BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780275|ref|YP_003064688.1| SsrA-binding protein [Candidatus Liberibacter asiaticus str. psy62] (159 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780275|ref|YP_003064688.1| SsrA-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 159 Score = 327 bits (839), Expect = 5e-92, Method: Compositional matrix adjust. Identities = 159/159 (100%), Positives = 159/159 (100%) Query: 1 MSLKSRGNPPKKVVSDNRKARYNYHIVRSFEAGIVLTGTEVKSLRVSKVNISDSYATFEN 60 MSLKSRGNPPKKVVSDNRKARYNYHIVRSFEAGIVLTGTEVKSLRVSKVNISDSYATFEN Sbjct: 1 MSLKSRGNPPKKVVSDNRKARYNYHIVRSFEAGIVLTGTEVKSLRVSKVNISDSYATFEN 60 Query: 61 DEIWLTNSYIPEYLQANRFNHYPRRNRKLLLSKREIHRLYAAVRRDGMTLVPMKIYFNAK 120 DEIWLTNSYIPEYLQANRFNHYPRRNRKLLLSKREIHRLYAAVRRDGMTLVPMKIYFNAK Sbjct: 61 DEIWLTNSYIPEYLQANRFNHYPRRNRKLLLSKREIHRLYAAVRRDGMTLVPMKIYFNAK 120 Query: 121 GLAKIDLALAQGKKNYDKRETEKKRDWDRQKHRILREHN 159 GLAKIDLALAQGKKNYDKRETEKKRDWDRQKHRILREHN Sbjct: 121 GLAKIDLALAQGKKNYDKRETEKKRDWDRQKHRILREHN 159 >gi|254780635|ref|YP_003065048.1| hypothetical protein CLIBASIA_02610 [Candidatus Liberibacter asiaticus str. psy62] Length = 412 Score = 25.4 bits (54), Expect = 0.50, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 18/25 (72%) Query: 53 DSYATFENDEIWLTNSYIPEYLQAN 77 ++YA++ ND I + +SY EY++ N Sbjct: 291 NTYASYLNDVIGIISSYTGEYIRMN 315 >gi|254780813|ref|YP_003065226.1| Maf-like protein [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Score = 24.3 bits (51), Expect = 1.2, Method: Compositional matrix adjust. Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 133 KKNYDKRETEKKRDWDRQK 151 K N D+RE EKK D+ +K Sbjct: 29 KPNIDEREMEKKMDFSERK 47 >gi|254780879|ref|YP_003065292.1| hypothetical protein CLIBASIA_03880 [Candidatus Liberibacter asiaticus str. psy62] Length = 652 Score = 23.5 bits (49), Expect = 2.0, Method: Compositional matrix adjust. Identities = 14/37 (37%), Positives = 18/37 (48%) Query: 91 LSKREIHRLYAAVRRDGMTLVPMKIYFNAKGLAKIDL 127 L+K EI R+ + D T+V IY K L I L Sbjct: 317 LTKDEILRIGVVQKDDKFTIVRFSIYHKQKHLLTIAL 353 >gi|254780859|ref|YP_003065272.1| NADH dehydrogenase subunit G [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Score = 22.3 bits (46), Expect = 4.4, Method: Composition-based stats. Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Query: 6 RGNPPKKVVSDNRKARYNY-HIVRSFEA 32 RGN P V+ D + RY Y H+ EA Sbjct: 403 RGNFPIAVIGDVGELRYKYEHLGNGSEA 430 >gi|254780666|ref|YP_003065079.1| Fmu (Sun) domain protein [Candidatus Liberibacter asiaticus str. psy62] Length = 445 Score = 21.9 bits (45), Expect = 6.2, Method: Compositional matrix adjust. Identities = 8/31 (25%), Positives = 16/31 (51%) Query: 105 RDGMTLVPMKIYFNAKGLAKIDLALAQGKKN 135 +D +P++++ L+ +DL A G K Sbjct: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKT 256 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.134 0.387 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102,555 Number of Sequences: 1233 Number of extensions: 3920 Number of successful extensions: 14 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 10 length of query: 159 length of database: 328,796 effective HSP length: 67 effective length of query: 92 effective length of database: 246,185 effective search space: 22649020 effective search space used: 22649020 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 35 (18.1 bits)