RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780275|ref|YP_003064688.1| SsrA-binding protein [Candidatus Liberibacter asiaticus str. psy62] (159 letters) >d1wjxa_ b.111.1.1 (A:) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]} Length = 120 Score = 150 bits (381), Expect = 5e-38 Identities = 64/120 (53%), Positives = 86/120 (71%) Query: 14 VSDNRKARYNYHIVRSFEAGIVLTGTEVKSLRVSKVNISDSYATFENDEIWLTNSYIPEY 73 V +NR+AR++Y I+ ++EAGI L GTEVKSLR KV+ + S+A FE+ E++L N YI Y Sbjct: 1 VLENRRARHDYEILETYEAGIALKGTEVKSLRAGKVDFTGSFARFEDGELYLENLYIAPY 60 Query: 74 LQANRFNHYPRRNRKLLLSKREIHRLYAAVRRDGMTLVPMKIYFNAKGLAKIDLALAQGK 133 + + N PRR RKLLL K E+ RL V + G+TLVP+KIYFN +G AK+ L LA+GK Sbjct: 61 EKGSYANVDPRRKRKLLLHKHELRRLLGKVEQKGLTLVPLKIYFNERGYAKVLLGLARGK 120 >d1p6va_ b.111.1.1 (A:) Small protein B (SmpB) {Aquifex aeolicus [TaxId: 63363]} Length = 128 Score = 138 bits (350), Expect = 2e-34 Identities = 59/125 (47%), Positives = 80/125 (64%), Gaps = 2/125 (1%) Query: 11 KKVVSDNRKARYNYHIVRSFEAGIVLTGTEVKSLR-VSKVNISDSYATFENDEIWLTNSY 69 +++N++A+ Y I+ ++EAGIVL G+EVKSLR V+ DS+ EN E WL N Y Sbjct: 4 IIPIAENKEAKAKYDILETYEAGIVLKGSEVKSLREKGTVSFKDSFVRIENGEAWLYNLY 63 Query: 70 IPEYLQANRFNHYPRRNRKLLLSKREIHRLYAAVRRDGMTLVPMKIYFNAKGLAKIDLAL 129 I Y A NH P R RKLLL KREI RLY V+ G T++P+K+Y+ K+ +AL Sbjct: 64 IAPYKHATIENHDPLRKRKLLLHKREIMRLYGKVQEKGYTIIPLKLYWK-NNKVKVLIAL 122 Query: 130 AQGKK 134 A+GKK Sbjct: 123 AKGKK 127 >d2gyco1 a.144.2.1 (O:2-116) Ribosomal protein L20 {Escherichia coli [TaxId: 562]} Length = 115 Score = 24.3 bits (53), Expect = 6.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 84 RRNRKLLLSKREIHRLYAAVRRDGMTL 110 RR RK + I R+ AA R++G++ Sbjct: 48 RRQRKRQFRQLWIARINAAARQNGISY 74 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.319 0.134 0.387 Gapped Lambda K H 0.267 0.0713 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 589,403 Number of extensions: 25604 Number of successful extensions: 62 Number of sequences better than 10.0: 1 Number of HSP's gapped: 60 Number of HSP's successfully gapped: 16 Length of query: 159 Length of database: 2,407,596 Length adjustment: 78 Effective length of query: 81 Effective length of database: 1,336,656 Effective search space: 108269136 Effective search space used: 108269136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (22.7 bits)