLQQKHIERISEALSE----------HFNRTITVKIDISNHQTE 459 Query: 128 ---ALAQGKKNYDKRETEKKRDWDRQKHRILR 156 ALAQ K + E EK+ DRQ RI++ Sbjct: 460 TPAALAQKKAQDRQTEAEKRMMNDRQVQRIMQ 491 >gnl|CDD|185214 PRK15314, PRK15314, outer membrane protein RatB; Provisional. Length = 2435 Score = 28.7 bits (63), Expect = 0.81 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 5/62 (8%) Query: 16 DNRKARYNYHIVRSFEAGIVLTGTEVKSL--RVSKVNISDSYATFENDEIWLTNSYIPEY 73 D+ KA+Y H+ +F + E K R + +D+ EN+E W T S P Sbjct: 1724 DSDKAKYWGHMPETFTNSKGV---EFKRPLLRAELSSTADTSGYTENNETWYTWSRYPNM 1780 Query: 74 LQ 75 Q Sbjct: 1781 YQ 1782 >gnl|CDD|185080 PRK15126, PRK15126, thiamin pyrimidine pyrophosphate hydrolase; Provisional. Length = 272 Score = 28.1 bits (63), Expect = 0.95 Identities = 10/25 (40%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Query: 60 NDEIWLTNSYIPEYLQANRFN--HY 82 ND+ W T IP LQA+ ++ Y Sbjct: 106 NDDGWFTGKEIPALLQAHVYSGFRY 130 >gnl|CDD|173323 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional. Length = 335 Score = 25.5 bits (56), Expect = 6.2 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 11/66 (16%) Query: 87 RKLLLSKREIHRLYAAVRRDGMTLVPMKIYFNAKGLAKI-DLALAQGKKN------YDKR 139 ++L +H+ Y + RD L P I+ N+KG+ KI D LA+ K Sbjct: 126 LQILNGLNVLHKWYF-MHRD---LSPANIFINSKGICKIADFGLARRYGYPPYSDTLSKD 181 Query: 140 ETEKKR 145 ET ++R Sbjct: 182 ETMQRR 187 >gnl|CDD|178188 PLN02576, PLN02576, protoporphyrinogen oxidase. Length = 496 Score = 25.0 bits (55), Expect = 9.7 Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 1 MSLKSRGNPPKKVVSDNRKARYNYHIVRSFEAG-IVLTGTEVKSLRVSKVNIS 52 +++ PK D R + V SF G L K L KV ++ Sbjct: 205 KAIQEAKKNPKPEPRDPRLPKPKGQTVGSFRGGLQTLPDALAKRLGKDKVKLN 257 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.134 0.387 Gapped Lambda K H 0.267 0.0695 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,612,607 Number of extensions: 155840 Number of successful extensions: 313 Number of sequences better than 10.0: 1 Number of HSP's gapped: 312 Number of HSP's successfully gapped: 15 Length of query: 159 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 73 Effective length of database: 4,136,185 Effective search space: 301941505 Effective search space used: 301941505 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (24.3 bits)